From a855d6202536ff28e5aae4f22a0f31d8f5b325d0 Mon Sep 17 00:00:00 2001 From: Franklin Wei Date: Sat, 21 Jan 2017 15:18:31 -0500 Subject: Port of Duke Nukem 3D This ports Fabien Sanglard's Chocolate Duke to run on a version of SDL for Rockbox. Change-Id: I8f2c4c78af19de10c1633ed7bb7a997b43256dd9 --- apps/plugins/CATEGORIES | 1 + apps/plugins/SOURCES | 5 + apps/plugins/SUBDIRS | 3 +- apps/plugins/duke3d.c | 31 + apps/plugins/lib/stdio_compat.c | 50 +- apps/plugins/lib/stdio_compat.h | 6 +- apps/plugins/sdl/COPYING | 458 + apps/plugins/sdl/CREDITS | 94 + apps/plugins/sdl/NOTES | 5 + apps/plugins/sdl/README | 51 + apps/plugins/sdl/README-SDL.txt | 13 + apps/plugins/sdl/README.Porting | 56 + apps/plugins/sdl/SDL_image/CHANGES | 198 + apps/plugins/sdl/SDL_image/COPYING | 20 + apps/plugins/sdl/SDL_image/IMG.c | 214 + apps/plugins/sdl/SDL_image/IMG_bmp.c | 848 ++ apps/plugins/sdl/SDL_image/IMG_gif.c | 625 ++ apps/plugins/sdl/SDL_image/IMG_jpg.c | 495 + apps/plugins/sdl/SDL_image/IMG_lbm.c | 503 + apps/plugins/sdl/SDL_image/IMG_pcx.c | 276 + apps/plugins/sdl/SDL_image/IMG_png.c | 584 + apps/plugins/sdl/SDL_image/IMG_pnm.c | 258 + apps/plugins/sdl/SDL_image/IMG_tga.c | 336 + apps/plugins/sdl/SDL_image/IMG_tif.c | 298 + apps/plugins/sdl/SDL_image/IMG_webp.c | 295 + apps/plugins/sdl/SDL_image/IMG_xcf.c | 824 ++ apps/plugins/sdl/SDL_image/IMG_xpm.c | 514 + apps/plugins/sdl/SDL_image/IMG_xv.c | 165 + apps/plugins/sdl/SDL_image/IMG_xxx.c | 87 + apps/plugins/sdl/SDL_image/README | 40 + apps/plugins/sdl/SDL_image/showimage.c | 216 + apps/plugins/sdl/SDL_mixer/CHANGES | 348 + apps/plugins/sdl/SDL_mixer/COPYING | 20 + apps/plugins/sdl/SDL_mixer/Makefile.in | 133 + apps/plugins/sdl/SDL_mixer/README | 43 + apps/plugins/sdl/SDL_mixer/dynamic_flac.c | 177 + apps/plugins/sdl/SDL_mixer/dynamic_flac.h | 66 + apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.c | 87 + apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.h | 57 + apps/plugins/sdl/SDL_mixer/dynamic_mod.c | 275 + apps/plugins/sdl/SDL_mixer/dynamic_mod.h | 62 + apps/plugins/sdl/SDL_mixer/dynamic_mp3.c | 171 + apps/plugins/sdl/SDL_mixer/dynamic_mp3.h | 47 + apps/plugins/sdl/SDL_mixer/dynamic_ogg.c | 131 + apps/plugins/sdl/SDL_mixer/dynamic_ogg.h | 53 + apps/plugins/sdl/SDL_mixer/effect_position.c | 1615 +++ apps/plugins/sdl/SDL_mixer/effect_stereoreverse.c | 117 + apps/plugins/sdl/SDL_mixer/effects_internal.c | 121 + apps/plugins/sdl/SDL_mixer/effects_internal.h | 60 + apps/plugins/sdl/SDL_mixer/fluidsynth.c | 219 + apps/plugins/sdl/SDL_mixer/fluidsynth.h | 51 + apps/plugins/sdl/SDL_mixer/load_aiff.c | 247 + apps/plugins/sdl/SDL_mixer/load_aiff.h | 31 + apps/plugins/sdl/SDL_mixer/load_flac.c | 338 + apps/plugins/sdl/SDL_mixer/load_flac.h | 31 + apps/plugins/sdl/SDL_mixer/load_ogg.c | 159 + apps/plugins/sdl/SDL_mixer/load_ogg.h | 31 + apps/plugins/sdl/SDL_mixer/load_voc.c | 458 + apps/plugins/sdl/SDL_mixer/load_voc.h | 36 + apps/plugins/sdl/SDL_mixer/mixer.c | 1484 +++ apps/plugins/sdl/SDL_mixer/music.c | 1599 +++ apps/plugins/sdl/SDL_mixer/music_cmd.c | 241 + apps/plugins/sdl/SDL_mixer/music_cmd.h | 62 + apps/plugins/sdl/SDL_mixer/music_flac.c | 593 + apps/plugins/sdl/SDL_mixer/music_flac.h | 90 + apps/plugins/sdl/SDL_mixer/music_mad.c | 325 + apps/plugins/sdl/SDL_mixer/music_mad.h | 72 + apps/plugins/sdl/SDL_mixer/music_mod.c | 346 + apps/plugins/sdl/SDL_mixer/music_mod.h | 62 + apps/plugins/sdl/SDL_mixer/music_modplug.c | 239 + apps/plugins/sdl/SDL_mixer/music_modplug.h | 42 + apps/plugins/sdl/SDL_mixer/music_ogg.c | 230 + apps/plugins/sdl/SDL_mixer/music_ogg.h | 75 + .../sdl/SDL_mixer/native_midi/native_midi.h | 38 + .../sdl/SDL_mixer/native_midi/native_midi_common.c | 409 + .../sdl/SDL_mixer/native_midi/native_midi_common.h | 63 + .../SDL_mixer/native_midi/native_midi_haiku.cpp | 281 + .../sdl/SDL_mixer/native_midi/native_midi_mac.c | 644 ++ .../sdl/SDL_mixer/native_midi/native_midi_macosx.c | 322 + .../sdl/SDL_mixer/native_midi/native_midi_win32.c | 312 + apps/plugins/sdl/SDL_mixer/playmus.c | 234 + apps/plugins/sdl/SDL_mixer/playwave.c | 497 + apps/plugins/sdl/SDL_mixer/timidity/COPYING | 127 + apps/plugins/sdl/SDL_mixer/timidity/FAQ | 112 + apps/plugins/sdl/SDL_mixer/timidity/README | 57 + apps/plugins/sdl/SDL_mixer/timidity/common.c | 238 + apps/plugins/sdl/SDL_mixer/timidity/common.h | 39 + apps/plugins/sdl/SDL_mixer/timidity/config.h | 229 + apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.c | 26 + apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.h | 74 + apps/plugins/sdl/SDL_mixer/timidity/filter.c | 187 + apps/plugins/sdl/SDL_mixer/timidity/filter.h | 23 + apps/plugins/sdl/SDL_mixer/timidity/instrum.c | 1018 ++ apps/plugins/sdl/SDL_mixer/timidity/instrum.h | 168 + apps/plugins/sdl/SDL_mixer/timidity/mix.c | 847 ++ apps/plugins/sdl/SDL_mixer/timidity/mix.h | 11 + apps/plugins/sdl/SDL_mixer/timidity/output.c | 122 + apps/plugins/sdl/SDL_mixer/timidity/output.h | 60 + apps/plugins/sdl/SDL_mixer/timidity/playmidi.c | 1746 +++ apps/plugins/sdl/SDL_mixer/timidity/playmidi.h | 160 + apps/plugins/sdl/SDL_mixer/timidity/readmidi.c | 1065 ++ apps/plugins/sdl/SDL_mixer/timidity/readmidi.h | 18 + apps/plugins/sdl/SDL_mixer/timidity/resample.c | 730 ++ apps/plugins/sdl/SDL_mixer/timidity/resample.h | 10 + apps/plugins/sdl/SDL_mixer/timidity/sdl_a.c | 19 + apps/plugins/sdl/SDL_mixer/timidity/sdl_c.c | 136 + apps/plugins/sdl/SDL_mixer/timidity/tables.c | 1111 ++ apps/plugins/sdl/SDL_mixer/timidity/tables.h | 35 + apps/plugins/sdl/SDL_mixer/timidity/timidity.c | 359 + apps/plugins/sdl/SDL_mixer/timidity/timidity.h | 20 + apps/plugins/sdl/SDL_mixer/wavestream.c | 521 + apps/plugins/sdl/SDL_mixer/wavestream.h | 60 + apps/plugins/sdl/SOURCES | 129 + apps/plugins/sdl/SOURCES.duke | 41 + apps/plugins/sdl/include/SDL.h | 101 + apps/plugins/sdl/include/SDL_active.h | 63 + apps/plugins/sdl/include/SDL_audio.h | 284 + apps/plugins/sdl/include/SDL_byteorder.h | 29 + apps/plugins/sdl/include/SDL_cdrom.h | 202 + apps/plugins/sdl/include/SDL_config.h | 47 + apps/plugins/sdl/include/SDL_config.h.default | 45 + apps/plugins/sdl/include/SDL_config.h.in | 312 + apps/plugins/sdl/include/SDL_config_dreamcast.h | 106 + apps/plugins/sdl/include/SDL_config_macos.h | 112 + apps/plugins/sdl/include/SDL_config_macosx.h | 150 + apps/plugins/sdl/include/SDL_config_minimal.h | 62 + apps/plugins/sdl/include/SDL_config_nds.h | 115 + apps/plugins/sdl/include/SDL_config_os2.h | 141 + apps/plugins/sdl/include/SDL_config_rockbox.h | 198 + apps/plugins/sdl/include/SDL_config_symbian.h | 146 + apps/plugins/sdl/include/SDL_config_win32.h | 183 + apps/plugins/sdl/include/SDL_copying.h | 22 + apps/plugins/sdl/include/SDL_cpuinfo.h | 69 + apps/plugins/sdl/include/SDL_endian.h | 224 + apps/plugins/sdl/include/SDL_error.h | 72 + apps/plugins/sdl/include/SDL_events.h | 356 + apps/plugins/sdl/include/SDL_getenv.h | 28 + apps/plugins/sdl/include/SDL_image.h | 138 + apps/plugins/sdl/include/SDL_joystick.h | 187 + apps/plugins/sdl/include/SDL_keyboard.h | 135 + apps/plugins/sdl/include/SDL_keysym.h | 326 + apps/plugins/sdl/include/SDL_loadso.h | 78 + apps/plugins/sdl/include/SDL_main.h | 106 + apps/plugins/sdl/include/SDL_mixer.h | 634 ++ apps/plugins/sdl/include/SDL_mouse.h | 143 + apps/plugins/sdl/include/SDL_mutex.h | 177 + apps/plugins/sdl/include/SDL_name.h | 11 + apps/plugins/sdl/include/SDL_opengl.h | 6570 +++++++++++ apps/plugins/sdl/include/SDL_platform.h | 114 + apps/plugins/sdl/include/SDL_quit.h | 55 + apps/plugins/sdl/include/SDL_rwops.h | 155 + apps/plugins/sdl/include/SDL_stdinc.h | 620 ++ apps/plugins/sdl/include/SDL_syswm.h | 226 + apps/plugins/sdl/include/SDL_thread.h | 115 + apps/plugins/sdl/include/SDL_timer.h | 125 + apps/plugins/sdl/include/SDL_types.h | 28 + apps/plugins/sdl/include/SDL_version.h | 91 + apps/plugins/sdl/include/SDL_video.h | 951 ++ apps/plugins/sdl/include/begin_code.h | 196 + apps/plugins/sdl/include/close_code.h | 46 + apps/plugins/sdl/include/doxyfile | 946 ++ apps/plugins/sdl/include/stdio.h | 4 + apps/plugins/sdl/main.c | 301 + apps/plugins/sdl/progs/duke3d/Engine/src/Makefile | 693 ++ .../sdl/progs/duke3d/Engine/src/Makefile.am | 3 + .../sdl/progs/duke3d/Engine/src/Makefile.in | 693 ++ apps/plugins/sdl/progs/duke3d/Engine/src/build.h | 320 + apps/plugins/sdl/progs/duke3d/Engine/src/cache.c | 225 + apps/plugins/sdl/progs/duke3d/Engine/src/cache.h | 34 + apps/plugins/sdl/progs/duke3d/Engine/src/display.c | 1949 ++++ apps/plugins/sdl/progs/duke3d/Engine/src/display.h | 110 + apps/plugins/sdl/progs/duke3d/Engine/src/draw.c | 919 ++ apps/plugins/sdl/progs/duke3d/Engine/src/draw.h | 105 + .../sdl/progs/duke3d/Engine/src/dummy_multi.c | 16 + .../sdl/progs/duke3d/Engine/src/enet/ChangeLog | 177 + .../sdl/progs/duke3d/Engine/src/enet/LICENSE | 7 + .../sdl/progs/duke3d/Engine/src/enet/README | 15 + .../duke3d/Engine/src/enet/include/callbacks.h | 27 + .../progs/duke3d/Engine/src/enet/include/enet.h | 592 + .../progs/duke3d/Engine/src/enet/include/list.h | 43 + .../duke3d/Engine/src/enet/include/protocol.h | 198 + .../progs/duke3d/Engine/src/enet/include/time.h | 18 + .../progs/duke3d/Engine/src/enet/include/types.h | 13 + .../progs/duke3d/Engine/src/enet/include/unix.h | 40 + .../progs/duke3d/Engine/src/enet/include/utility.h | 12 + .../progs/duke3d/Engine/src/enet/include/win32.h | 57 + apps/plugins/sdl/progs/duke3d/Engine/src/engine.c | 9349 ++++++++++++++++ apps/plugins/sdl/progs/duke3d/Engine/src/engine.h | 164 + .../sdl/progs/duke3d/Engine/src/filesystem.c | 877 ++ .../sdl/progs/duke3d/Engine/src/filesystem.h | 49 + .../sdl/progs/duke3d/Engine/src/fixedPoint_math.c | 54 + .../sdl/progs/duke3d/Engine/src/fixedPoint_math.h | 167 + apps/plugins/sdl/progs/duke3d/Engine/src/icon.c | 168 + apps/plugins/sdl/progs/duke3d/Engine/src/icon.h | 5 + .../sdl/progs/duke3d/Engine/src/macos_compat.h | 62 + apps/plugins/sdl/progs/duke3d/Engine/src/mmulti.c | 1707 +++ .../plugins/sdl/progs/duke3d/Engine/src/mmulti.cpp | 1213 ++ .../sdl/progs/duke3d/Engine/src/mmulti_stable.cpp | 1211 ++ .../sdl/progs/duke3d/Engine/src/mmulti_stable.h | 19 + .../sdl/progs/duke3d/Engine/src/mmulti_unstable.h | 19 + apps/plugins/sdl/progs/duke3d/Engine/src/multi.c | 1176 ++ apps/plugins/sdl/progs/duke3d/Engine/src/network.c | 222 + apps/plugins/sdl/progs/duke3d/Engine/src/network.h | 33 + .../plugins/sdl/progs/duke3d/Engine/src/platform.h | 38 + .../sdl/progs/duke3d/Engine/src/rockbox_compat.h | 67 + apps/plugins/sdl/progs/duke3d/Engine/src/tiles.c | 386 + apps/plugins/sdl/progs/duke3d/Engine/src/tiles.h | 73 + .../sdl/progs/duke3d/Engine/src/unix_compat.h | 67 + .../sdl/progs/duke3d/Engine/src/win32_compat.h | 106 + .../sdl/progs/duke3d/Engine/src/windows/inttypes.h | 305 + .../sdl/progs/duke3d/Engine/src/windows/stdint.h | 247 + apps/plugins/sdl/progs/duke3d/Game/src/DbgHelp.h | 2437 +++++ apps/plugins/sdl/progs/duke3d/Game/src/Makefile | 942 ++ apps/plugins/sdl/progs/duke3d/Game/src/Makefile.am | 14 + apps/plugins/sdl/progs/duke3d/Game/src/Makefile.in | 942 ++ apps/plugins/sdl/progs/duke3d/Game/src/_functio.h | 174 + apps/plugins/sdl/progs/duke3d/Game/src/_rts.h | 54 + apps/plugins/sdl/progs/duke3d/Game/src/actors.c | 7157 ++++++++++++ apps/plugins/sdl/progs/duke3d/Game/src/animlib.c | 352 + apps/plugins/sdl/progs/duke3d/Game/src/animlib.h | 155 + .../sdl/progs/duke3d/Game/src/audiolib/Makefile | 546 + .../sdl/progs/duke3d/Game/src/audiolib/Makefile.am | 4 + .../sdl/progs/duke3d/Game/src/audiolib/Makefile.in | 546 + .../sdl/progs/duke3d/Game/src/audiolib/_al_midi.h | 174 + .../sdl/progs/duke3d/Game/src/audiolib/_blaster.h | 133 + .../sdl/progs/duke3d/Game/src/audiolib/_guswave.h | 164 + .../sdl/progs/duke3d/Game/src/audiolib/_midi.h | 290 + .../sdl/progs/duke3d/Game/src/audiolib/_multivc.h | 318 + .../sdl/progs/duke3d/Game/src/audiolib/_pas16.h | 250 + .../sdl/progs/duke3d/Game/src/audiolib/_sndscap.h | 136 + .../sdl/progs/duke3d/Game/src/audiolib/adlibfx.c | 552 + .../sdl/progs/duke3d/Game/src/audiolib/adlibfx.h | 80 + .../sdl/progs/duke3d/Game/src/audiolib/al_midi.c | 1510 +++ .../sdl/progs/duke3d/Game/src/audiolib/al_midi.h | 58 + .../sdl/progs/duke3d/Game/src/audiolib/assert.h | 49 + .../sdl/progs/duke3d/Game/src/audiolib/awe32.c | 540 + .../sdl/progs/duke3d/Game/src/audiolib/awe32.h | 58 + .../sdl/progs/duke3d/Game/src/audiolib/blaster.c | 2330 ++++ .../sdl/progs/duke3d/Game/src/audiolib/blaster.h | 148 + .../sdl/progs/duke3d/Game/src/audiolib/ctaweapi.h | 352 + .../sdl/progs/duke3d/Game/src/audiolib/debugio.c | 251 + .../sdl/progs/duke3d/Game/src/audiolib/debugio.h | 30 + .../sdl/progs/duke3d/Game/src/audiolib/dma.c | 379 + .../sdl/progs/duke3d/Game/src/audiolib/dma.h | 83 + .../sdl/progs/duke3d/Game/src/audiolib/dpmi.c | 250 + .../sdl/progs/duke3d/Game/src/audiolib/dpmi.h | 86 + .../sdl/progs/duke3d/Game/src/audiolib/dsl.c | 231 + .../sdl/progs/duke3d/Game/src/audiolib/dsl.h | 28 + .../sdl/progs/duke3d/Game/src/audiolib/fx_man.c | 1058 ++ .../sdl/progs/duke3d/Game/src/audiolib/fx_man.h | 140 + .../sdl/progs/duke3d/Game/src/audiolib/gmtimbre.c | 290 + .../sdl/progs/duke3d/Game/src/audiolib/gus.c | 283 + .../sdl/progs/duke3d/Game/src/audiolib/gusmidi.c | 561 + .../sdl/progs/duke3d/Game/src/audiolib/gusmidi.h | 59 + .../sdl/progs/duke3d/Game/src/audiolib/guswave.c | 1773 +++ .../sdl/progs/duke3d/Game/src/audiolib/guswave.h | 75 + .../sdl/progs/duke3d/Game/src/audiolib/interrup.h | 50 + .../sdl/progs/duke3d/Game/src/audiolib/irq.c | 325 + .../sdl/progs/duke3d/Game/src/audiolib/irq.h | 54 + .../sdl/progs/duke3d/Game/src/audiolib/leetimbr.c | 290 + .../sdl/progs/duke3d/Game/src/audiolib/linklist.h | 118 + .../sdl/progs/duke3d/Game/src/audiolib/ll_man.c | 173 + .../sdl/progs/duke3d/Game/src/audiolib/ll_man.h | 76 + .../sdl/progs/duke3d/Game/src/audiolib/memcheck.h | 20 + .../sdl/progs/duke3d/Game/src/audiolib/midi.c | 2265 ++++ .../sdl/progs/duke3d/Game/src/audiolib/midi.h | 98 + .../sdl/progs/duke3d/Game/src/audiolib/mpu401.c | 451 + .../sdl/progs/duke3d/Game/src/audiolib/mpu401.h | 61 + .../sdl/progs/duke3d/Game/src/audiolib/multivoc.c | 3404 ++++++ .../sdl/progs/duke3d/Game/src/audiolib/multivoc.h | 130 + .../sdl/progs/duke3d/Game/src/audiolib/music.c | 1035 ++ .../sdl/progs/duke3d/Game/src/audiolib/music.h | 99 + .../sdl/progs/duke3d/Game/src/audiolib/mv_mix.asm | 505 + .../sdl/progs/duke3d/Game/src/audiolib/mv_mix.c | 483 + .../progs/duke3d/Game/src/audiolib/mv_mix16.asm | 524 + .../progs/duke3d/Game/src/audiolib/mvreverb.asm | 181 + .../sdl/progs/duke3d/Game/src/audiolib/mvreverb.c | 312 + .../sdl/progs/duke3d/Game/src/audiolib/myprint.c | 310 + .../sdl/progs/duke3d/Game/src/audiolib/myprint.h | 43 + .../sdl/progs/duke3d/Game/src/audiolib/newgf1.h | 431 + .../sdl/progs/duke3d/Game/src/audiolib/nodpmi.c | 166 + .../sdl/progs/duke3d/Game/src/audiolib/nomusic.c | 115 + .../sdl/progs/duke3d/Game/src/audiolib/pas16.c | 1924 ++++ .../sdl/progs/duke3d/Game/src/audiolib/pas16.h | 81 + .../sdl/progs/duke3d/Game/src/audiolib/pitch.c | 258 + .../sdl/progs/duke3d/Game/src/audiolib/pitch.h | 47 + .../sdl/progs/duke3d/Game/src/audiolib/sndcards.h | 55 + .../sdl/progs/duke3d/Game/src/audiolib/sndscape.c | 1661 +++ .../sdl/progs/duke3d/Game/src/audiolib/sndscape.h | 73 + .../sdl/progs/duke3d/Game/src/audiolib/sndsrc.c | 658 ++ .../sdl/progs/duke3d/Game/src/audiolib/sndsrc.h | 70 + .../sdl/progs/duke3d/Game/src/audiolib/standard.h | 72 + .../sdl/progs/duke3d/Game/src/audiolib/task_man.c | 976 ++ .../sdl/progs/duke3d/Game/src/audiolib/task_man.h | 68 + .../sdl/progs/duke3d/Game/src/audiolib/user.c | 100 + .../sdl/progs/duke3d/Game/src/audiolib/user.h | 38 + .../sdl/progs/duke3d/Game/src/audiolib/usrhooks.c | 84 + .../sdl/progs/duke3d/Game/src/audiolib/usrhooks.h | 57 + .../sdl/progs/duke3d/Game/src/audiolib/util.h | 13 + apps/plugins/sdl/progs/duke3d/Game/src/config.c | 897 ++ apps/plugins/sdl/progs/duke3d/Game/src/config.h | 46 + apps/plugins/sdl/progs/duke3d/Game/src/console.c | 630 ++ apps/plugins/sdl/progs/duke3d/Game/src/console.h | 19 + apps/plugins/sdl/progs/duke3d/Game/src/control.c | 930 ++ apps/plugins/sdl/progs/duke3d/Game/src/control.h | 265 + apps/plugins/sdl/progs/duke3d/Game/src/cvar_defs.c | 357 + apps/plugins/sdl/progs/duke3d/Game/src/cvar_defs.h | 43 + apps/plugins/sdl/progs/duke3d/Game/src/cvars.c | 53 + apps/plugins/sdl/progs/duke3d/Game/src/cvars.h | 29 + apps/plugins/sdl/progs/duke3d/Game/src/develop.h | 65 + apps/plugins/sdl/progs/duke3d/Game/src/duke3d.h | 695 ++ .../sdl/progs/duke3d/Game/src/dukerockbox.h | 94 + apps/plugins/sdl/progs/duke3d/Game/src/dukeunix.h | 100 + apps/plugins/sdl/progs/duke3d/Game/src/dukewin.h | 86 + .../sdl/progs/duke3d/Game/src/dummy_audiolib.c | 215 + apps/plugins/sdl/progs/duke3d/Game/src/file_lib.h | 260 + apps/plugins/sdl/progs/duke3d/Game/src/funct.h | 593 + apps/plugins/sdl/progs/duke3d/Game/src/function.h | 106 + apps/plugins/sdl/progs/duke3d/Game/src/game.c | 10966 +++++++++++++++++++ apps/plugins/sdl/progs/duke3d/Game/src/game.h | 8 + apps/plugins/sdl/progs/duke3d/Game/src/gamedef.c | 3316 ++++++ apps/plugins/sdl/progs/duke3d/Game/src/gamedefs.h | 131 + apps/plugins/sdl/progs/duke3d/Game/src/global.c | 931 ++ apps/plugins/sdl/progs/duke3d/Game/src/global.h | 80 + apps/plugins/sdl/progs/duke3d/Game/src/joystick.h | 19 + apps/plugins/sdl/progs/duke3d/Game/src/keyboard.c | 441 + apps/plugins/sdl/progs/duke3d/Game/src/keyboard.h | 224 + apps/plugins/sdl/progs/duke3d/Game/src/menues.c | 4707 ++++++++ .../sdl/progs/duke3d/Game/src/midi/sdl_midi.c | 191 + apps/plugins/sdl/progs/duke3d/Game/src/mouse.h | 51 + apps/plugins/sdl/progs/duke3d/Game/src/names.h | 754 ++ apps/plugins/sdl/progs/duke3d/Game/src/player.c | 4462 ++++++++ apps/plugins/sdl/progs/duke3d/Game/src/premap.c | 1728 +++ apps/plugins/sdl/progs/duke3d/Game/src/premap.h | 17 + apps/plugins/sdl/progs/duke3d/Game/src/rts.c | 240 + apps/plugins/sdl/progs/duke3d/Game/src/rts.h | 84 + apps/plugins/sdl/progs/duke3d/Game/src/scriplib.c | 1065 ++ apps/plugins/sdl/progs/duke3d/Game/src/scriplib.h | 373 + apps/plugins/sdl/progs/duke3d/Game/src/sector.c | 3249 ++++++ .../sdl/progs/duke3d/Game/src/sounddebugdefs.h | 8 + apps/plugins/sdl/progs/duke3d/Game/src/soundefs.h | 1233 +++ apps/plugins/sdl/progs/duke3d/Game/src/sounds.c | 681 ++ apps/plugins/sdl/progs/duke3d/Game/src/sounds.h | 62 + apps/plugins/sdl/progs/duke3d/Game/src/types.h | 101 + apps/plugins/sdl/progs/duke3d/Game/src/util_lib.h | 77 + apps/plugins/sdl/redefines.txt | 469 + apps/plugins/sdl/sdl.make | 56 + apps/plugins/sdl/src/SDL.c | 350 + apps/plugins/sdl/src/SDL_error.c | 238 + apps/plugins/sdl/src/SDL_error_c.h | 58 + apps/plugins/sdl/src/SDL_fatal.c | 134 + apps/plugins/sdl/src/SDL_fatal.h | 28 + apps/plugins/sdl/src/audio/SDL_audio.c | 707 ++ apps/plugins/sdl/src/audio/SDL_audio_c.h | 35 + apps/plugins/sdl/src/audio/SDL_audiocvt.c | 1510 +++ apps/plugins/sdl/src/audio/SDL_audiodev.c | 179 + apps/plugins/sdl/src/audio/SDL_audiodev_c.h | 26 + apps/plugins/sdl/src/audio/SDL_audiomem.h | 25 + apps/plugins/sdl/src/audio/SDL_mixer.c | 264 + apps/plugins/sdl/src/audio/SDL_mixer_MMX.c | 207 + apps/plugins/sdl/src/audio/SDL_mixer_MMX.h | 17 + apps/plugins/sdl/src/audio/SDL_mixer_MMX_VC.c | 183 + apps/plugins/sdl/src/audio/SDL_mixer_MMX_VC.h | 38 + apps/plugins/sdl/src/audio/SDL_mixer_m68k.c | 210 + apps/plugins/sdl/src/audio/SDL_mixer_m68k.h | 36 + apps/plugins/sdl/src/audio/SDL_sysaudio.h | 189 + apps/plugins/sdl/src/audio/SDL_wave.c | 596 + apps/plugins/sdl/src/audio/SDL_wave.h | 62 + apps/plugins/sdl/src/audio/alsa/SDL_alsa_audio.c | 619 ++ apps/plugins/sdl/src/audio/alsa/SDL_alsa_audio.h | 48 + apps/plugins/sdl/src/audio/arts/SDL_artsaudio.c | 362 + apps/plugins/sdl/src/audio/arts/SDL_artsaudio.h | 60 + apps/plugins/sdl/src/audio/baudio/SDL_beaudio.cc | 225 + apps/plugins/sdl/src/audio/baudio/SDL_beaudio.h | 39 + apps/plugins/sdl/src/audio/bsd/SDL_bsdaudio.c | 404 + apps/plugins/sdl/src/audio/bsd/SDL_bsdaudio.h | 58 + apps/plugins/sdl/src/audio/dart/SDL_dart.c | 441 + apps/plugins/sdl/src/audio/dart/SDL_dart.h | 63 + apps/plugins/sdl/src/audio/dc/SDL_dcaudio.c | 246 + apps/plugins/sdl/src/audio/dc/SDL_dcaudio.h | 41 + apps/plugins/sdl/src/audio/dc/aica.c | 271 + apps/plugins/sdl/src/audio/dc/aica.h | 40 + apps/plugins/sdl/src/audio/disk/SDL_diskaudio.c | 186 + apps/plugins/sdl/src/audio/disk/SDL_diskaudio.h | 41 + apps/plugins/sdl/src/audio/dma/SDL_dmaaudio.c | 455 + apps/plugins/sdl/src/audio/dma/SDL_dmaaudio.h | 59 + apps/plugins/sdl/src/audio/dmedia/SDL_irixaudio.c | 242 + apps/plugins/sdl/src/audio/dmedia/SDL_irixaudio.h | 45 + apps/plugins/sdl/src/audio/dsp/SDL_dspaudio.c | 340 + apps/plugins/sdl/src/audio/dsp/SDL_dspaudio.h | 53 + apps/plugins/sdl/src/audio/dummy/SDL_dummyaudio.c | 156 + apps/plugins/sdl/src/audio/dummy/SDL_dummyaudio.h | 40 + apps/plugins/sdl/src/audio/esd/SDL_esdaudio.c | 323 + apps/plugins/sdl/src/audio/esd/SDL_esdaudio.h | 57 + apps/plugins/sdl/src/audio/macosx/SDL_coreaudio.c | 291 + apps/plugins/sdl/src/audio/macosx/SDL_coreaudio.h | 45 + apps/plugins/sdl/src/audio/macrom/SDL_romaudio.c | 496 + apps/plugins/sdl/src/audio/macrom/SDL_romaudio.h | 50 + apps/plugins/sdl/src/audio/mint/SDL_mintaudio.c | 215 + apps/plugins/sdl/src/audio/mint/SDL_mintaudio.h | 121 + .../sdl/src/audio/mint/SDL_mintaudio_dma8.c | 357 + .../sdl/src/audio/mint/SDL_mintaudio_dma8.h | 85 + .../sdl/src/audio/mint/SDL_mintaudio_gsxb.c | 436 + .../sdl/src/audio/mint/SDL_mintaudio_gsxb.h | 104 + apps/plugins/sdl/src/audio/mint/SDL_mintaudio_it.S | 386 + .../sdl/src/audio/mint/SDL_mintaudio_mcsn.c | 405 + .../sdl/src/audio/mint/SDL_mintaudio_mcsn.h | 59 + .../sdl/src/audio/mint/SDL_mintaudio_stfa.c | 326 + .../sdl/src/audio/mint/SDL_mintaudio_stfa.h | 97 + .../sdl/src/audio/mint/SDL_mintaudio_xbios.c | 490 + apps/plugins/sdl/src/audio/mme/SDL_mmeaudio.c | 264 + apps/plugins/sdl/src/audio/mme/SDL_mmeaudio.h | 51 + apps/plugins/sdl/src/audio/nas/SDL_nasaudio.c | 423 + apps/plugins/sdl/src/audio/nas/SDL_nasaudio.h | 62 + apps/plugins/sdl/src/audio/nds/SDL_ndsaudio.c | 335 + apps/plugins/sdl/src/audio/nds/SDL_ndsaudio.h | 40 + apps/plugins/sdl/src/audio/nds/sound9.c | 61 + apps/plugins/sdl/src/audio/nds/soundcommon.h | 80 + apps/plugins/sdl/src/audio/nto/SDL_nto_audio.c | 507 + apps/plugins/sdl/src/audio/nto/SDL_nto_audio.h | 68 + apps/plugins/sdl/src/audio/paudio/SDL_paudio.c | 511 + apps/plugins/sdl/src/audio/paudio/SDL_paudio.h | 57 + apps/plugins/sdl/src/audio/pulse/SDL_pulseaudio.c | 570 + apps/plugins/sdl/src/audio/pulse/SDL_pulseaudio.h | 73 + .../sdl/src/audio/rockbox/SDL_rockboxaudio.c | 271 + .../sdl/src/audio/rockbox/SDL_rockboxaudio.h | 50 + apps/plugins/sdl/src/audio/sun/SDL_sunaudio.c | 432 + apps/plugins/sdl/src/audio/sun/SDL_sunaudio.h | 55 + .../sdl/src/audio/symbian/SDL_epocaudio.cpp | 614 ++ apps/plugins/sdl/src/audio/symbian/SDL_epocaudio.h | 37 + .../plugins/sdl/src/audio/symbian/streamplayer.cpp | 279 + apps/plugins/sdl/src/audio/symbian/streamplayer.h | 89 + apps/plugins/sdl/src/audio/ums/SDL_umsaudio.c | 547 + apps/plugins/sdl/src/audio/ums/SDL_umsaudio.h | 50 + apps/plugins/sdl/src/audio/windib/SDL_dibaudio.c | 322 + apps/plugins/sdl/src/audio/windib/SDL_dibaudio.h | 49 + apps/plugins/sdl/src/audio/windx5/SDL_dx5audio.c | 705 ++ apps/plugins/sdl/src/audio/windx5/SDL_dx5audio.h | 55 + apps/plugins/sdl/src/audio/windx5/directx.h | 81 + apps/plugins/sdl/src/cdrom/SDL_cdrom.c | 341 + apps/plugins/sdl/src/cdrom/SDL_syscdrom.h | 76 + apps/plugins/sdl/src/cdrom/aix/SDL_syscdrom.c | 660 ++ apps/plugins/sdl/src/cdrom/beos/SDL_syscdrom.cc | 410 + apps/plugins/sdl/src/cdrom/bsdi/SDL_syscdrom.c | 542 + apps/plugins/sdl/src/cdrom/dc/SDL_syscdrom.c | 167 + apps/plugins/sdl/src/cdrom/dummy/SDL_syscdrom.c | 41 + apps/plugins/sdl/src/cdrom/freebsd/SDL_syscdrom.c | 406 + apps/plugins/sdl/src/cdrom/linux/SDL_syscdrom.c | 564 + apps/plugins/sdl/src/cdrom/macos/SDL_syscdrom.c | 525 + apps/plugins/sdl/src/cdrom/macos/SDL_syscdrom_c.h | 140 + .../plugins/sdl/src/cdrom/macosx/AudioFilePlayer.c | 360 + .../plugins/sdl/src/cdrom/macosx/AudioFilePlayer.h | 178 + .../sdl/src/cdrom/macosx/AudioFileReaderThread.c | 610 ++ apps/plugins/sdl/src/cdrom/macosx/CDPlayer.c | 636 ++ apps/plugins/sdl/src/cdrom/macosx/CDPlayer.h | 69 + apps/plugins/sdl/src/cdrom/macosx/SDLOSXCAGuard.c | 199 + apps/plugins/sdl/src/cdrom/macosx/SDLOSXCAGuard.h | 116 + apps/plugins/sdl/src/cdrom/macosx/SDL_syscdrom.c | 514 + apps/plugins/sdl/src/cdrom/macosx/SDL_syscdrom_c.h | 136 + apps/plugins/sdl/src/cdrom/mint/SDL_syscdrom.c | 317 + apps/plugins/sdl/src/cdrom/openbsd/SDL_syscdrom.c | 416 + apps/plugins/sdl/src/cdrom/os2/SDL_syscdrom.c | 393 + apps/plugins/sdl/src/cdrom/osf/SDL_syscdrom.c | 444 + apps/plugins/sdl/src/cdrom/qnx/SDL_syscdrom.c | 551 + apps/plugins/sdl/src/cdrom/win32/SDL_syscdrom.c | 386 + apps/plugins/sdl/src/cpuinfo/SDL_cpuinfo.c | 499 + apps/plugins/sdl/src/events/SDL_active.c | 95 + apps/plugins/sdl/src/events/SDL_events.c | 501 + apps/plugins/sdl/src/events/SDL_events_c.h | 83 + apps/plugins/sdl/src/events/SDL_expose.c | 51 + apps/plugins/sdl/src/events/SDL_keyboard.c | 614 ++ apps/plugins/sdl/src/events/SDL_mouse.c | 268 + apps/plugins/sdl/src/events/SDL_quit.c | 124 + apps/plugins/sdl/src/events/SDL_resize.c | 71 + apps/plugins/sdl/src/events/SDL_sysevents.h | 46 + apps/plugins/sdl/src/file/SDL_rwops.c | 681 ++ apps/plugins/sdl/src/hermes/COPYING.LIB | 438 + apps/plugins/sdl/src/hermes/HeadMMX.h | 100 + apps/plugins/sdl/src/hermes/HeadX86.h | 186 + apps/plugins/sdl/src/hermes/README | 13 + apps/plugins/sdl/src/hermes/common.inc | 9 + apps/plugins/sdl/src/hermes/mmx_main.asm | 74 + apps/plugins/sdl/src/hermes/mmxp2_32.asm | 405 + apps/plugins/sdl/src/hermes/x86_main.asm | 75 + apps/plugins/sdl/src/hermes/x86p_16.asm | 490 + apps/plugins/sdl/src/hermes/x86p_32.asm | 1044 ++ apps/plugins/sdl/src/joystick/SDL_joystick.c | 606 + apps/plugins/sdl/src/joystick/SDL_joystick_c.h | 38 + apps/plugins/sdl/src/joystick/SDL_sysjoystick.h | 82 + .../sdl/src/joystick/beos/SDL_bejoystick.cc | 237 + .../plugins/sdl/src/joystick/bsd/SDL_sysjoystick.c | 608 + .../sdl/src/joystick/darwin/SDL_sysjoystick.c | 842 ++ apps/plugins/sdl/src/joystick/dc/SDL_sysjoystick.c | 193 + .../sdl/src/joystick/dummy/SDL_sysjoystick.c | 83 + .../sdl/src/joystick/linux/SDL_sysjoystick.c | 1218 ++ .../sdl/src/joystick/macos/SDL_sysjoystick.c | 320 + .../sdl/src/joystick/mint/SDL_sysjoystick.c | 826 ++ .../plugins/sdl/src/joystick/nds/SDL_sysjoystick.c | 150 + .../sdl/src/joystick/riscos/SDL_sysjoystick.c | 176 + .../sdl/src/joystick/win32/SDL_mmjoystick.c | 407 + apps/plugins/sdl/src/loadso/beos/SDL_sysloadso.c | 72 + apps/plugins/sdl/src/loadso/dlopen/SDL_sysloadso.c | 69 + apps/plugins/sdl/src/loadso/dummy/SDL_sysloadso.c | 50 + apps/plugins/sdl/src/loadso/macos/SDL_sysloadso.c | 106 + apps/plugins/sdl/src/loadso/macosx/SDL_dlcompat.c | 1407 +++ apps/plugins/sdl/src/loadso/mint/SDL_sysloadso.c | 62 + apps/plugins/sdl/src/loadso/os2/SDL_sysloadso.c | 71 + apps/plugins/sdl/src/loadso/win32/SDL_sysloadso.c | 139 + apps/plugins/sdl/src/main/beos/SDL_BeApp.cc | 111 + apps/plugins/sdl/src/main/beos/SDL_BeApp.h | 33 + apps/plugins/sdl/src/main/dummy/SDL_dummy_main.c | 13 + apps/plugins/sdl/src/main/macos/SDL.r | 1 + apps/plugins/sdl/src/main/macos/SDL.shlib.r | 1 + apps/plugins/sdl/src/main/macos/SDL_main.c | 610 ++ apps/plugins/sdl/src/main/macos/SIZE.r | 1 + apps/plugins/sdl/src/main/macos/exports/Makefile | 39 + apps/plugins/sdl/src/main/macos/exports/SDL.x | 1 + apps/plugins/sdl/src/main/macos/exports/gendef.pl | 43 + apps/plugins/sdl/src/main/macosx/Info.plist.in | 24 + apps/plugins/sdl/src/main/macosx/SDLMain.h | 16 + apps/plugins/sdl/src/main/macosx/SDLMain.m | 381 + .../sdl/src/main/macosx/SDLMain.nib/classes.nib | 12 + .../sdl/src/main/macosx/SDLMain.nib/info.nib | 12 + .../sdl/src/main/macosx/SDLMain.nib/objects.nib | Bin 0 -> 1701 bytes apps/plugins/sdl/src/main/macosx/info.nib | 1 + .../plugins/sdl/src/main/qtopia/SDL_qtopia_main.cc | 47 + .../plugins/sdl/src/main/symbian/EKA1/SDL_main.cpp | 152 + .../plugins/sdl/src/main/symbian/EKA2/SDL_main.cpp | 1035 ++ apps/plugins/sdl/src/main/symbian/EKA2/sdlexe.cpp | 809 ++ apps/plugins/sdl/src/main/symbian/EKA2/sdllib.cpp | 12 + .../sdl/src/main/symbian/EKA2/vectorbuffer.cpp | 62 + .../sdl/src/main/symbian/EKA2/vectorbuffer.h | 240 + apps/plugins/sdl/src/main/win32/SDL_win32_main.c | 402 + apps/plugins/sdl/src/main/win32/version.rc | 38 + apps/plugins/sdl/src/stdlib/SDL_getenv.c | 247 + apps/plugins/sdl/src/stdlib/SDL_iconv.c | 881 ++ apps/plugins/sdl/src/stdlib/SDL_malloc.c | 5111 +++++++++ apps/plugins/sdl/src/stdlib/SDL_qsort.c | 443 + apps/plugins/sdl/src/stdlib/SDL_stdlib.c | 620 ++ apps/plugins/sdl/src/stdlib/SDL_string.c | 1248 +++ apps/plugins/sdl/src/thread/SDL_systhread.h | 52 + apps/plugins/sdl/src/thread/SDL_thread.c | 300 + apps/plugins/sdl/src/thread/SDL_thread_c.h | 66 + apps/plugins/sdl/src/thread/beos/SDL_syssem.c | 142 + apps/plugins/sdl/src/thread/beos/SDL_systhread.c | 96 + apps/plugins/sdl/src/thread/beos/SDL_systhread_c.h | 31 + apps/plugins/sdl/src/thread/dc/SDL_syscond.c | 215 + apps/plugins/sdl/src/thread/dc/SDL_syscond_c.h | 23 + apps/plugins/sdl/src/thread/dc/SDL_sysmutex.c | 122 + apps/plugins/sdl/src/thread/dc/SDL_sysmutex_c.h | 23 + apps/plugins/sdl/src/thread/dc/SDL_syssem.c | 173 + apps/plugins/sdl/src/thread/dc/SDL_syssem_c.h | 23 + apps/plugins/sdl/src/thread/dc/SDL_systhread.c | 60 + apps/plugins/sdl/src/thread/dc/SDL_systhread_c.h | 24 + apps/plugins/sdl/src/thread/generic/SDL_syscond.c | 215 + apps/plugins/sdl/src/thread/generic/SDL_sysmutex.c | 129 + .../sdl/src/thread/generic/SDL_sysmutex_c.h | 23 + apps/plugins/sdl/src/thread/generic/SDL_syssem.c | 211 + .../plugins/sdl/src/thread/generic/SDL_systhread.c | 54 + .../sdl/src/thread/generic/SDL_systhread_c.h | 25 + apps/plugins/sdl/src/thread/irix/SDL_syssem.c | 219 + apps/plugins/sdl/src/thread/irix/SDL_systhread.c | 85 + apps/plugins/sdl/src/thread/irix/SDL_systhread_c.h | 27 + apps/plugins/sdl/src/thread/os2/SDL_syscond.c | 215 + apps/plugins/sdl/src/thread/os2/SDL_syscond_c.h | 23 + apps/plugins/sdl/src/thread/os2/SDL_sysmutex.c | 108 + apps/plugins/sdl/src/thread/os2/SDL_syssem.c | 192 + apps/plugins/sdl/src/thread/os2/SDL_systhread.c | 108 + apps/plugins/sdl/src/thread/os2/SDL_systhread_c.h | 28 + apps/plugins/sdl/src/thread/pth/SDL_syscond.c | 164 + apps/plugins/sdl/src/thread/pth/SDL_sysmutex.c | 87 + apps/plugins/sdl/src/thread/pth/SDL_sysmutex_c.h | 31 + apps/plugins/sdl/src/thread/pth/SDL_systhread.c | 103 + apps/plugins/sdl/src/thread/pth/SDL_systhread_c.h | 31 + apps/plugins/sdl/src/thread/pthread/SDL_syscond.c | 155 + apps/plugins/sdl/src/thread/pthread/SDL_sysmutex.c | 153 + .../sdl/src/thread/pthread/SDL_sysmutex_c.h | 31 + apps/plugins/sdl/src/thread/pthread/SDL_syssem.c | 190 + .../plugins/sdl/src/thread/pthread/SDL_systhread.c | 120 + .../sdl/src/thread/pthread/SDL_systhread_c.h | 26 + apps/plugins/sdl/src/thread/riscos/SDL_syscond.c | 160 + apps/plugins/sdl/src/thread/riscos/SDL_sysmutex.c | 153 + .../plugins/sdl/src/thread/riscos/SDL_sysmutex_c.h | 34 + apps/plugins/sdl/src/thread/riscos/SDL_syssem.c | 203 + apps/plugins/sdl/src/thread/riscos/SDL_systhread.c | 144 + .../sdl/src/thread/riscos/SDL_systhread_c.h | 34 + apps/plugins/sdl/src/thread/rockbox/SDL_syscond.c | 215 + apps/plugins/sdl/src/thread/rockbox/SDL_sysmutex.c | 120 + .../sdl/src/thread/rockbox/SDL_sysmutex_c.h | 23 + apps/plugins/sdl/src/thread/rockbox/SDL_syssem.c | 170 + .../plugins/sdl/src/thread/rockbox/SDL_systhread.c | 89 + .../sdl/src/thread/rockbox/SDL_systhread_c.h | 24 + .../sdl/src/thread/symbian/SDL_sysmutex.cpp | 130 + apps/plugins/sdl/src/thread/symbian/SDL_syssem.cpp | 214 + .../sdl/src/thread/symbian/SDL_systhread.cpp | 146 + .../sdl/src/thread/symbian/SDL_systhread_c.h | 30 + apps/plugins/sdl/src/thread/win32/SDL_sysmutex.c | 95 + apps/plugins/sdl/src/thread/win32/SDL_syssem.c | 164 + apps/plugins/sdl/src/thread/win32/SDL_systhread.c | 162 + .../plugins/sdl/src/thread/win32/SDL_systhread_c.h | 28 + .../sdl/src/thread/win32/win_ce_semaphore.c | 216 + .../sdl/src/thread/win32/win_ce_semaphore.h | 22 + apps/plugins/sdl/src/timer/SDL_systimer.h | 40 + apps/plugins/sdl/src/timer/SDL_timer.c | 285 + apps/plugins/sdl/src/timer/SDL_timer_c.h | 46 + apps/plugins/sdl/src/timer/beos/SDL_systimer.c | 95 + apps/plugins/sdl/src/timer/dc/SDL_systimer.c | 100 + apps/plugins/sdl/src/timer/dummy/SDL_systimer.c | 91 + apps/plugins/sdl/src/timer/macos/FastTimes.c | 352 + apps/plugins/sdl/src/timer/macos/FastTimes.h | 27 + apps/plugins/sdl/src/timer/macos/SDL_MPWtimer.c | 152 + apps/plugins/sdl/src/timer/macos/SDL_systimer.c | 186 + apps/plugins/sdl/src/timer/mint/SDL_systimer.c | 149 + apps/plugins/sdl/src/timer/mint/SDL_vbltimer.S | 228 + apps/plugins/sdl/src/timer/mint/SDL_vbltimer_s.h | 35 + apps/plugins/sdl/src/timer/nds/SDL_systimer.c | 73 + apps/plugins/sdl/src/timer/os2/SDL_systimer.c | 227 + apps/plugins/sdl/src/timer/riscos/SDL_systimer.c | 233 + apps/plugins/sdl/src/timer/rockbox/SDL_systimer.c | 117 + .../plugins/sdl/src/timer/symbian/SDL_systimer.cpp | 114 + apps/plugins/sdl/src/timer/unix/SDL_systimer.c | 240 + apps/plugins/sdl/src/timer/win32/SDL_systimer.c | 160 + apps/plugins/sdl/src/timer/wince/SDL_systimer.c | 198 + apps/plugins/sdl/src/video/SDL_RLEaccel.c | 1941 ++++ apps/plugins/sdl/src/video/SDL_RLEaccel_c.h | 31 + apps/plugins/sdl/src/video/SDL_blit.c | 360 + apps/plugins/sdl/src/video/SDL_blit.h | 528 + apps/plugins/sdl/src/video/SDL_blit_0.c | 471 + apps/plugins/sdl/src/video/SDL_blit_1.c | 523 + apps/plugins/sdl/src/video/SDL_blit_A.c | 2873 +++++ apps/plugins/sdl/src/video/SDL_blit_N.c | 2492 +++++ apps/plugins/sdl/src/video/SDL_bmp.c | 549 + apps/plugins/sdl/src/video/SDL_cursor.c | 758 ++ apps/plugins/sdl/src/video/SDL_cursor_c.h | 73 + apps/plugins/sdl/src/video/SDL_gamma.c | 233 + apps/plugins/sdl/src/video/SDL_glfuncs.h | 341 + apps/plugins/sdl/src/video/SDL_leaks.h | 31 + apps/plugins/sdl/src/video/SDL_pixels.c | 626 ++ apps/plugins/sdl/src/video/SDL_pixels_c.h | 46 + apps/plugins/sdl/src/video/SDL_stretch.c | 358 + apps/plugins/sdl/src/video/SDL_stretch_c.h | 29 + apps/plugins/sdl/src/video/SDL_surface.c | 941 ++ apps/plugins/sdl/src/video/SDL_sysvideo.h | 427 + apps/plugins/sdl/src/video/SDL_video.c | 1978 ++++ apps/plugins/sdl/src/video/SDL_yuv.c | 150 + apps/plugins/sdl/src/video/SDL_yuv_mmx.c | 428 + apps/plugins/sdl/src/video/SDL_yuv_sw.c | 1299 +++ apps/plugins/sdl/src/video/SDL_yuv_sw_c.h | 37 + apps/plugins/sdl/src/video/SDL_yuvfuncs.h | 37 + apps/plugins/sdl/src/video/Xext/README | 10 + apps/plugins/sdl/src/video/Xext/XME/xme.c | 410 + .../plugins/sdl/src/video/Xext/Xinerama/Xinerama.c | 324 + apps/plugins/sdl/src/video/Xext/Xv/Xv.c | 1151 ++ apps/plugins/sdl/src/video/Xext/Xv/Xvlibint.h | 81 + apps/plugins/sdl/src/video/Xext/Xxf86dga/XF86DGA.c | 721 ++ .../plugins/sdl/src/video/Xext/Xxf86dga/XF86DGA2.c | 993 ++ .../plugins/sdl/src/video/Xext/Xxf86vm/XF86VMode.c | 1226 +++ apps/plugins/sdl/src/video/Xext/extensions/Xext.h | 50 + .../sdl/src/video/Xext/extensions/Xinerama.h | 46 + apps/plugins/sdl/src/video/Xext/extensions/Xv.h | 129 + apps/plugins/sdl/src/video/Xext/extensions/Xvlib.h | 433 + .../sdl/src/video/Xext/extensions/Xvproto.h | 604 + .../sdl/src/video/Xext/extensions/extutil.h | 226 + .../sdl/src/video/Xext/extensions/panoramiXext.h | 52 + .../sdl/src/video/Xext/extensions/panoramiXproto.h | 192 + .../sdl/src/video/Xext/extensions/xf86dga.h | 265 + .../sdl/src/video/Xext/extensions/xf86dga1.h | 169 + .../sdl/src/video/Xext/extensions/xf86dga1str.h | 194 + .../sdl/src/video/Xext/extensions/xf86dgastr.h | 344 + .../sdl/src/video/Xext/extensions/xf86vmode.h | 314 + .../sdl/src/video/Xext/extensions/xf86vmstr.h | 546 + apps/plugins/sdl/src/video/Xext/extensions/xme.h | 45 + apps/plugins/sdl/src/video/aalib/SDL_aaevents.c | 202 + apps/plugins/sdl/src/video/aalib/SDL_aaevents_c.h | 35 + apps/plugins/sdl/src/video/aalib/SDL_aamouse.c | 35 + apps/plugins/sdl/src/video/aalib/SDL_aamouse_c.h | 26 + apps/plugins/sdl/src/video/aalib/SDL_aavideo.c | 388 + apps/plugins/sdl/src/video/aalib/SDL_aavideo.h | 66 + .../sdl/src/video/ataricommon/SDL_ataric2p.S | 452 + .../sdl/src/video/ataricommon/SDL_ataric2p_s.h | 75 + .../sdl/src/video/ataricommon/SDL_ataridevmouse.c | 159 + .../src/video/ataricommon/SDL_ataridevmouse_c.h | 42 + .../sdl/src/video/ataricommon/SDL_atarieddi.S | 42 + .../sdl/src/video/ataricommon/SDL_atarieddi_s.h | 54 + .../sdl/src/video/ataricommon/SDL_atarievents.c | 234 + .../sdl/src/video/ataricommon/SDL_atarievents_c.h | 52 + .../sdl/src/video/ataricommon/SDL_atarigl.c | 1086 ++ .../sdl/src/video/ataricommon/SDL_atarigl_c.h | 109 + .../sdl/src/video/ataricommon/SDL_atarikeys.h | 140 + .../sdl/src/video/ataricommon/SDL_atarimxalloc.c | 52 + .../sdl/src/video/ataricommon/SDL_atarimxalloc_c.h | 37 + .../sdl/src/video/ataricommon/SDL_atarisuper.h | 61 + .../sdl/src/video/ataricommon/SDL_biosevents.c | 131 + .../sdl/src/video/ataricommon/SDL_biosevents_c.h | 42 + .../sdl/src/video/ataricommon/SDL_gemdosevents.c | 132 + .../sdl/src/video/ataricommon/SDL_gemdosevents_c.h | 42 + .../sdl/src/video/ataricommon/SDL_ikbdevents.c | 124 + .../sdl/src/video/ataricommon/SDL_ikbdevents_c.h | 42 + .../sdl/src/video/ataricommon/SDL_ikbdinterrupt.S | 404 + .../src/video/ataricommon/SDL_ikbdinterrupt_s.h | 61 + .../sdl/src/video/ataricommon/SDL_xbiosevents.c | 155 + .../sdl/src/video/ataricommon/SDL_xbiosevents_c.h | 48 + .../sdl/src/video/ataricommon/SDL_xbiosinterrupt.S | 212 + .../src/video/ataricommon/SDL_xbiosinterrupt_s.h | 52 + apps/plugins/sdl/src/video/blank_cursor.h | 33 + apps/plugins/sdl/src/video/bwindow/SDL_BView.h | 116 + apps/plugins/sdl/src/video/bwindow/SDL_BWin.h | 290 + apps/plugins/sdl/src/video/bwindow/SDL_lowvideo.h | 58 + .../plugins/sdl/src/video/bwindow/SDL_sysevents.cc | 415 + .../sdl/src/video/bwindow/SDL_sysevents_c.h | 31 + apps/plugins/sdl/src/video/bwindow/SDL_sysmouse.cc | 153 + .../plugins/sdl/src/video/bwindow/SDL_sysmouse_c.h | 33 + apps/plugins/sdl/src/video/bwindow/SDL_sysvideo.cc | 841 ++ apps/plugins/sdl/src/video/bwindow/SDL_syswm.cc | 92 + apps/plugins/sdl/src/video/bwindow/SDL_syswm_c.h | 32 + apps/plugins/sdl/src/video/bwindow/SDL_sysyuv.cc | 314 + apps/plugins/sdl/src/video/bwindow/SDL_sysyuv.h | 73 + apps/plugins/sdl/src/video/caca/SDL_cacaevents.c | 101 + apps/plugins/sdl/src/video/caca/SDL_cacaevents_c.h | 35 + apps/plugins/sdl/src/video/caca/SDL_cacavideo.c | 304 + apps/plugins/sdl/src/video/caca/SDL_cacavideo.h | 76 + apps/plugins/sdl/src/video/dc/SDL_dcevents.c | 152 + apps/plugins/sdl/src/video/dc/SDL_dcevents_c.h | 33 + apps/plugins/sdl/src/video/dc/SDL_dcmouse.c | 35 + apps/plugins/sdl/src/video/dc/SDL_dcmouse_c.h | 26 + apps/plugins/sdl/src/video/dc/SDL_dcvideo.c | 445 + apps/plugins/sdl/src/video/dc/SDL_dcvideo.h | 42 + apps/plugins/sdl/src/video/default_cursor.h | 116 + apps/plugins/sdl/src/video/dga/SDL_dgaevents.c | 163 + apps/plugins/sdl/src/video/dga/SDL_dgaevents_c.h | 28 + apps/plugins/sdl/src/video/dga/SDL_dgamouse.c | 35 + apps/plugins/sdl/src/video/dga/SDL_dgamouse_c.h | 26 + apps/plugins/sdl/src/video/dga/SDL_dgavideo.c | 1101 ++ apps/plugins/sdl/src/video/dga/SDL_dgavideo.h | 124 + .../sdl/src/video/directfb/SDL_DirectFB_events.c | 219 + .../sdl/src/video/directfb/SDL_DirectFB_events.h | 29 + .../sdl/src/video/directfb/SDL_DirectFB_keys.h | 135 + .../sdl/src/video/directfb/SDL_DirectFB_video.c | 1171 ++ .../sdl/src/video/directfb/SDL_DirectFB_video.h | 62 + .../sdl/src/video/directfb/SDL_DirectFB_yuv.c | 290 + .../sdl/src/video/directfb/SDL_DirectFB_yuv.h | 38 + apps/plugins/sdl/src/video/dummy/SDL_nullevents.c | 45 + .../plugins/sdl/src/video/dummy/SDL_nullevents_c.h | 33 + apps/plugins/sdl/src/video/dummy/SDL_nullmouse.c | 33 + apps/plugins/sdl/src/video/dummy/SDL_nullmouse_c.h | 26 + apps/plugins/sdl/src/video/dummy/SDL_nullvideo.c | 239 + apps/plugins/sdl/src/video/dummy/SDL_nullvideo.h | 40 + apps/plugins/sdl/src/video/e_log.h | 140 + apps/plugins/sdl/src/video/e_pow.h | 302 + apps/plugins/sdl/src/video/e_sqrt.h | 493 + apps/plugins/sdl/src/video/fbcon/3dfx_mmio.h | 56 + apps/plugins/sdl/src/video/fbcon/3dfx_regs.h | 83 + apps/plugins/sdl/src/video/fbcon/SDL_fb3dfx.c | 215 + apps/plugins/sdl/src/video/fbcon/SDL_fb3dfx.h | 29 + apps/plugins/sdl/src/video/fbcon/SDL_fbelo.c | 442 + apps/plugins/sdl/src/video/fbcon/SDL_fbelo.h | 55 + apps/plugins/sdl/src/video/fbcon/SDL_fbevents.c | 1254 +++ apps/plugins/sdl/src/video/fbcon/SDL_fbevents_c.h | 38 + apps/plugins/sdl/src/video/fbcon/SDL_fbkeys.h | 139 + apps/plugins/sdl/src/video/fbcon/SDL_fbmatrox.c | 280 + apps/plugins/sdl/src/video/fbcon/SDL_fbmatrox.h | 29 + apps/plugins/sdl/src/video/fbcon/SDL_fbmouse.c | 33 + apps/plugins/sdl/src/video/fbcon/SDL_fbmouse_c.h | 26 + apps/plugins/sdl/src/video/fbcon/SDL_fbriva.c | 222 + apps/plugins/sdl/src/video/fbcon/SDL_fbriva.h | 36 + apps/plugins/sdl/src/video/fbcon/SDL_fbvideo.c | 1982 ++++ apps/plugins/sdl/src/video/fbcon/SDL_fbvideo.h | 200 + apps/plugins/sdl/src/video/fbcon/matrox_mmio.h | 51 + apps/plugins/sdl/src/video/fbcon/matrox_regs.h | 376 + apps/plugins/sdl/src/video/fbcon/riva_mmio.h | 449 + apps/plugins/sdl/src/video/fbcon/riva_regs.h | 43 + apps/plugins/sdl/src/video/gapi/SDL_gapivideo.c | 1287 +++ apps/plugins/sdl/src/video/gapi/SDL_gapivideo.h | 160 + apps/plugins/sdl/src/video/gem/SDL_gemevents.c | 375 + apps/plugins/sdl/src/video/gem/SDL_gemevents_c.h | 33 + apps/plugins/sdl/src/video/gem/SDL_gemmouse.c | 205 + apps/plugins/sdl/src/video/gem/SDL_gemmouse_c.h | 34 + apps/plugins/sdl/src/video/gem/SDL_gemvideo.c | 1337 +++ apps/plugins/sdl/src/video/gem/SDL_gemvideo.h | 191 + apps/plugins/sdl/src/video/gem/SDL_gemwm.c | 116 + apps/plugins/sdl/src/video/gem/SDL_gemwm_c.h | 37 + apps/plugins/sdl/src/video/ggi/SDL_ggievents.c | 264 + apps/plugins/sdl/src/video/ggi/SDL_ggievents_c.h | 29 + apps/plugins/sdl/src/video/ggi/SDL_ggikeys.h | 135 + apps/plugins/sdl/src/video/ggi/SDL_ggimouse.c | 32 + apps/plugins/sdl/src/video/ggi/SDL_ggimouse_c.h | 26 + apps/plugins/sdl/src/video/ggi/SDL_ggivideo.c | 378 + apps/plugins/sdl/src/video/ggi/SDL_ggivideo.h | 48 + apps/plugins/sdl/src/video/ipod/SDL_ipodvideo.c | 733 ++ apps/plugins/sdl/src/video/ipod/SDL_ipodvideo.h | 38 + .../plugins/sdl/src/video/maccommon/SDL_lowvideo.h | 102 + .../sdl/src/video/maccommon/SDL_macevents.c | 746 ++ .../sdl/src/video/maccommon/SDL_macevents_c.h | 32 + apps/plugins/sdl/src/video/maccommon/SDL_macgl.c | 197 + apps/plugins/sdl/src/video/maccommon/SDL_macgl_c.h | 47 + apps/plugins/sdl/src/video/maccommon/SDL_mackeys.h | 140 + .../plugins/sdl/src/video/maccommon/SDL_macmouse.c | 129 + .../sdl/src/video/maccommon/SDL_macmouse_c.h | 34 + apps/plugins/sdl/src/video/maccommon/SDL_macwm.c | 442 + apps/plugins/sdl/src/video/maccommon/SDL_macwm_c.h | 41 + apps/plugins/sdl/src/video/macdsp/SDL_dspvideo.c | 1422 +++ apps/plugins/sdl/src/video/macdsp/SDL_dspvideo.h | 54 + apps/plugins/sdl/src/video/macrom/SDL_romvideo.c | 745 ++ apps/plugins/sdl/src/video/macrom/SDL_romvideo.h | 29 + apps/plugins/sdl/src/video/math_private.h | 173 + apps/plugins/sdl/src/video/mmx.h | 704 ++ apps/plugins/sdl/src/video/nanox/SDL_nxevents.c | 382 + apps/plugins/sdl/src/video/nanox/SDL_nxevents_c.h | 32 + apps/plugins/sdl/src/video/nanox/SDL_nximage.c | 230 + apps/plugins/sdl/src/video/nanox/SDL_nximage_c.h | 35 + apps/plugins/sdl/src/video/nanox/SDL_nxmodes.c | 84 + apps/plugins/sdl/src/video/nanox/SDL_nxmodes_c.h | 34 + apps/plugins/sdl/src/video/nanox/SDL_nxmouse.c | 79 + apps/plugins/sdl/src/video/nanox/SDL_nxmouse_c.h | 29 + apps/plugins/sdl/src/video/nanox/SDL_nxvideo.c | 544 + apps/plugins/sdl/src/video/nanox/SDL_nxvideo.h | 96 + apps/plugins/sdl/src/video/nanox/SDL_nxwm.c | 61 + apps/plugins/sdl/src/video/nanox/SDL_nxwm_c.h | 32 + apps/plugins/sdl/src/video/nds/SDL_ndsevents.c | 83 + apps/plugins/sdl/src/video/nds/SDL_ndsevents_c.h | 51 + apps/plugins/sdl/src/video/nds/SDL_ndsmouse.c | 34 + apps/plugins/sdl/src/video/nds/SDL_ndsmouse_c.h | 26 + apps/plugins/sdl/src/video/nds/SDL_ndsvideo.c | 500 + apps/plugins/sdl/src/video/nds/SDL_ndsvideo.h | 61 + apps/plugins/sdl/src/video/os2fslib/SDL_os2fslib.c | 3018 +++++ apps/plugins/sdl/src/video/os2fslib/SDL_os2fslib.h | 71 + apps/plugins/sdl/src/video/os2fslib/SDL_vkeys.h | 74 + apps/plugins/sdl/src/video/photon/SDL_ph_events.c | 624 ++ .../plugins/sdl/src/video/photon/SDL_ph_events_c.h | 37 + apps/plugins/sdl/src/video/photon/SDL_ph_gl.c | 406 + apps/plugins/sdl/src/video/photon/SDL_ph_gl.h | 41 + apps/plugins/sdl/src/video/photon/SDL_ph_image.c | 1059 ++ apps/plugins/sdl/src/video/photon/SDL_ph_image_c.h | 59 + apps/plugins/sdl/src/video/photon/SDL_ph_modes.c | 390 + apps/plugins/sdl/src/video/photon/SDL_ph_modes_c.h | 43 + apps/plugins/sdl/src/video/photon/SDL_ph_mouse.c | 220 + apps/plugins/sdl/src/video/photon/SDL_ph_mouse_c.h | 39 + apps/plugins/sdl/src/video/photon/SDL_ph_video.c | 648 ++ apps/plugins/sdl/src/video/photon/SDL_ph_video.h | 157 + apps/plugins/sdl/src/video/photon/SDL_ph_wm.c | 118 + apps/plugins/sdl/src/video/photon/SDL_ph_wm_c.h | 37 + apps/plugins/sdl/src/video/photon/SDL_phyuv.c | 504 + apps/plugins/sdl/src/video/photon/SDL_phyuv_c.h | 62 + apps/plugins/sdl/src/video/picogui/SDL_pgevents.c | 117 + .../plugins/sdl/src/video/picogui/SDL_pgevents_c.h | 37 + apps/plugins/sdl/src/video/picogui/SDL_pgvideo.c | 364 + apps/plugins/sdl/src/video/picogui/SDL_pgvideo.h | 50 + apps/plugins/sdl/src/video/ps2gs/SDL_gsevents.c | 977 ++ apps/plugins/sdl/src/video/ps2gs/SDL_gsevents_c.h | 38 + apps/plugins/sdl/src/video/ps2gs/SDL_gskeys.h | 139 + apps/plugins/sdl/src/video/ps2gs/SDL_gsmouse.c | 146 + apps/plugins/sdl/src/video/ps2gs/SDL_gsmouse_c.h | 37 + apps/plugins/sdl/src/video/ps2gs/SDL_gsvideo.c | 689 ++ apps/plugins/sdl/src/video/ps2gs/SDL_gsvideo.h | 95 + apps/plugins/sdl/src/video/ps2gs/SDL_gsyuv.c | 461 + apps/plugins/sdl/src/video/ps2gs/SDL_gsyuv_c.h | 37 + apps/plugins/sdl/src/video/ps3/SDL_ps3events.c | 44 + apps/plugins/sdl/src/video/ps3/SDL_ps3events_c.h | 41 + apps/plugins/sdl/src/video/ps3/SDL_ps3video.c | 621 ++ apps/plugins/sdl/src/video/ps3/SDL_ps3video.h | 165 + apps/plugins/sdl/src/video/ps3/SDL_ps3yuv.c | 340 + apps/plugins/sdl/src/video/ps3/SDL_ps3yuv_c.h | 44 + apps/plugins/sdl/src/video/ps3/spulibs/Makefile | 83 + .../sdl/src/video/ps3/spulibs/bilin_scaler.c | 2050 ++++ apps/plugins/sdl/src/video/ps3/spulibs/fb_writer.c | 193 + .../plugins/sdl/src/video/ps3/spulibs/spu_common.h | 108 + .../sdl/src/video/ps3/spulibs/yuv2rgb_converter.c | 629 ++ apps/plugins/sdl/src/video/qtopia/SDL_QPEApp.cc | 63 + apps/plugins/sdl/src/video/qtopia/SDL_QPEApp.h | 33 + apps/plugins/sdl/src/video/qtopia/SDL_QWin.cc | 527 + apps/plugins/sdl/src/video/qtopia/SDL_QWin.h | 110 + apps/plugins/sdl/src/video/qtopia/SDL_lowvideo.h | 65 + apps/plugins/sdl/src/video/qtopia/SDL_sysevents.cc | 269 + .../plugins/sdl/src/video/qtopia/SDL_sysevents_c.h | 31 + apps/plugins/sdl/src/video/qtopia/SDL_sysmouse.cc | 56 + apps/plugins/sdl/src/video/qtopia/SDL_sysmouse_c.h | 32 + apps/plugins/sdl/src/video/qtopia/SDL_sysvideo.cc | 403 + apps/plugins/sdl/src/video/qtopia/SDL_syswm.cc | 35 + apps/plugins/sdl/src/video/qtopia/SDL_syswm_c.h | 28 + apps/plugins/sdl/src/video/quartz/CGS.h | 84 + .../sdl/src/video/quartz/SDL_QuartzEvents.m | 1063 ++ apps/plugins/sdl/src/video/quartz/SDL_QuartzGL.m | 292 + apps/plugins/sdl/src/video/quartz/SDL_QuartzKeys.h | 146 + .../plugins/sdl/src/video/quartz/SDL_QuartzVideo.h | 229 + .../plugins/sdl/src/video/quartz/SDL_QuartzVideo.m | 1689 +++ apps/plugins/sdl/src/video/quartz/SDL_QuartzWM.h | 27 + apps/plugins/sdl/src/video/quartz/SDL_QuartzWM.m | 444 + .../sdl/src/video/quartz/SDL_QuartzWindow.h | 51 + .../sdl/src/video/quartz/SDL_QuartzWindow.m | 231 + apps/plugins/sdl/src/video/riscos/SDL_riscosASM.S | 116 + .../src/video/riscos/SDL_riscosFullScreenVideo.c | 777 ++ .../sdl/src/video/riscos/SDL_riscosevents.c | 549 + .../sdl/src/video/riscos/SDL_riscosevents_c.h | 34 + .../plugins/sdl/src/video/riscos/SDL_riscosmouse.c | 371 + .../sdl/src/video/riscos/SDL_riscosmouse_c.h | 44 + .../sdl/src/video/riscos/SDL_riscossprite.c | 265 + apps/plugins/sdl/src/video/riscos/SDL_riscostask.c | 350 + apps/plugins/sdl/src/video/riscos/SDL_riscostask.h | 39 + .../plugins/sdl/src/video/riscos/SDL_riscosvideo.c | 316 + .../plugins/sdl/src/video/riscos/SDL_riscosvideo.h | 62 + apps/plugins/sdl/src/video/riscos/SDL_wimppoll.c | 330 + apps/plugins/sdl/src/video/riscos/SDL_wimpvideo.c | 501 + .../sdl/src/video/rockbox/SDL_rockboxvideo.c | 793 ++ .../sdl/src/video/rockbox/SDL_rockboxvideo.h | 44 + apps/plugins/sdl/src/video/rockbox/keymaps_extra.h | 40 + apps/plugins/sdl/src/video/svga/SDL_svgaevents.c | 412 + apps/plugins/sdl/src/video/svga/SDL_svgaevents_c.h | 35 + apps/plugins/sdl/src/video/svga/SDL_svgamouse.c | 33 + apps/plugins/sdl/src/video/svga/SDL_svgamouse_c.h | 26 + apps/plugins/sdl/src/video/svga/SDL_svgavideo.c | 584 + apps/plugins/sdl/src/video/svga/SDL_svgavideo.h | 58 + .../sdl/src/video/symbian/EKA1/SDL_epocevents.cpp | 626 ++ .../sdl/src/video/symbian/EKA1/SDL_epocvideo.cpp | 1356 +++ .../sdl/src/video/symbian/EKA1/SDL_epocvideo.h | 34 + .../sdl/src/video/symbian/EKA2/SDL_epocevents.cpp | 521 + .../sdl/src/video/symbian/EKA2/SDL_epocvideo.cpp | 594 + .../sdl/src/video/symbian/EKA2/SDL_epocvideo.h | 51 + apps/plugins/sdl/src/video/symbian/EKA2/dsa.cpp | 1505 +++ .../plugins/sdl/src/video/symbian/EKA2/dsa_new.cpp | 1443 +++ .../plugins/sdl/src/video/symbian/EKA2/dsa_old.cpp | 1075 ++ .../sdl/src/video/symbian/SDL_epocevents_c.h | 60 + apps/plugins/sdl/src/video/vgl/SDL_vglevents.c | 299 + apps/plugins/sdl/src/video/vgl/SDL_vglevents_c.h | 155 + apps/plugins/sdl/src/video/vgl/SDL_vglmouse.c | 56 + apps/plugins/sdl/src/video/vgl/SDL_vglmouse_c.h | 32 + apps/plugins/sdl/src/video/vgl/SDL_vglvideo.c | 624 ++ apps/plugins/sdl/src/video/vgl/SDL_vglvideo.h | 65 + .../plugins/sdl/src/video/wincommon/SDL_lowvideo.h | 152 + .../sdl/src/video/wincommon/SDL_sysevents.c | 855 ++ .../plugins/sdl/src/video/wincommon/SDL_sysmouse.c | 259 + .../sdl/src/video/wincommon/SDL_sysmouse_c.h | 33 + apps/plugins/sdl/src/video/wincommon/SDL_syswm.c | 297 + apps/plugins/sdl/src/video/wincommon/SDL_syswm_c.h | 35 + apps/plugins/sdl/src/video/wincommon/SDL_wingl.c | 659 ++ apps/plugins/sdl/src/video/wincommon/SDL_wingl_c.h | 135 + apps/plugins/sdl/src/video/wincommon/wmmsg.h | 1030 ++ apps/plugins/sdl/src/video/windib/SDL_dibevents.c | 704 ++ .../plugins/sdl/src/video/windib/SDL_dibevents_c.h | 35 + apps/plugins/sdl/src/video/windib/SDL_dibvideo.c | 1323 +++ apps/plugins/sdl/src/video/windib/SDL_dibvideo.h | 59 + .../sdl/src/video/windib/SDL_gapidibvideo.h | 56 + apps/plugins/sdl/src/video/windib/SDL_vkeys.h | 75 + apps/plugins/sdl/src/video/windx5/SDL_dx5events.c | 1005 ++ .../plugins/sdl/src/video/windx5/SDL_dx5events_c.h | 37 + apps/plugins/sdl/src/video/windx5/SDL_dx5video.c | 2537 +++++ apps/plugins/sdl/src/video/windx5/SDL_dx5video.h | 61 + apps/plugins/sdl/src/video/windx5/SDL_dx5yuv.c | 296 + apps/plugins/sdl/src/video/windx5/SDL_dx5yuv_c.h | 38 + apps/plugins/sdl/src/video/windx5/directx.h | 97 + .../sdl/src/video/wscons/SDL_wsconsevents.c | 233 + .../sdl/src/video/wscons/SDL_wsconsevents_c.h | 36 + .../plugins/sdl/src/video/wscons/SDL_wsconsmouse.c | 33 + .../sdl/src/video/wscons/SDL_wsconsmouse_c.h | 26 + .../plugins/sdl/src/video/wscons/SDL_wsconsvideo.c | 609 + .../plugins/sdl/src/video/wscons/SDL_wsconsvideo.h | 76 + apps/plugins/sdl/src/video/x11/SDL_x11dga.c | 90 + apps/plugins/sdl/src/video/x11/SDL_x11dga_c.h | 33 + apps/plugins/sdl/src/video/x11/SDL_x11dyn.c | 222 + apps/plugins/sdl/src/video/x11/SDL_x11dyn.h | 93 + apps/plugins/sdl/src/video/x11/SDL_x11events.c | 1414 +++ apps/plugins/sdl/src/video/x11/SDL_x11events_c.h | 34 + apps/plugins/sdl/src/video/x11/SDL_x11gamma.c | 142 + apps/plugins/sdl/src/video/x11/SDL_x11gamma_c.h | 32 + apps/plugins/sdl/src/video/x11/SDL_x11gl.c | 577 + apps/plugins/sdl/src/video/x11/SDL_x11gl_c.h | 99 + apps/plugins/sdl/src/video/x11/SDL_x11image.c | 316 + apps/plugins/sdl/src/video/x11/SDL_x11image_c.h | 38 + apps/plugins/sdl/src/video/x11/SDL_x11modes.c | 1143 ++ apps/plugins/sdl/src/video/x11/SDL_x11modes_c.h | 43 + apps/plugins/sdl/src/video/x11/SDL_x11mouse.c | 288 + apps/plugins/sdl/src/video/x11/SDL_x11mouse_c.h | 33 + apps/plugins/sdl/src/video/x11/SDL_x11sym.h | 201 + apps/plugins/sdl/src/video/x11/SDL_x11video.c | 1571 +++ apps/plugins/sdl/src/video/x11/SDL_x11video.h | 214 + apps/plugins/sdl/src/video/x11/SDL_x11wm.c | 434 + apps/plugins/sdl/src/video/x11/SDL_x11wm_c.h | 34 + apps/plugins/sdl/src/video/x11/SDL_x11yuv.c | 538 + apps/plugins/sdl/src/video/x11/SDL_x11yuv_c.h | 41 + apps/plugins/sdl/src/video/xbios/SDL_xbios.c | 1116 ++ apps/plugins/sdl/src/video/xbios/SDL_xbios.h | 111 + .../plugins/sdl/src/video/xbios/SDL_xbios_blowup.c | 77 + .../plugins/sdl/src/video/xbios/SDL_xbios_blowup.h | 86 + .../sdl/src/video/xbios/SDL_xbios_centscreen.c | 104 + .../sdl/src/video/xbios/SDL_xbios_centscreen.h | 114 + apps/plugins/sdl/src/video/xbios/SDL_xbios_milan.c | 106 + apps/plugins/sdl/src/video/xbios/SDL_xbios_milan.h | 129 + apps/plugins/sdl/src/video/xbios/SDL_xbios_sb3.c | 83 + apps/plugins/sdl/src/video/xbios/SDL_xbios_sb3.h | 82 + .../sdl/src/video/xbios/SDL_xbios_tveille.c | 63 + .../sdl/src/video/xbios/SDL_xbios_tveille.h | 64 + apps/plugins/sdl/wrappers.c | 1343 +++ 991 files changed, 336917 insertions(+), 13 deletions(-) create mode 100644 apps/plugins/duke3d.c create mode 100644 apps/plugins/sdl/COPYING create mode 100644 apps/plugins/sdl/CREDITS create mode 100644 apps/plugins/sdl/NOTES create mode 100644 apps/plugins/sdl/README create mode 100644 apps/plugins/sdl/README-SDL.txt create mode 100644 apps/plugins/sdl/README.Porting create mode 100644 apps/plugins/sdl/SDL_image/CHANGES create mode 100644 apps/plugins/sdl/SDL_image/COPYING create mode 100644 apps/plugins/sdl/SDL_image/IMG.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_bmp.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_gif.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_jpg.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_lbm.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_pcx.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_png.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_pnm.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_tga.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_tif.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_webp.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_xcf.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_xpm.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_xv.c create mode 100644 apps/plugins/sdl/SDL_image/IMG_xxx.c create mode 100644 apps/plugins/sdl/SDL_image/README create mode 100644 apps/plugins/sdl/SDL_image/showimage.c create mode 100644 apps/plugins/sdl/SDL_mixer/CHANGES create mode 100644 apps/plugins/sdl/SDL_mixer/COPYING create mode 100644 apps/plugins/sdl/SDL_mixer/Makefile.in create mode 100644 apps/plugins/sdl/SDL_mixer/README create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_flac.c create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_flac.h create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.c create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.h create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_mod.c create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_mod.h create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_mp3.c create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_mp3.h create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_ogg.c create mode 100644 apps/plugins/sdl/SDL_mixer/dynamic_ogg.h create mode 100644 apps/plugins/sdl/SDL_mixer/effect_position.c create mode 100644 apps/plugins/sdl/SDL_mixer/effect_stereoreverse.c create mode 100644 apps/plugins/sdl/SDL_mixer/effects_internal.c create mode 100644 apps/plugins/sdl/SDL_mixer/effects_internal.h create mode 100644 apps/plugins/sdl/SDL_mixer/fluidsynth.c create mode 100644 apps/plugins/sdl/SDL_mixer/fluidsynth.h create mode 100644 apps/plugins/sdl/SDL_mixer/load_aiff.c create mode 100644 apps/plugins/sdl/SDL_mixer/load_aiff.h create mode 100644 apps/plugins/sdl/SDL_mixer/load_flac.c create mode 100644 apps/plugins/sdl/SDL_mixer/load_flac.h create mode 100644 apps/plugins/sdl/SDL_mixer/load_ogg.c create mode 100644 apps/plugins/sdl/SDL_mixer/load_ogg.h create mode 100644 apps/plugins/sdl/SDL_mixer/load_voc.c create mode 100644 apps/plugins/sdl/SDL_mixer/load_voc.h create mode 100644 apps/plugins/sdl/SDL_mixer/mixer.c create mode 100644 apps/plugins/sdl/SDL_mixer/music.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_cmd.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_cmd.h create mode 100644 apps/plugins/sdl/SDL_mixer/music_flac.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_flac.h create mode 100644 apps/plugins/sdl/SDL_mixer/music_mad.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_mad.h create mode 100644 apps/plugins/sdl/SDL_mixer/music_mod.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_mod.h create mode 100644 apps/plugins/sdl/SDL_mixer/music_modplug.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_modplug.h create mode 100644 apps/plugins/sdl/SDL_mixer/music_ogg.c create mode 100644 apps/plugins/sdl/SDL_mixer/music_ogg.h create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi.h create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.c create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.h create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi_haiku.cpp create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi_mac.c create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi_macosx.c create mode 100644 apps/plugins/sdl/SDL_mixer/native_midi/native_midi_win32.c create mode 100644 apps/plugins/sdl/SDL_mixer/playmus.c create mode 100644 apps/plugins/sdl/SDL_mixer/playwave.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/COPYING create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/FAQ create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/README create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/common.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/common.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/config.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/filter.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/filter.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/instrum.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/instrum.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/mix.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/mix.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/output.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/output.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/playmidi.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/playmidi.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/readmidi.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/readmidi.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/resample.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/resample.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/sdl_a.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/sdl_c.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/tables.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/tables.h create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/timidity.c create mode 100644 apps/plugins/sdl/SDL_mixer/timidity/timidity.h create mode 100644 apps/plugins/sdl/SDL_mixer/wavestream.c create mode 100644 apps/plugins/sdl/SDL_mixer/wavestream.h create mode 100644 apps/plugins/sdl/SOURCES create mode 100644 apps/plugins/sdl/SOURCES.duke create mode 100644 apps/plugins/sdl/include/SDL.h create mode 100644 apps/plugins/sdl/include/SDL_active.h create mode 100644 apps/plugins/sdl/include/SDL_audio.h create mode 100644 apps/plugins/sdl/include/SDL_byteorder.h create mode 100644 apps/plugins/sdl/include/SDL_cdrom.h create mode 100644 apps/plugins/sdl/include/SDL_config.h create mode 100644 apps/plugins/sdl/include/SDL_config.h.default create mode 100644 apps/plugins/sdl/include/SDL_config.h.in create mode 100644 apps/plugins/sdl/include/SDL_config_dreamcast.h create mode 100644 apps/plugins/sdl/include/SDL_config_macos.h create mode 100644 apps/plugins/sdl/include/SDL_config_macosx.h create mode 100644 apps/plugins/sdl/include/SDL_config_minimal.h create mode 100644 apps/plugins/sdl/include/SDL_config_nds.h create mode 100644 apps/plugins/sdl/include/SDL_config_os2.h create mode 100644 apps/plugins/sdl/include/SDL_config_rockbox.h create mode 100644 apps/plugins/sdl/include/SDL_config_symbian.h create mode 100644 apps/plugins/sdl/include/SDL_config_win32.h create mode 100644 apps/plugins/sdl/include/SDL_copying.h create mode 100644 apps/plugins/sdl/include/SDL_cpuinfo.h create mode 100644 apps/plugins/sdl/include/SDL_endian.h create mode 100644 apps/plugins/sdl/include/SDL_error.h create mode 100644 apps/plugins/sdl/include/SDL_events.h create mode 100644 apps/plugins/sdl/include/SDL_getenv.h create mode 100644 apps/plugins/sdl/include/SDL_image.h create mode 100644 apps/plugins/sdl/include/SDL_joystick.h create mode 100644 apps/plugins/sdl/include/SDL_keyboard.h create mode 100644 apps/plugins/sdl/include/SDL_keysym.h create mode 100644 apps/plugins/sdl/include/SDL_loadso.h create mode 100644 apps/plugins/sdl/include/SDL_main.h create mode 100644 apps/plugins/sdl/include/SDL_mixer.h create mode 100644 apps/plugins/sdl/include/SDL_mouse.h create mode 100644 apps/plugins/sdl/include/SDL_mutex.h create mode 100644 apps/plugins/sdl/include/SDL_name.h create mode 100644 apps/plugins/sdl/include/SDL_opengl.h create mode 100644 apps/plugins/sdl/include/SDL_platform.h create mode 100644 apps/plugins/sdl/include/SDL_quit.h create mode 100644 apps/plugins/sdl/include/SDL_rwops.h create mode 100644 apps/plugins/sdl/include/SDL_stdinc.h create mode 100644 apps/plugins/sdl/include/SDL_syswm.h create mode 100644 apps/plugins/sdl/include/SDL_thread.h create mode 100644 apps/plugins/sdl/include/SDL_timer.h create mode 100644 apps/plugins/sdl/include/SDL_types.h create mode 100644 apps/plugins/sdl/include/SDL_version.h create mode 100644 apps/plugins/sdl/include/SDL_video.h create mode 100644 apps/plugins/sdl/include/begin_code.h create mode 100644 apps/plugins/sdl/include/close_code.h create mode 100644 apps/plugins/sdl/include/doxyfile create mode 100644 apps/plugins/sdl/include/stdio.h create mode 100644 apps/plugins/sdl/main.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/Makefile create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/Makefile.am create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/Makefile.in create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/build.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/cache.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/cache.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/display.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/display.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/draw.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/draw.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/dummy_multi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/ChangeLog create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/LICENSE create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/README create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/callbacks.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/enet.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/list.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/protocol.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/time.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/types.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/unix.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/utility.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/enet/include/win32.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/engine.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/engine.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/filesystem.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/filesystem.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/fixedPoint_math.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/fixedPoint_math.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/icon.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/icon.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/macos_compat.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/mmulti.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/mmulti.cpp create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/mmulti_stable.cpp create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/mmulti_stable.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/mmulti_unstable.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/multi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/network.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/network.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/platform.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/rockbox_compat.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/tiles.c create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/tiles.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/unix_compat.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/win32_compat.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/windows/inttypes.h create mode 100644 apps/plugins/sdl/progs/duke3d/Engine/src/windows/stdint.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/DbgHelp.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/Makefile create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/Makefile.am create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/Makefile.in create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/_functio.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/_rts.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/actors.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/animlib.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/animlib.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/Makefile create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/Makefile.am create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/Makefile.in create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_al_midi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_blaster.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_guswave.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_midi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_multivc.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_pas16.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/_sndscap.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/adlibfx.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/adlibfx.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/al_midi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/al_midi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/assert.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/awe32.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/awe32.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/blaster.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/blaster.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/ctaweapi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/debugio.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/debugio.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/dma.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/dma.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/dpmi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/dpmi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/dsl.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/dsl.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/fx_man.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/fx_man.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/gmtimbre.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/gus.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/gusmidi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/gusmidi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/guswave.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/guswave.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/interrup.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/irq.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/irq.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/leetimbr.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/linklist.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/ll_man.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/ll_man.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/memcheck.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/midi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/midi.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mpu401.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mpu401.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/multivoc.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/multivoc.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/music.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/music.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mv_mix.asm create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mv_mix.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mv_mix16.asm create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mvreverb.asm create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/mvreverb.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/myprint.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/myprint.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/newgf1.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/nodpmi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/nomusic.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/pas16.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/pas16.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/pitch.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/pitch.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/sndcards.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/sndscape.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/sndscape.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/sndsrc.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/sndsrc.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/standard.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/task_man.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/task_man.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/user.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/user.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/usrhooks.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/usrhooks.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/audiolib/util.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/config.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/config.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/console.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/console.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/control.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/control.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/cvar_defs.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/cvar_defs.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/cvars.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/cvars.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/develop.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/duke3d.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/dukerockbox.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/dukeunix.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/dukewin.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/dummy_audiolib.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/file_lib.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/funct.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/function.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/game.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/game.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/gamedef.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/gamedefs.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/global.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/global.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/joystick.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/keyboard.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/keyboard.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/menues.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/midi/sdl_midi.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/mouse.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/names.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/player.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/premap.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/premap.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/rts.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/rts.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/scriplib.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/scriplib.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/sector.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/sounddebugdefs.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/soundefs.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/sounds.c create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/sounds.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/types.h create mode 100644 apps/plugins/sdl/progs/duke3d/Game/src/util_lib.h create mode 100644 apps/plugins/sdl/redefines.txt create mode 100644 apps/plugins/sdl/sdl.make create mode 100644 apps/plugins/sdl/src/SDL.c create mode 100644 apps/plugins/sdl/src/SDL_error.c create mode 100644 apps/plugins/sdl/src/SDL_error_c.h create mode 100644 apps/plugins/sdl/src/SDL_fatal.c create mode 100644 apps/plugins/sdl/src/SDL_fatal.h create mode 100644 apps/plugins/sdl/src/audio/SDL_audio.c create mode 100644 apps/plugins/sdl/src/audio/SDL_audio_c.h create mode 100644 apps/plugins/sdl/src/audio/SDL_audiocvt.c create mode 100644 apps/plugins/sdl/src/audio/SDL_audiodev.c create mode 100644 apps/plugins/sdl/src/audio/SDL_audiodev_c.h create mode 100644 apps/plugins/sdl/src/audio/SDL_audiomem.h create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer.c create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer_MMX.c create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer_MMX.h create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer_MMX_VC.c create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer_MMX_VC.h create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer_m68k.c create mode 100644 apps/plugins/sdl/src/audio/SDL_mixer_m68k.h create mode 100644 apps/plugins/sdl/src/audio/SDL_sysaudio.h create mode 100644 apps/plugins/sdl/src/audio/SDL_wave.c create mode 100644 apps/plugins/sdl/src/audio/SDL_wave.h create mode 100644 apps/plugins/sdl/src/audio/alsa/SDL_alsa_audio.c create mode 100644 apps/plugins/sdl/src/audio/alsa/SDL_alsa_audio.h create mode 100644 apps/plugins/sdl/src/audio/arts/SDL_artsaudio.c create mode 100644 apps/plugins/sdl/src/audio/arts/SDL_artsaudio.h create mode 100644 apps/plugins/sdl/src/audio/baudio/SDL_beaudio.cc create mode 100644 apps/plugins/sdl/src/audio/baudio/SDL_beaudio.h create mode 100644 apps/plugins/sdl/src/audio/bsd/SDL_bsdaudio.c create mode 100644 apps/plugins/sdl/src/audio/bsd/SDL_bsdaudio.h create mode 100644 apps/plugins/sdl/src/audio/dart/SDL_dart.c create mode 100644 apps/plugins/sdl/src/audio/dart/SDL_dart.h create mode 100644 apps/plugins/sdl/src/audio/dc/SDL_dcaudio.c create mode 100644 apps/plugins/sdl/src/audio/dc/SDL_dcaudio.h create mode 100644 apps/plugins/sdl/src/audio/dc/aica.c create mode 100644 apps/plugins/sdl/src/audio/dc/aica.h create mode 100644 apps/plugins/sdl/src/audio/disk/SDL_diskaudio.c create mode 100644 apps/plugins/sdl/src/audio/disk/SDL_diskaudio.h create mode 100644 apps/plugins/sdl/src/audio/dma/SDL_dmaaudio.c create mode 100644 apps/plugins/sdl/src/audio/dma/SDL_dmaaudio.h create mode 100644 apps/plugins/sdl/src/audio/dmedia/SDL_irixaudio.c create mode 100644 apps/plugins/sdl/src/audio/dmedia/SDL_irixaudio.h create mode 100644 apps/plugins/sdl/src/audio/dsp/SDL_dspaudio.c create mode 100644 apps/plugins/sdl/src/audio/dsp/SDL_dspaudio.h create mode 100644 apps/plugins/sdl/src/audio/dummy/SDL_dummyaudio.c create mode 100644 apps/plugins/sdl/src/audio/dummy/SDL_dummyaudio.h create mode 100644 apps/plugins/sdl/src/audio/esd/SDL_esdaudio.c create mode 100644 apps/plugins/sdl/src/audio/esd/SDL_esdaudio.h create mode 100644 apps/plugins/sdl/src/audio/macosx/SDL_coreaudio.c create mode 100644 apps/plugins/sdl/src/audio/macosx/SDL_coreaudio.h create mode 100644 apps/plugins/sdl/src/audio/macrom/SDL_romaudio.c create mode 100644 apps/plugins/sdl/src/audio/macrom/SDL_romaudio.h create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio.c create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio.h create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_dma8.c create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_dma8.h create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_gsxb.c create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_gsxb.h create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_it.S create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_mcsn.c create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_mcsn.h create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_stfa.c create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_stfa.h create mode 100644 apps/plugins/sdl/src/audio/mint/SDL_mintaudio_xbios.c create mode 100644 apps/plugins/sdl/src/audio/mme/SDL_mmeaudio.c create mode 100644 apps/plugins/sdl/src/audio/mme/SDL_mmeaudio.h create mode 100644 apps/plugins/sdl/src/audio/nas/SDL_nasaudio.c create mode 100644 apps/plugins/sdl/src/audio/nas/SDL_nasaudio.h create mode 100644 apps/plugins/sdl/src/audio/nds/SDL_ndsaudio.c create mode 100644 apps/plugins/sdl/src/audio/nds/SDL_ndsaudio.h create mode 100644 apps/plugins/sdl/src/audio/nds/sound9.c create mode 100644 apps/plugins/sdl/src/audio/nds/soundcommon.h create mode 100644 apps/plugins/sdl/src/audio/nto/SDL_nto_audio.c create mode 100644 apps/plugins/sdl/src/audio/nto/SDL_nto_audio.h create mode 100644 apps/plugins/sdl/src/audio/paudio/SDL_paudio.c create mode 100644 apps/plugins/sdl/src/audio/paudio/SDL_paudio.h create mode 100644 apps/plugins/sdl/src/audio/pulse/SDL_pulseaudio.c create mode 100644 apps/plugins/sdl/src/audio/pulse/SDL_pulseaudio.h create mode 100644 apps/plugins/sdl/src/audio/rockbox/SDL_rockboxaudio.c create mode 100644 apps/plugins/sdl/src/audio/rockbox/SDL_rockboxaudio.h create mode 100644 apps/plugins/sdl/src/audio/sun/SDL_sunaudio.c create mode 100644 apps/plugins/sdl/src/audio/sun/SDL_sunaudio.h create mode 100644 apps/plugins/sdl/src/audio/symbian/SDL_epocaudio.cpp create mode 100644 apps/plugins/sdl/src/audio/symbian/SDL_epocaudio.h create mode 100644 apps/plugins/sdl/src/audio/symbian/streamplayer.cpp create mode 100644 apps/plugins/sdl/src/audio/symbian/streamplayer.h create mode 100644 apps/plugins/sdl/src/audio/ums/SDL_umsaudio.c create mode 100644 apps/plugins/sdl/src/audio/ums/SDL_umsaudio.h create mode 100644 apps/plugins/sdl/src/audio/windib/SDL_dibaudio.c create mode 100644 apps/plugins/sdl/src/audio/windib/SDL_dibaudio.h create mode 100644 apps/plugins/sdl/src/audio/windx5/SDL_dx5audio.c create mode 100644 apps/plugins/sdl/src/audio/windx5/SDL_dx5audio.h create mode 100644 apps/plugins/sdl/src/audio/windx5/directx.h create mode 100644 apps/plugins/sdl/src/cdrom/SDL_cdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/SDL_syscdrom.h create mode 100644 apps/plugins/sdl/src/cdrom/aix/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/beos/SDL_syscdrom.cc create mode 100644 apps/plugins/sdl/src/cdrom/bsdi/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/dc/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/dummy/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/freebsd/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/linux/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/macos/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/macos/SDL_syscdrom_c.h create mode 100644 apps/plugins/sdl/src/cdrom/macosx/AudioFilePlayer.c create mode 100644 apps/plugins/sdl/src/cdrom/macosx/AudioFilePlayer.h create mode 100644 apps/plugins/sdl/src/cdrom/macosx/AudioFileReaderThread.c create mode 100644 apps/plugins/sdl/src/cdrom/macosx/CDPlayer.c create mode 100644 apps/plugins/sdl/src/cdrom/macosx/CDPlayer.h create mode 100644 apps/plugins/sdl/src/cdrom/macosx/SDLOSXCAGuard.c create mode 100644 apps/plugins/sdl/src/cdrom/macosx/SDLOSXCAGuard.h create mode 100644 apps/plugins/sdl/src/cdrom/macosx/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/macosx/SDL_syscdrom_c.h create mode 100644 apps/plugins/sdl/src/cdrom/mint/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/openbsd/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/os2/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/osf/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/qnx/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cdrom/win32/SDL_syscdrom.c create mode 100644 apps/plugins/sdl/src/cpuinfo/SDL_cpuinfo.c create mode 100644 apps/plugins/sdl/src/events/SDL_active.c create mode 100644 apps/plugins/sdl/src/events/SDL_events.c create mode 100644 apps/plugins/sdl/src/events/SDL_events_c.h create mode 100644 apps/plugins/sdl/src/events/SDL_expose.c create mode 100644 apps/plugins/sdl/src/events/SDL_keyboard.c create mode 100644 apps/plugins/sdl/src/events/SDL_mouse.c create mode 100644 apps/plugins/sdl/src/events/SDL_quit.c create mode 100644 apps/plugins/sdl/src/events/SDL_resize.c create mode 100644 apps/plugins/sdl/src/events/SDL_sysevents.h create mode 100644 apps/plugins/sdl/src/file/SDL_rwops.c create mode 100644 apps/plugins/sdl/src/hermes/COPYING.LIB create mode 100644 apps/plugins/sdl/src/hermes/HeadMMX.h create mode 100644 apps/plugins/sdl/src/hermes/HeadX86.h create mode 100644 apps/plugins/sdl/src/hermes/README create mode 100644 apps/plugins/sdl/src/hermes/common.inc create mode 100644 apps/plugins/sdl/src/hermes/mmx_main.asm create mode 100644 apps/plugins/sdl/src/hermes/mmxp2_32.asm create mode 100644 apps/plugins/sdl/src/hermes/x86_main.asm create mode 100644 apps/plugins/sdl/src/hermes/x86p_16.asm create mode 100644 apps/plugins/sdl/src/hermes/x86p_32.asm create mode 100644 apps/plugins/sdl/src/joystick/SDL_joystick.c create mode 100644 apps/plugins/sdl/src/joystick/SDL_joystick_c.h create mode 100644 apps/plugins/sdl/src/joystick/SDL_sysjoystick.h create mode 100644 apps/plugins/sdl/src/joystick/beos/SDL_bejoystick.cc create mode 100644 apps/plugins/sdl/src/joystick/bsd/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/darwin/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/dc/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/dummy/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/linux/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/macos/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/mint/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/nds/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/riscos/SDL_sysjoystick.c create mode 100644 apps/plugins/sdl/src/joystick/win32/SDL_mmjoystick.c create mode 100644 apps/plugins/sdl/src/loadso/beos/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/loadso/dlopen/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/loadso/dummy/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/loadso/macos/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/loadso/macosx/SDL_dlcompat.c create mode 100644 apps/plugins/sdl/src/loadso/mint/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/loadso/os2/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/loadso/win32/SDL_sysloadso.c create mode 100644 apps/plugins/sdl/src/main/beos/SDL_BeApp.cc create mode 100644 apps/plugins/sdl/src/main/beos/SDL_BeApp.h create mode 100644 apps/plugins/sdl/src/main/dummy/SDL_dummy_main.c create mode 100644 apps/plugins/sdl/src/main/macos/SDL.r create mode 100644 apps/plugins/sdl/src/main/macos/SDL.shlib.r create mode 100644 apps/plugins/sdl/src/main/macos/SDL_main.c create mode 100644 apps/plugins/sdl/src/main/macos/SIZE.r create mode 100644 apps/plugins/sdl/src/main/macos/exports/Makefile create mode 100644 apps/plugins/sdl/src/main/macos/exports/SDL.x create mode 100644 apps/plugins/sdl/src/main/macos/exports/gendef.pl create mode 100644 apps/plugins/sdl/src/main/macosx/Info.plist.in create mode 100644 apps/plugins/sdl/src/main/macosx/SDLMain.h create mode 100644 apps/plugins/sdl/src/main/macosx/SDLMain.m create mode 100644 apps/plugins/sdl/src/main/macosx/SDLMain.nib/classes.nib create mode 100644 apps/plugins/sdl/src/main/macosx/SDLMain.nib/info.nib create mode 100644 apps/plugins/sdl/src/main/macosx/SDLMain.nib/objects.nib create mode 100644 apps/plugins/sdl/src/main/macosx/info.nib create mode 100644 apps/plugins/sdl/src/main/qtopia/SDL_qtopia_main.cc create mode 100644 apps/plugins/sdl/src/main/symbian/EKA1/SDL_main.cpp create mode 100644 apps/plugins/sdl/src/main/symbian/EKA2/SDL_main.cpp create mode 100644 apps/plugins/sdl/src/main/symbian/EKA2/sdlexe.cpp create mode 100644 apps/plugins/sdl/src/main/symbian/EKA2/sdllib.cpp create mode 100644 apps/plugins/sdl/src/main/symbian/EKA2/vectorbuffer.cpp create mode 100644 apps/plugins/sdl/src/main/symbian/EKA2/vectorbuffer.h create mode 100644 apps/plugins/sdl/src/main/win32/SDL_win32_main.c create mode 100644 apps/plugins/sdl/src/main/win32/version.rc create mode 100644 apps/plugins/sdl/src/stdlib/SDL_getenv.c create mode 100644 apps/plugins/sdl/src/stdlib/SDL_iconv.c create mode 100644 apps/plugins/sdl/src/stdlib/SDL_malloc.c create mode 100644 apps/plugins/sdl/src/stdlib/SDL_qsort.c create mode 100644 apps/plugins/sdl/src/stdlib/SDL_stdlib.c create mode 100644 apps/plugins/sdl/src/stdlib/SDL_string.c create mode 100644 apps/plugins/sdl/src/thread/SDL_systhread.h create mode 100644 apps/plugins/sdl/src/thread/SDL_thread.c create mode 100644 apps/plugins/sdl/src/thread/SDL_thread_c.h create mode 100644 apps/plugins/sdl/src/thread/beos/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/beos/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/beos/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_syscond_c.h create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_sysmutex_c.h create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_syssem_c.h create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/dc/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/generic/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/generic/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/generic/SDL_sysmutex_c.h create mode 100644 apps/plugins/sdl/src/thread/generic/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/generic/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/generic/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/irix/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/irix/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/irix/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/os2/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/os2/SDL_syscond_c.h create mode 100644 apps/plugins/sdl/src/thread/os2/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/os2/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/os2/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/os2/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/pth/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/pth/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/pth/SDL_sysmutex_c.h create mode 100644 apps/plugins/sdl/src/thread/pth/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/pth/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/pthread/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/pthread/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/pthread/SDL_sysmutex_c.h create mode 100644 apps/plugins/sdl/src/thread/pthread/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/pthread/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/pthread/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/riscos/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/riscos/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/riscos/SDL_sysmutex_c.h create mode 100644 apps/plugins/sdl/src/thread/riscos/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/riscos/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/riscos/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/rockbox/SDL_syscond.c create mode 100644 apps/plugins/sdl/src/thread/rockbox/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/rockbox/SDL_sysmutex_c.h create mode 100644 apps/plugins/sdl/src/thread/rockbox/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/rockbox/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/rockbox/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/symbian/SDL_sysmutex.cpp create mode 100644 apps/plugins/sdl/src/thread/symbian/SDL_syssem.cpp create mode 100644 apps/plugins/sdl/src/thread/symbian/SDL_systhread.cpp create mode 100644 apps/plugins/sdl/src/thread/symbian/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/win32/SDL_sysmutex.c create mode 100644 apps/plugins/sdl/src/thread/win32/SDL_syssem.c create mode 100644 apps/plugins/sdl/src/thread/win32/SDL_systhread.c create mode 100644 apps/plugins/sdl/src/thread/win32/SDL_systhread_c.h create mode 100644 apps/plugins/sdl/src/thread/win32/win_ce_semaphore.c create mode 100644 apps/plugins/sdl/src/thread/win32/win_ce_semaphore.h create mode 100644 apps/plugins/sdl/src/timer/SDL_systimer.h create mode 100644 apps/plugins/sdl/src/timer/SDL_timer.c create mode 100644 apps/plugins/sdl/src/timer/SDL_timer_c.h create mode 100644 apps/plugins/sdl/src/timer/beos/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/dc/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/dummy/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/macos/FastTimes.c create mode 100644 apps/plugins/sdl/src/timer/macos/FastTimes.h create mode 100644 apps/plugins/sdl/src/timer/macos/SDL_MPWtimer.c create mode 100644 apps/plugins/sdl/src/timer/macos/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/mint/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/mint/SDL_vbltimer.S create mode 100644 apps/plugins/sdl/src/timer/mint/SDL_vbltimer_s.h create mode 100644 apps/plugins/sdl/src/timer/nds/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/os2/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/riscos/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/rockbox/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/symbian/SDL_systimer.cpp create mode 100644 apps/plugins/sdl/src/timer/unix/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/win32/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/timer/wince/SDL_systimer.c create mode 100644 apps/plugins/sdl/src/video/SDL_RLEaccel.c create mode 100644 apps/plugins/sdl/src/video/SDL_RLEaccel_c.h create mode 100644 apps/plugins/sdl/src/video/SDL_blit.c create mode 100644 apps/plugins/sdl/src/video/SDL_blit.h create mode 100644 apps/plugins/sdl/src/video/SDL_blit_0.c create mode 100644 apps/plugins/sdl/src/video/SDL_blit_1.c create mode 100644 apps/plugins/sdl/src/video/SDL_blit_A.c create mode 100644 apps/plugins/sdl/src/video/SDL_blit_N.c create mode 100644 apps/plugins/sdl/src/video/SDL_bmp.c create mode 100644 apps/plugins/sdl/src/video/SDL_cursor.c create mode 100644 apps/plugins/sdl/src/video/SDL_cursor_c.h create mode 100644 apps/plugins/sdl/src/video/SDL_gamma.c create mode 100644 apps/plugins/sdl/src/video/SDL_glfuncs.h create mode 100644 apps/plugins/sdl/src/video/SDL_leaks.h create mode 100644 apps/plugins/sdl/src/video/SDL_pixels.c create mode 100644 apps/plugins/sdl/src/video/SDL_pixels_c.h create mode 100644 apps/plugins/sdl/src/video/SDL_stretch.c create mode 100644 apps/plugins/sdl/src/video/SDL_stretch_c.h create mode 100644 apps/plugins/sdl/src/video/SDL_surface.c create mode 100644 apps/plugins/sdl/src/video/SDL_sysvideo.h create mode 100644 apps/plugins/sdl/src/video/SDL_video.c create mode 100644 apps/plugins/sdl/src/video/SDL_yuv.c create mode 100644 apps/plugins/sdl/src/video/SDL_yuv_mmx.c create mode 100644 apps/plugins/sdl/src/video/SDL_yuv_sw.c create mode 100644 apps/plugins/sdl/src/video/SDL_yuv_sw_c.h create mode 100644 apps/plugins/sdl/src/video/SDL_yuvfuncs.h create mode 100644 apps/plugins/sdl/src/video/Xext/README create mode 100644 apps/plugins/sdl/src/video/Xext/XME/xme.c create mode 100644 apps/plugins/sdl/src/video/Xext/Xinerama/Xinerama.c create mode 100644 apps/plugins/sdl/src/video/Xext/Xv/Xv.c create mode 100644 apps/plugins/sdl/src/video/Xext/Xv/Xvlibint.h create mode 100644 apps/plugins/sdl/src/video/Xext/Xxf86dga/XF86DGA.c create mode 100644 apps/plugins/sdl/src/video/Xext/Xxf86dga/XF86DGA2.c create mode 100644 apps/plugins/sdl/src/video/Xext/Xxf86vm/XF86VMode.c create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/Xext.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/Xinerama.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/Xv.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/Xvlib.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/Xvproto.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/extutil.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/panoramiXext.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/panoramiXproto.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xf86dga.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xf86dga1.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xf86dga1str.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xf86dgastr.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xf86vmode.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xf86vmstr.h create mode 100644 apps/plugins/sdl/src/video/Xext/extensions/xme.h create mode 100644 apps/plugins/sdl/src/video/aalib/SDL_aaevents.c create mode 100644 apps/plugins/sdl/src/video/aalib/SDL_aaevents_c.h create mode 100644 apps/plugins/sdl/src/video/aalib/SDL_aamouse.c create mode 100644 apps/plugins/sdl/src/video/aalib/SDL_aamouse_c.h create mode 100644 apps/plugins/sdl/src/video/aalib/SDL_aavideo.c create mode 100644 apps/plugins/sdl/src/video/aalib/SDL_aavideo.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ataric2p.S create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ataric2p_s.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ataridevmouse.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ataridevmouse_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarieddi.S create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarieddi_s.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarievents.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarievents_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarigl.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarigl_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarikeys.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarimxalloc.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarimxalloc_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_atarisuper.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_biosevents.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_biosevents_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_gemdosevents.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_gemdosevents_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ikbdevents.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ikbdevents_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ikbdinterrupt.S create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_ikbdinterrupt_s.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_xbiosevents.c create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_xbiosevents_c.h create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_xbiosinterrupt.S create mode 100644 apps/plugins/sdl/src/video/ataricommon/SDL_xbiosinterrupt_s.h create mode 100644 apps/plugins/sdl/src/video/blank_cursor.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_BView.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_BWin.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_lowvideo.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysevents.cc create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysevents_c.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysmouse.cc create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysmouse_c.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysvideo.cc create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_syswm.cc create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_syswm_c.h create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysyuv.cc create mode 100644 apps/plugins/sdl/src/video/bwindow/SDL_sysyuv.h create mode 100644 apps/plugins/sdl/src/video/caca/SDL_cacaevents.c create mode 100644 apps/plugins/sdl/src/video/caca/SDL_cacaevents_c.h create mode 100644 apps/plugins/sdl/src/video/caca/SDL_cacavideo.c create mode 100644 apps/plugins/sdl/src/video/caca/SDL_cacavideo.h create mode 100644 apps/plugins/sdl/src/video/dc/SDL_dcevents.c create mode 100644 apps/plugins/sdl/src/video/dc/SDL_dcevents_c.h create mode 100644 apps/plugins/sdl/src/video/dc/SDL_dcmouse.c create mode 100644 apps/plugins/sdl/src/video/dc/SDL_dcmouse_c.h create mode 100644 apps/plugins/sdl/src/video/dc/SDL_dcvideo.c create mode 100644 apps/plugins/sdl/src/video/dc/SDL_dcvideo.h create mode 100644 apps/plugins/sdl/src/video/default_cursor.h create mode 100644 apps/plugins/sdl/src/video/dga/SDL_dgaevents.c create mode 100644 apps/plugins/sdl/src/video/dga/SDL_dgaevents_c.h create mode 100644 apps/plugins/sdl/src/video/dga/SDL_dgamouse.c create mode 100644 apps/plugins/sdl/src/video/dga/SDL_dgamouse_c.h create mode 100644 apps/plugins/sdl/src/video/dga/SDL_dgavideo.c create mode 100644 apps/plugins/sdl/src/video/dga/SDL_dgavideo.h create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_events.c create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_events.h create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_keys.h create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_video.c create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_video.h create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_yuv.c create mode 100644 apps/plugins/sdl/src/video/directfb/SDL_DirectFB_yuv.h create mode 100644 apps/plugins/sdl/src/video/dummy/SDL_nullevents.c create mode 100644 apps/plugins/sdl/src/video/dummy/SDL_nullevents_c.h create mode 100644 apps/plugins/sdl/src/video/dummy/SDL_nullmouse.c create mode 100644 apps/plugins/sdl/src/video/dummy/SDL_nullmouse_c.h create mode 100644 apps/plugins/sdl/src/video/dummy/SDL_nullvideo.c create mode 100644 apps/plugins/sdl/src/video/dummy/SDL_nullvideo.h create mode 100644 apps/plugins/sdl/src/video/e_log.h create mode 100644 apps/plugins/sdl/src/video/e_pow.h create mode 100644 apps/plugins/sdl/src/video/e_sqrt.h create mode 100644 apps/plugins/sdl/src/video/fbcon/3dfx_mmio.h create mode 100644 apps/plugins/sdl/src/video/fbcon/3dfx_regs.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fb3dfx.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fb3dfx.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbelo.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbelo.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbevents.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbevents_c.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbkeys.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbmatrox.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbmatrox.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbmouse.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbmouse_c.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbriva.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbriva.h create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbvideo.c create mode 100644 apps/plugins/sdl/src/video/fbcon/SDL_fbvideo.h create mode 100644 apps/plugins/sdl/src/video/fbcon/matrox_mmio.h create mode 100644 apps/plugins/sdl/src/video/fbcon/matrox_regs.h create mode 100644 apps/plugins/sdl/src/video/fbcon/riva_mmio.h create mode 100644 apps/plugins/sdl/src/video/fbcon/riva_regs.h create mode 100644 apps/plugins/sdl/src/video/gapi/SDL_gapivideo.c create mode 100644 apps/plugins/sdl/src/video/gapi/SDL_gapivideo.h create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemevents.c create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemevents_c.h create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemmouse.c create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemmouse_c.h create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemvideo.c create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemvideo.h create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemwm.c create mode 100644 apps/plugins/sdl/src/video/gem/SDL_gemwm_c.h create mode 100644 apps/plugins/sdl/src/video/ggi/SDL_ggievents.c create mode 100755 apps/plugins/sdl/src/video/ggi/SDL_ggievents_c.h create mode 100644 apps/plugins/sdl/src/video/ggi/SDL_ggikeys.h create mode 100644 apps/plugins/sdl/src/video/ggi/SDL_ggimouse.c create mode 100755 apps/plugins/sdl/src/video/ggi/SDL_ggimouse_c.h create mode 100644 apps/plugins/sdl/src/video/ggi/SDL_ggivideo.c create mode 100644 apps/plugins/sdl/src/video/ggi/SDL_ggivideo.h create mode 100644 apps/plugins/sdl/src/video/ipod/SDL_ipodvideo.c create mode 100644 apps/plugins/sdl/src/video/ipod/SDL_ipodvideo.h create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_lowvideo.h create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macevents.c create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macevents_c.h create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macgl.c create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macgl_c.h create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_mackeys.h create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macmouse.c create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macmouse_c.h create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macwm.c create mode 100644 apps/plugins/sdl/src/video/maccommon/SDL_macwm_c.h create mode 100644 apps/plugins/sdl/src/video/macdsp/SDL_dspvideo.c create mode 100644 apps/plugins/sdl/src/video/macdsp/SDL_dspvideo.h create mode 100644 apps/plugins/sdl/src/video/macrom/SDL_romvideo.c create mode 100644 apps/plugins/sdl/src/video/macrom/SDL_romvideo.h create mode 100644 apps/plugins/sdl/src/video/math_private.h create mode 100644 apps/plugins/sdl/src/video/mmx.h create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxevents.c create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxevents_c.h create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nximage.c create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nximage_c.h create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxmodes.c create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxmodes_c.h create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxmouse.c create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxmouse_c.h create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxvideo.c create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxvideo.h create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxwm.c create mode 100644 apps/plugins/sdl/src/video/nanox/SDL_nxwm_c.h create mode 100644 apps/plugins/sdl/src/video/nds/SDL_ndsevents.c create mode 100644 apps/plugins/sdl/src/video/nds/SDL_ndsevents_c.h create mode 100644 apps/plugins/sdl/src/video/nds/SDL_ndsmouse.c create mode 100644 apps/plugins/sdl/src/video/nds/SDL_ndsmouse_c.h create mode 100644 apps/plugins/sdl/src/video/nds/SDL_ndsvideo.c create mode 100644 apps/plugins/sdl/src/video/nds/SDL_ndsvideo.h create mode 100644 apps/plugins/sdl/src/video/os2fslib/SDL_os2fslib.c create mode 100644 apps/plugins/sdl/src/video/os2fslib/SDL_os2fslib.h create mode 100644 apps/plugins/sdl/src/video/os2fslib/SDL_vkeys.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_events.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_events_c.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_gl.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_gl.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_image.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_image_c.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_modes.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_modes_c.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_mouse.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_mouse_c.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_video.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_video.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_wm.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_ph_wm_c.h create mode 100644 apps/plugins/sdl/src/video/photon/SDL_phyuv.c create mode 100644 apps/plugins/sdl/src/video/photon/SDL_phyuv_c.h create mode 100644 apps/plugins/sdl/src/video/picogui/SDL_pgevents.c create mode 100644 apps/plugins/sdl/src/video/picogui/SDL_pgevents_c.h create mode 100644 apps/plugins/sdl/src/video/picogui/SDL_pgvideo.c create mode 100644 apps/plugins/sdl/src/video/picogui/SDL_pgvideo.h create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsevents.c create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsevents_c.h create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gskeys.h create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsmouse.c create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsmouse_c.h create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsvideo.c create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsvideo.h create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsyuv.c create mode 100644 apps/plugins/sdl/src/video/ps2gs/SDL_gsyuv_c.h create mode 100644 apps/plugins/sdl/src/video/ps3/SDL_ps3events.c create mode 100644 apps/plugins/sdl/src/video/ps3/SDL_ps3events_c.h create mode 100644 apps/plugins/sdl/src/video/ps3/SDL_ps3video.c create mode 100644 apps/plugins/sdl/src/video/ps3/SDL_ps3video.h create mode 100644 apps/plugins/sdl/src/video/ps3/SDL_ps3yuv.c create mode 100644 apps/plugins/sdl/src/video/ps3/SDL_ps3yuv_c.h create mode 100644 apps/plugins/sdl/src/video/ps3/spulibs/Makefile create mode 100644 apps/plugins/sdl/src/video/ps3/spulibs/bilin_scaler.c create mode 100644 apps/plugins/sdl/src/video/ps3/spulibs/fb_writer.c create mode 100644 apps/plugins/sdl/src/video/ps3/spulibs/spu_common.h create mode 100644 apps/plugins/sdl/src/video/ps3/spulibs/yuv2rgb_converter.c create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_QPEApp.cc create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_QPEApp.h create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_QWin.cc create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_QWin.h create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_lowvideo.h create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_sysevents.cc create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_sysevents_c.h create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_sysmouse.cc create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_sysmouse_c.h create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_sysvideo.cc create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_syswm.cc create mode 100644 apps/plugins/sdl/src/video/qtopia/SDL_syswm_c.h create mode 100644 apps/plugins/sdl/src/video/quartz/CGS.h create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzEvents.m create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzGL.m create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzKeys.h create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzVideo.h create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzVideo.m create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzWM.h create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzWM.m create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzWindow.h create mode 100644 apps/plugins/sdl/src/video/quartz/SDL_QuartzWindow.m create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosASM.S create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosFullScreenVideo.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosevents.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosevents_c.h create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosmouse.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosmouse_c.h create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscossprite.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscostask.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscostask.h create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosvideo.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_riscosvideo.h create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_wimppoll.c create mode 100644 apps/plugins/sdl/src/video/riscos/SDL_wimpvideo.c create mode 100644 apps/plugins/sdl/src/video/rockbox/SDL_rockboxvideo.c create mode 100644 apps/plugins/sdl/src/video/rockbox/SDL_rockboxvideo.h create mode 100644 apps/plugins/sdl/src/video/rockbox/keymaps_extra.h create mode 100644 apps/plugins/sdl/src/video/svga/SDL_svgaevents.c create mode 100644 apps/plugins/sdl/src/video/svga/SDL_svgaevents_c.h create mode 100644 apps/plugins/sdl/src/video/svga/SDL_svgamouse.c create mode 100644 apps/plugins/sdl/src/video/svga/SDL_svgamouse_c.h create mode 100644 apps/plugins/sdl/src/video/svga/SDL_svgavideo.c create mode 100644 apps/plugins/sdl/src/video/svga/SDL_svgavideo.h create mode 100644 apps/plugins/sdl/src/video/symbian/EKA1/SDL_epocevents.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/EKA1/SDL_epocvideo.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/EKA1/SDL_epocvideo.h create mode 100644 apps/plugins/sdl/src/video/symbian/EKA2/SDL_epocevents.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/EKA2/SDL_epocvideo.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/EKA2/SDL_epocvideo.h create mode 100644 apps/plugins/sdl/src/video/symbian/EKA2/dsa.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/EKA2/dsa_new.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/EKA2/dsa_old.cpp create mode 100644 apps/plugins/sdl/src/video/symbian/SDL_epocevents_c.h create mode 100644 apps/plugins/sdl/src/video/vgl/SDL_vglevents.c create mode 100644 apps/plugins/sdl/src/video/vgl/SDL_vglevents_c.h create mode 100644 apps/plugins/sdl/src/video/vgl/SDL_vglmouse.c create mode 100644 apps/plugins/sdl/src/video/vgl/SDL_vglmouse_c.h create mode 100644 apps/plugins/sdl/src/video/vgl/SDL_vglvideo.c create mode 100644 apps/plugins/sdl/src/video/vgl/SDL_vglvideo.h create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_lowvideo.h create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_sysevents.c create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_sysmouse.c create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_sysmouse_c.h create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_syswm.c create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_syswm_c.h create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_wingl.c create mode 100644 apps/plugins/sdl/src/video/wincommon/SDL_wingl_c.h create mode 100644 apps/plugins/sdl/src/video/wincommon/wmmsg.h create mode 100644 apps/plugins/sdl/src/video/windib/SDL_dibevents.c create mode 100644 apps/plugins/sdl/src/video/windib/SDL_dibevents_c.h create mode 100644 apps/plugins/sdl/src/video/windib/SDL_dibvideo.c create mode 100644 apps/plugins/sdl/src/video/windib/SDL_dibvideo.h create mode 100644 apps/plugins/sdl/src/video/windib/SDL_gapidibvideo.h create mode 100644 apps/plugins/sdl/src/video/windib/SDL_vkeys.h create mode 100644 apps/plugins/sdl/src/video/windx5/SDL_dx5events.c create mode 100644 apps/plugins/sdl/src/video/windx5/SDL_dx5events_c.h create mode 100644 apps/plugins/sdl/src/video/windx5/SDL_dx5video.c create mode 100644 apps/plugins/sdl/src/video/windx5/SDL_dx5video.h create mode 100644 apps/plugins/sdl/src/video/windx5/SDL_dx5yuv.c create mode 100644 apps/plugins/sdl/src/video/windx5/SDL_dx5yuv_c.h create mode 100644 apps/plugins/sdl/src/video/windx5/directx.h create mode 100644 apps/plugins/sdl/src/video/wscons/SDL_wsconsevents.c create mode 100644 apps/plugins/sdl/src/video/wscons/SDL_wsconsevents_c.h create mode 100644 apps/plugins/sdl/src/video/wscons/SDL_wsconsmouse.c create mode 100644 apps/plugins/sdl/src/video/wscons/SDL_wsconsmouse_c.h create mode 100644 apps/plugins/sdl/src/video/wscons/SDL_wsconsvideo.c create mode 100644 apps/plugins/sdl/src/video/wscons/SDL_wsconsvideo.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11dga.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11dga_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11dyn.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11dyn.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11events.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11events_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11gamma.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11gamma_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11gl.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11gl_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11image.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11image_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11modes.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11modes_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11mouse.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11mouse_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11sym.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11video.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11video.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11wm.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11wm_c.h create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11yuv.c create mode 100644 apps/plugins/sdl/src/video/x11/SDL_x11yuv_c.h create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios.c create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios.h create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_blowup.c create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_blowup.h create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_centscreen.c create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_centscreen.h create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_milan.c create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_milan.h create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_sb3.c create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_sb3.h create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_tveille.c create mode 100644 apps/plugins/sdl/src/video/xbios/SDL_xbios_tveille.h create mode 100644 apps/plugins/sdl/wrappers.c (limited to 'apps') diff --git a/apps/plugins/CATEGORIES b/apps/plugins/CATEGORIES index 1b5bb9a..652a0b3 100644 --- a/apps/plugins/CATEGORIES +++ b/apps/plugins/CATEGORIES @@ -26,6 +26,7 @@ dice,games dict,apps disktidy,apps doom,games +duke3d,games euroconverter,apps fft,demos fire,demos diff --git a/apps/plugins/SOURCES b/apps/plugins/SOURCES index 4576fb7..ea0173a 100644 --- a/apps/plugins/SOURCES +++ b/apps/plugins/SOURCES @@ -74,6 +74,11 @@ iriverify.c /* Overlays loaders */ +#if defined(HAVE_LCD_COLOR) && \ + (!defined(LCD_STRIDEFORMAT) || (LCD_STRIDEFORMAT != VERTICAL_STRIDE)) +duke3d.c +#endif + #if PLUGIN_BUFFER_SIZE <= 0x20000 && defined(HAVE_LCD_BITMAP) #if CONFIG_KEYPAD != ONDIO_PAD && CONFIG_KEYPAD != SANSA_M200_PAD \ diff --git a/apps/plugins/SUBDIRS b/apps/plugins/SUBDIRS index 56ac665..aa63c3c 100644 --- a/apps/plugins/SUBDIRS +++ b/apps/plugins/SUBDIRS @@ -12,10 +12,11 @@ clock /* For all targets with a bitmap display */ #ifdef HAVE_LCD_BITMAP -/* XWorld only supports color horizontal stride LCDs /for now/ ;) */ +/* color horizontal-stride LCDs */ #if defined(HAVE_LCD_COLOR) && \ (!defined(LCD_STRIDEFORMAT) || (LCD_STRIDEFORMAT != VERTICAL_STRIDE)) xworld +sdl puzzles #endif diff --git a/apps/plugins/duke3d.c b/apps/plugins/duke3d.c new file mode 100644 index 0000000..6e1c6f0 --- /dev/null +++ b/apps/plugins/duke3d.c @@ -0,0 +1,31 @@ +/*************************************************************************** + * __________ __ ___. + * Open \______ \ ____ ____ | | _\_ |__ _______ ___ + * Source | _// _ \_/ ___\| |/ /| __ \ / _ \ \/ / + * Jukebox | | ( <_> ) \___| < | \_\ ( <_> > < < + * Firmware |____|_ /\____/ \___ >__|_ \|___ /\____/__/\_ \ + * \/ \/ \/ \/ \/ + * $Id$ + * + * Copyright (C) 2017 Franklin Wei + * + * Duke3D stub loader. + * + * This program is free software; you can redistribute it and/or + * modify it under the terms of the GNU General Public License + * as published by the Free Software Foundation; either version 2 + * of the License, or (at your option) any later version. + * + * This software is distributed on an "AS IS" basis, WITHOUT WARRANTY OF ANY + * KIND, either express or implied. + * + ****************************************************************************/ +#include "plugin.h" + +#include "lib/overlay.h" + +/* this is the plugin entry point */ +enum plugin_status plugin_start(const void* parameter) +{ + return run_overlay(parameter, PLUGIN_GAMES_DIR "/duke3d.ovl", "Duke3D"); +} diff --git a/apps/plugins/lib/stdio_compat.c b/apps/plugins/lib/stdio_compat.c index d2b8f9b..957dd0d 100644 --- a/apps/plugins/lib/stdio_compat.c +++ b/apps/plugins/lib/stdio_compat.c @@ -20,12 +20,16 @@ #include "plugin.h" #include "stdio_compat.h" +#include "errno.h" static _FILE_ __file__[MAX_STDIO_FILES] = { {-1,-1,0},{-1,-1,0},{-1,-1,0},{-1,-1,0}, - {-1,-1,0},{-1,-1,0},{-1,-1,0},{-1,-1,0} + {-1,-1,0},{-1,-1,0},{-1,-1,0},{-1,-1,0}, + {-1,-1,0},{-1,-1,0},{-1,-1,0} }; +_FILE_ *_stdout_ = NULL, *_stderr_ = NULL; + _FILE_ *_fopen_(const char *path, const char *mode) { _FILE_ *f = __file__; @@ -34,13 +38,16 @@ _FILE_ *_fopen_(const char *path, const char *mode) int i; /* look for free slot */ - for (i=0; ifd == -1) break; /* no empty slots */ if (i == MAX_STDIO_FILES) + { + rb->splash(HZ, "no open slots"); return NULL; + } if (*mode != 'r') { @@ -72,10 +79,14 @@ _FILE_ *_fopen_(const char *path, const char *mode) } - fd = rb->open(path, flags); + fd = rb->open(path, flags, 0666); - if (fd == -1) + if (fd < 0) + { + //extern int errno; + //rb->splashf(HZ*2, "open of %s failed (%d)", path, errno); return NULL; + } /* initialize */ f->fd = fd; @@ -97,23 +108,40 @@ size_t _fread_(void *ptr, size_t size, size_t nmemb, _FILE_ *stream) if (ret < (ssize_t)(size*nmemb)) stream->error = -1; - - return ret; + return ret / size; } size_t _fwrite_(const void *ptr, size_t size, size_t nmemb, _FILE_ *stream) { - ssize_t ret = rb->write(stream->fd, ptr, size*nmemb); + if(stream) + { + ssize_t ret = rb->write(stream->fd, ptr, size*nmemb); - if (ret < (ssize_t)(size*nmemb)) - stream->error = -1; + if (ret < (ssize_t)(size*nmemb)) + stream->error = -1; - return ret; + return ret / size; + } +#if 1 + else + { + char buf[10]; + rb->snprintf(buf, 10, "%%%ds", size*nmemb); + rb->splashf(HZ, buf, ptr); + return size * nmemb; + } +#endif } int _fseek_(_FILE_ *stream, long offset, int whence) { - return rb->lseek(stream->fd, offset, whence); + if(rb->lseek(stream->fd, offset, whence) >= 0) + return 0; + else + { + rb->splashf(HZ, "lseek() failed: %d fd:%d", errno, stream->fd); + return -1; + } } long _ftell_(_FILE_ *stream) diff --git a/apps/plugins/lib/stdio_compat.h b/apps/plugins/lib/stdio_compat.h index bb37940..27ccfcf 100644 --- a/apps/plugins/lib/stdio_compat.h +++ b/apps/plugins/lib/stdio_compat.h @@ -20,7 +20,7 @@ #include -#define MAX_STDIO_FILES 8 +#define MAX_STDIO_FILES 11 #undef FILE #define FILE _FILE_ @@ -42,6 +42,8 @@ #define ferror _ferror_ #define feof _feof_ #define fprintf _fprintf_ +#define stdout _stdout_ +#define stderr _stderr_ typedef struct { int fd; @@ -49,6 +51,8 @@ typedef struct { int error; } _FILE_; +extern _FILE_ *_stdout_, *_stderr_; + _FILE_ *_fopen_(const char *path, const char *mode); int _fclose_(_FILE_ *stream); int _fflush_(_FILE_ *stream); diff --git a/apps/plugins/sdl/COPYING b/apps/plugins/sdl/COPYING new file mode 100644 index 0000000..2cba2ac --- /dev/null +++ b/apps/plugins/sdl/COPYING @@ -0,0 +1,458 @@ + GNU LESSER GENERAL PUBLIC LICENSE + Version 2.1, February 1999 + + Copyright (C) 1991, 1999 Free Software Foundation, Inc. + 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + Everyone is permitted to copy and distribute verbatim copies + of this license document, but changing it is not allowed. + +[This is the first released version of the Lesser GPL. It also counts + as the successor of the GNU Library Public License, version 2, hence + the version number 2.1.] + + Preamble + + The licenses for most software are designed to take away your +freedom to share and change it. By contrast, the GNU General Public +Licenses are intended to guarantee your freedom to share and change +free software--to make sure the software is free for all its users. + + This license, the Lesser General Public License, applies to some +specially designated software packages--typically libraries--of the +Free Software Foundation and other authors who decide to use it. You +can use it too, but we suggest you first think carefully about whether +this license or the ordinary General Public License is the better +strategy to use in any particular case, based on the explanations below. + + When we speak of free software, we are referring to freedom of use, +not price. Our General Public Licenses are designed to make sure that +you have the freedom to distribute copies of free software (and charge +for this service if you wish); that you receive source code or can get +it if you want it; that you can change the software and use pieces of +it in new free programs; and that you are informed that you can do +these things. + + To protect your rights, we need to make restrictions that forbid +distributors to deny you these rights or to ask you to surrender these +rights. These restrictions translate to certain responsibilities for +you if you distribute copies of the library or if you modify it. + + For example, if you distribute copies of the library, whether gratis +or for a fee, you must give the recipients all the rights that we gave +you. You must make sure that they, too, receive or can get the source +code. If you link other code with the library, you must provide +complete object files to the recipients, so that they can relink them +with the library after making changes to the library and recompiling +it. And you must show them these terms so they know their rights. + + We protect your rights with a two-step method: (1) we copyright the +library, and (2) we offer you this license, which gives you legal +permission to copy, distribute and/or modify the library. + + To protect each distributor, we want to make it very clear that +there is no warranty for the free library. Also, if the library is +modified by someone else and passed on, the recipients should know +that what they have is not the original version, so that the original +author's reputation will not be affected by problems that might be +introduced by others. + + Finally, software patents pose a constant threat to the existence of +any free program. We wish to make sure that a company cannot +effectively restrict the users of a free program by obtaining a +restrictive license from a patent holder. Therefore, we insist that +any patent license obtained for a version of the library must be +consistent with the full freedom of use specified in this license. + + Most GNU software, including some libraries, is covered by the +ordinary GNU General Public License. This license, the GNU Lesser +General Public License, applies to certain designated libraries, and +is quite different from the ordinary General Public License. We use +this license for certain libraries in order to permit linking those +libraries into non-free programs. + + When a program is linked with a library, whether statically or using +a shared library, the combination of the two is legally speaking a +combined work, a derivative of the original library. The ordinary +General Public License therefore permits such linking only if the +entire combination fits its criteria of freedom. The Lesser General +Public License permits more lax criteria for linking other code with +the library. + + We call this license the "Lesser" General Public License because it +does Less to protect the user's freedom than the ordinary General +Public License. It also provides other free software developers Less +of an advantage over competing non-free programs. These disadvantages +are the reason we use the ordinary General Public License for many +libraries. However, the Lesser license provides advantages in certain +special circumstances. + + For example, on rare occasions, there may be a special need to +encourage the widest possible use of a certain library, so that it becomes +a de-facto standard. To achieve this, non-free programs must be +allowed to use the library. A more frequent case is that a free +library does the same job as widely used non-free libraries. In this +case, there is little to gain by limiting the free library to free +software only, so we use the Lesser General Public License. + + In other cases, permission to use a particular library in non-free +programs enables a greater number of people to use a large body of +free software. For example, permission to use the GNU C Library in +non-free programs enables many more people to use the whole GNU +operating system, as well as its variant, the GNU/Linux operating +system. + + Although the Lesser General Public License is Less protective of the +users' freedom, it does ensure that the user of a program that is +linked with the Library has the freedom and the wherewithal to run +that program using a modified version of the Library. + + The precise terms and conditions for copying, distribution and +modification follow. Pay close attention to the difference between a +"work based on the library" and a "work that uses the library". The +former contains code derived from the library, whereas the latter must +be combined with the library in order to run. + + GNU LESSER GENERAL PUBLIC LICENSE + TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION + + 0. This License Agreement applies to any software library or other +program which contains a notice placed by the copyright holder or +other authorized party saying it may be distributed under the terms of +this Lesser General Public License (also called "this License"). +Each licensee is addressed as "you". + + A "library" means a collection of software functions and/or data +prepared so as to be conveniently linked with application programs +(which use some of those functions and data) to form executables. + + The "Library", below, refers to any such software library or work +which has been distributed under these terms. A "work based on the +Library" means either the Library or any derivative work under +copyright law: that is to say, a work containing the Library or a +portion of it, either verbatim or with modifications and/or translated +straightforwardly into another language. (Hereinafter, translation is +included without limitation in the term "modification".) + + "Source code" for a work means the preferred form of the work for +making modifications to it. For a library, complete source code means +all the source code for all modules it contains, plus any associated +interface definition files, plus the scripts used to control compilation +and installation of the library. + + Activities other than copying, distribution and modification are not +covered by this License; they are outside its scope. The act of +running a program using the Library is not restricted, and output from +such a program is covered only if its contents constitute a work based +on the Library (independent of the use of the Library in a tool for +writing it). Whether that is true depends on what the Library does +and what the program that uses the Library does. + + 1. You may copy and distribute verbatim copies of the Library's +complete source code as you receive it, in any medium, provided that +you conspicuously and appropriately publish on each copy an +appropriate copyright notice and disclaimer of warranty; keep intact +all the notices that refer to this License and to the absence of any +warranty; and distribute a copy of this License along with the +Library. + + You may charge a fee for the physical act of transferring a copy, +and you may at your option offer warranty protection in exchange for a +fee. + + 2. You may modify your copy or copies of the Library or any portion +of it, thus forming a work based on the Library, and copy and +distribute such modifications or work under the terms of Section 1 +above, provided that you also meet all of these conditions: + + a) The modified work must itself be a software library. + + b) You must cause the files modified to carry prominent notices + stating that you changed the files and the date of any change. + + c) You must cause the whole of the work to be licensed at no + charge to all third parties under the terms of this License. + + d) If a facility in the modified Library refers to a function or a + table of data to be supplied by an application program that uses + the facility, other than as an argument passed when the facility + is invoked, then you must make a good faith effort to ensure that, + in the event an application does not supply such function or + table, the facility still operates, and performs whatever part of + its purpose remains meaningful. + + (For example, a function in a library to compute square roots has + a purpose that is entirely well-defined independent of the + application. Therefore, Subsection 2d requires that any + application-supplied function or table used by this function must + be optional: if the application does not supply it, the square + root function must still compute square roots.) + +These requirements apply to the modified work as a whole. If +identifiable sections of that work are not derived from the Library, +and can be reasonably considered independent and separate works in +themselves, then this License, and its terms, do not apply to those +sections when you distribute them as separate works. But when you +distribute the same sections as part of a whole which is a work based +on the Library, the distribution of the whole must be on the terms of +this License, whose permissions for other licensees extend to the +entire whole, and thus to each and every part regardless of who wrote +it. + +Thus, it is not the intent of this section to claim rights or contest +your rights to work written entirely by you; rather, the intent is to +exercise the right to control the distribution of derivative or +collective works based on the Library. + +In addition, mere aggregation of another work not based on the Library +with the Library (or with a work based on the Library) on a volume of +a storage or distribution medium does not bring the other work under +the scope of this License. + + 3. You may opt to apply the terms of the ordinary GNU General Public +License instead of this License to a given copy of the Library. To do +this, you must alter all the notices that refer to this License, so +that they refer to the ordinary GNU General Public License, version 2, +instead of to this License. (If a newer version than version 2 of the +ordinary GNU General Public License has appeared, then you can specify +that version instead if you wish.) Do not make any other change in +these notices. + + Once this change is made in a given copy, it is irreversible for +that copy, so the ordinary GNU General Public License applies to all +subsequent copies and derivative works made from that copy. + + This option is useful when you wish to copy part of the code of +the Library into a program that is not a library. + + 4. You may copy and distribute the Library (or a portion or +derivative of it, under Section 2) in object code or executable form +under the terms of Sections 1 and 2 above provided that you accompany +it with the complete corresponding machine-readable source code, which +must be distributed under the terms of Sections 1 and 2 above on a +medium customarily used for software interchange. + + If distribution of object code is made by offering access to copy +from a designated place, then offering equivalent access to copy the +source code from the same place satisfies the requirement to +distribute the source code, even though third parties are not +compelled to copy the source along with the object code. + + 5. A program that contains no derivative of any portion of the +Library, but is designed to work with the Library by being compiled or +linked with it, is called a "work that uses the Library". Such a +work, in isolation, is not a derivative work of the Library, and +therefore falls outside the scope of this License. + + However, linking a "work that uses the Library" with the Library +creates an executable that is a derivative of the Library (because it +contains portions of the Library), rather than a "work that uses the +library". The executable is therefore covered by this License. +Section 6 states terms for distribution of such executables. + + When a "work that uses the Library" uses material from a header file +that is part of the Library, the object code for the work may be a +derivative work of the Library even though the source code is not. +Whether this is true is especially significant if the work can be +linked without the Library, or if the work is itself a library. The +threshold for this to be true is not precisely defined by law. + + If such an object file uses only numerical parameters, data +structure layouts and accessors, and small macros and small inline +functions (ten lines or less in length), then the use of the object +file is unrestricted, regardless of whether it is legally a derivative +work. (Executables containing this object code plus portions of the +Library will still fall under Section 6.) + + Otherwise, if the work is a derivative of the Library, you may +distribute the object code for the work under the terms of Section 6. +Any executables containing that work also fall under Section 6, +whether or not they are linked directly with the Library itself. + + 6. As an exception to the Sections above, you may also combine or +link a "work that uses the Library" with the Library to produce a +work containing portions of the Library, and distribute that work +under terms of your choice, provided that the terms permit +modification of the work for the customer's own use and reverse +engineering for debugging such modifications. + + You must give prominent notice with each copy of the work that the +Library is used in it and that the Library and its use are covered by +this License. You must supply a copy of this License. If the work +during execution displays copyright notices, you must include the +copyright notice for the Library among them, as well as a reference +directing the user to the copy of this License. Also, you must do one +of these things: + + a) Accompany the work with the complete corresponding + machine-readable source code for the Library including whatever + changes were used in the work (which must be distributed under + Sections 1 and 2 above); and, if the work is an executable linked + with the Library, with the complete machine-readable "work that + uses the Library", as object code and/or source code, so that the + user can modify the Library and then relink to produce a modified + executable containing the modified Library. (It is understood + that the user who changes the contents of definitions files in the + Library will not necessarily be able to recompile the application + to use the modified definitions.) + + b) Use a suitable shared library mechanism for linking with the + Library. A suitable mechanism is one that (1) uses at run time a + copy of the library already present on the user's computer system, + rather than copying library functions into the executable, and (2) + will operate properly with a modified version of the library, if + the user installs one, as long as the modified version is + interface-compatible with the version that the work was made with. + + c) Accompany the work with a written offer, valid for at + least three years, to give the same user the materials + specified in Subsection 6a, above, for a charge no more + than the cost of performing this distribution. + + d) If distribution of the work is made by offering access to copy + from a designated place, offer equivalent access to copy the above + specified materials from the same place. + + e) Verify that the user has already received a copy of these + materials or that you have already sent this user a copy. + + For an executable, the required form of the "work that uses the +Library" must include any data and utility programs needed for +reproducing the executable from it. However, as a special exception, +the materials to be distributed need not include anything that is +normally distributed (in either source or binary form) with the major +components (compiler, kernel, and so on) of the operating system on +which the executable runs, unless that component itself accompanies +the executable. + + It may happen that this requirement contradicts the license +restrictions of other proprietary libraries that do not normally +accompany the operating system. Such a contradiction means you cannot +use both them and the Library together in an executable that you +distribute. + + 7. You may place library facilities that are a work based on the +Library side-by-side in a single library together with other library +facilities not covered by this License, and distribute such a combined +library, provided that the separate distribution of the work based on +the Library and of the other library facilities is otherwise +permitted, and provided that you do these two things: + + a) Accompany the combined library with a copy of the same work + based on the Library, uncombined with any other library + facilities. This must be distributed under the terms of the + Sections above. + + b) Give prominent notice with the combined library of the fact + that part of it is a work based on the Library, and explaining + where to find the accompanying uncombined form of the same work. + + 8. You may not copy, modify, sublicense, link with, or distribute +the Library except as expressly provided under this License. Any +attempt otherwise to copy, modify, sublicense, link with, or +distribute the Library is void, and will automatically terminate your +rights under this License. However, parties who have received copies, +or rights, from you under this License will not have their licenses +terminated so long as such parties remain in full compliance. + + 9. You are not required to accept this License, since you have not +signed it. However, nothing else grants you permission to modify or +distribute the Library or its derivative works. These actions are +prohibited by law if you do not accept this License. Therefore, by +modifying or distributing the Library (or any work based on the +Library), you indicate your acceptance of this License to do so, and +all its terms and conditions for copying, distributing or modifying +the Library or works based on it. + + 10. Each time you redistribute the Library (or any work based on the +Library), the recipient automatically receives a license from the +original licensor to copy, distribute, link with or modify the Library +subject to these terms and conditions. You may not impose any further +restrictions on the recipients' exercise of the rights granted herein. +You are not responsible for enforcing compliance by third parties with +this License. + + 11. If, as a consequence of a court judgment or allegation of patent +infringement or for any other reason (not limited to patent issues), +conditions are imposed on you (whether by court order, agreement or +otherwise) that contradict the conditions of this License, they do not +excuse you from the conditions of this License. If you cannot +distribute so as to satisfy simultaneously your obligations under this +License and any other pertinent obligations, then as a consequence you +may not distribute the Library at all. For example, if a patent +license would not permit royalty-free redistribution of the Library by +all those who receive copies directly or indirectly through you, then +the only way you could satisfy both it and this License would be to +refrain entirely from distribution of the Library. + +If any portion of this section is held invalid or unenforceable under any +particular circumstance, the balance of the section is intended to apply, +and the section as a whole is intended to apply in other circumstances. + +It is not the purpose of this section to induce you to infringe any +patents or other property right claims or to contest validity of any +such claims; this section has the sole purpose of protecting the +integrity of the free software distribution system which is +implemented by public license practices. Many people have made +generous contributions to the wide range of software distributed +through that system in reliance on consistent application of that +system; it is up to the author/donor to decide if he or she is willing +to distribute software through any other system and a licensee cannot +impose that choice. + +This section is intended to make thoroughly clear what is believed to +be a consequence of the rest of this License. + + 12. If the distribution and/or use of the Library is restricted in +certain countries either by patents or by copyrighted interfaces, the +original copyright holder who places the Library under this License may add +an explicit geographical distribution limitation excluding those countries, +so that distribution is permitted only in or among countries not thus +excluded. In such case, this License incorporates the limitation as if +written in the body of this License. + + 13. The Free Software Foundation may publish revised and/or new +versions of the Lesser General Public License from time to time. +Such new versions will be similar in spirit to the present version, +but may differ in detail to address new problems or concerns. + +Each version is given a distinguishing version number. If the Library +specifies a version number of this License which applies to it and +"any later version", you have the option of following the terms and +conditions either of that version or of any later version published by +the Free Software Foundation. If the Library does not specify a +license version number, you may choose any version ever published by +the Free Software Foundation. + + 14. If you wish to incorporate parts of the Library into other free +programs whose distribution conditions are incompatible with these, +write to the author to ask for permission. For software which is +copyrighted by the Free Software Foundation, write to the Free +Software Foundation; we sometimes make exceptions for this. Our +decision will be guided by the two goals of preserving the free status +of all derivatives of our free software and of promoting the sharing +and reuse of software generally. + + NO WARRANTY + + 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO +WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. +EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR +OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY +KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE +IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR +PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE +LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME +THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. + + 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN +WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY +AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU +FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR +CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE +LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING +RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A +FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF +SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH +DAMAGES. + + END OF TERMS AND CONDITIONS diff --git a/apps/plugins/sdl/CREDITS b/apps/plugins/sdl/CREDITS new file mode 100644 index 0000000..efdcfa4 --- /dev/null +++ b/apps/plugins/sdl/CREDITS @@ -0,0 +1,94 @@ + +Simple DirectMedia Layer CREDITS +Thanks to everyone who made this possible, including: + +* Cliff Matthews, for giving me a reason to start this project. :) + -- Executor rocks! *grin* + +* Scott Call, for making a home for SDL on the 'Net... Thanks! :) + +* The Linux Fund, C Magazine, Educational Technology Resources Inc., + Gareth Noyce, Jesse Pavel, Keith Kitchin, Jeremy Horvath, Thomas Nicholson, + Hans-Peter Gygax, the Eternal Lands Development Team, Lars Brubaker, + and Phoenix Kokido for financial contributions + +* Gaëtan de Menten for writing the PHP and SQL behind the SDL website + +* Tim Jones for the new look of the SDL website + +* Marco Kraus for setting up SDL merchandise + +* Martin Donlon for his work on the SDL Documentation Project + +* Ryan Gordon for helping everybody out and keeping the dream alive. :) + +* IBM R&D Lab for their PS3 SPE video acceleration code + +* Mattias Engdegård, for help with the Solaris port and lots of other help + +* Max Watson, Matt Slot, and Kyle for help with the MacOS Classic port + +* Stan Shebs, for the initial Mac OS X port + +* Eric Wing, Max Horn, and Darrell Walisser for unflagging work on the Mac OS X port + +* Patrick Trainor, Jim Boucher, and Mike Gorchak for the QNX Neutrino port + +* Carsten Griwodz for the AIX port + +* Gabriele Greco, for the Amiga port + +* Patrice Mandin, for the Atari port + +* Hannu Viitala for the EPOC port + +* Marcus Mertama for the S60 port. + +* Peter Valchev for nagging me about the OpenBSD port until I got it right. :) + +* Kent B Mein, for a place to do the IRIX port + +* Ash, for a place to do the OSF/1 Alpha port + +* David Sowsy, for help with the BeOS port + +* Eugenia Loli, for endless work on porting SDL games to BeOS + +* Jon Taylor for the GGI front-end + +* Paulus Esterhazy, for the Visual C++ testing and libraries + +* Brenda Tantzen, for Metrowerks CodeWarrior on MacOS + +* Chris Nentwich, for the Hermes assembly blitters + +* Michael Vance and Jim Kutter for the X11 OpenGL support + +* Stephane Peter, for the AAlib front-end and multi-threaded timer idea. + +* Jon Atkins for SDL_image, SDL_mixer and SDL_net documentation + +* Peter Wiklund, for the 1998 winning SDL logo, + and Arto Hamara, Steven Wong, and Kent Mein for other logo entries. + +* Arne Claus, for the 2004 winning SDL logo, + and Shandy Brown, Jac, Alex Lyman, Mikkel Gjoel, #Guy, Jonas Hartmann, + Daniel Liljeberg, Ronald Sowa, DocD, Pekka Jaervinen, Patrick Avella, + Erkki Kontilla, Levon Gavalian, Hal Emerich, David Wiktorsson, + S. Schury and F. Hufsky, Ciska de Ruyver, Shredweat, Tyler Montbriand, + Martin Andersson, Merlyn Wysard, Fernando Ibanez, David Miller, + Andre Bommele, lovesby.com, Francisco Camenforte Torres, and David Igreja + for other logo entries. + +* Bob Pendleton and David Olofson for being long time contributors to + the SDL mailing list. + +* Everybody at Loki Software, Inc. for their great contributions! + + And a big hand to everyone else who gave me appreciation, advice, + and suggestions, especially the good folks on the SDL mailing list. + +THANKS! :) + + -- Sam Lantinga + diff --git a/apps/plugins/sdl/NOTES b/apps/plugins/sdl/NOTES new file mode 100644 index 0000000..96b9046 --- /dev/null +++ b/apps/plugins/sdl/NOTES @@ -0,0 +1,5 @@ +- SDL sources are mostly untouched, only some minor tweaks to make it build +- SDL_image only builds XPM support, edit SDL_config_rockbox.h to change +- Only video and "keyboard" drivers are implemented, sound and threading are a WIP +- Video may not work under all pixel formats, please tell me if it doesn't! +- Ported SDL would conflict with hosted platform's SDL, if present. Worked around by using objcopy --redefine-syms diff --git a/apps/plugins/sdl/README b/apps/plugins/sdl/README new file mode 100644 index 0000000..9899f95 --- /dev/null +++ b/apps/plugins/sdl/README @@ -0,0 +1,51 @@ +See NOTES for Rockbox-specific porting notes. +The original README is below: + + Simple DirectMedia Layer + + (SDL) + + Version 1.2 + +--- +http://www.libsdl.org/ + +This is the Simple DirectMedia Layer, a general API that provides low +level access to audio, keyboard, mouse, joystick, 3D hardware via OpenGL, +and 2D framebuffer across multiple platforms. + +The current version supports Linux, Windows CE/95/98/ME/XP/Vista, BeOS, +MacOS Classic, Mac OS X, FreeBSD, NetBSD, OpenBSD, BSD/OS, Solaris, IRIX, +and QNX. The code contains support for Dreamcast, Atari, AIX, OSF/Tru64, +RISC OS, SymbianOS, Nintendo DS, and OS/2, but these are not officially +supported. + +SDL is written in C, but works with C++ natively, and has bindings to +several other languages, including Ada, C#, Eiffel, Erlang, Euphoria, +Guile, Haskell, Java, Lisp, Lua, ML, Objective C, Pascal, Perl, PHP, +Pike, Pliant, Python, Ruby, and Smalltalk. + +This library is distributed under GNU LGPL version 2, which can be +found in the file "COPYING". This license allows you to use SDL +freely in commercial programs as long as you link with the dynamic +library. + +The best way to learn how to use SDL is to check out the header files in +the "include" subdirectory and the programs in the "test" subdirectory. +The header files and test programs are well commented and always up to date. +More documentation is available in HTML format in "docs/index.html", and +a documentation wiki is available online at: + http://www.libsdl.org/cgi/docwiki.cgi + +The test programs in the "test" subdirectory are in the public domain. + +Frequently asked questions are answered online: + http://www.libsdl.org/faq.php + +If you need help with the library, or just want to discuss SDL related +issues, you can join the developers mailing list: + http://www.libsdl.org/mailing-list.php + +Enjoy! + Sam Lantinga (slouken@libsdl.org) + diff --git a/apps/plugins/sdl/README-SDL.txt b/apps/plugins/sdl/README-SDL.txt new file mode 100644 index 0000000..4d36ca9 --- /dev/null +++ b/apps/plugins/sdl/README-SDL.txt @@ -0,0 +1,13 @@ + +Please distribute this file with the SDL runtime environment: + +The Simple DirectMedia Layer (SDL for short) is a cross-platfrom library +designed to make it easy to write multi-media software, such as games and +emulators. + +The Simple DirectMedia Layer library source code is available from: +http://www.libsdl.org/ + +This library is distributed under the terms of the GNU LGPL license: +http://www.gnu.org/copyleft/lesser.html + diff --git a/apps/plugins/sdl/README.Porting b/apps/plugins/sdl/README.Porting new file mode 100644 index 0000000..df61993 --- /dev/null +++ b/apps/plugins/sdl/README.Porting @@ -0,0 +1,56 @@ + +* Porting To A New Platform + + The first thing you have to do when porting to a new platform, is look at +include/SDL_platform.h and create an entry there for your operating system. +The standard format is __PLATFORM__, where PLATFORM is the name of the OS. +Ideally SDL_platform.h will be able to auto-detect the system it's building +on based on C preprocessor symbols. + +There are two basic ways of building SDL at the moment: + +1. The "UNIX" way: ./configure; make; make install + + If you have a GNUish system, then you might try this. Edit configure.in, + take a look at the large section labelled: + "Set up the configuration based on the target platform!" + Add a section for your platform, and then re-run autogen.sh and build! + +2. Using an IDE: + + If you're using an IDE or other non-configure build system, you'll probably + want to create a custom SDL_config.h for your platform. Edit SDL_config.h, + add a section for your platform, and create a custom SDL_config_{platform}.h, + based on SDL_config.h.minimal and SDL_config.h.in + + Add the top level include directory to the header search path, and then add + the following sources to the project: + src/*.c + src/audio/*.c + src/cdrom/*.c + src/cpuinfo/*.c + src/events/*.c + src/file/*.c + src/joystick/*.c + src/stdlib/*.c + src/thread/*.c + src/timer/*.c + src/video/*.c + src/audio/disk/*.c + src/video/dummy/*.c + src/joystick/dummy/*.c + src/cdrom/dummy/*.c + src/thread/generic/*.c + src/timer/dummy/*.c + src/loadso/dummy/*.c + + +Once you have a working library without any drivers, you can go back to each +of the major subsystems and start implementing drivers for your platform. + +If you have any questions, don't hesitate to ask on the SDL mailing list: + http://www.libsdl.org/mailing-list.php + +Enjoy! + Sam Lantinga (slouken@libsdl.org) + diff --git a/apps/plugins/sdl/SDL_image/CHANGES b/apps/plugins/sdl/SDL_image/CHANGES new file mode 100644 index 0000000..afaa520 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/CHANGES @@ -0,0 +1,198 @@ +1.2.12: +Sam Lantinga - Thu Jan 19 23:18:09 EST 2012 + * Fixed regression in 1.2.11 loading 8-bit PNG images with libpng + +1.2.11: +Sam Lantinga - Sat Jan 14 17:54:38 EST 2012 + * Fixed loading 8-bit PNG images on Mac OS X +Sam Lantinga - Sat Dec 31 09:35:40 EST 2011 + * SDL_image is now under the zlib license +Michael Bonfils - Mon Nov 28 21:46:00 EST 2011 + * Added WEBP image support +Thomas Klausner - Wed Jan 19 19:31:25 PST 2011 + * Fixed compiling with libpng 1.4 +Sam Lantinga - Mon Jan 10 12:09:57 2011 -0800 + * Added Android.mk to build on the Android platform +Sam Lantinga - Mon May 10 22:42:53 PDT 2010 + * Fixed loading HAM6 images with stencil mask +Mark Tucker - Fri, 27 Nov 2009 12:38:21 -0500 + * Fixed bug loading 15 and 16 bit BMP images + +1.2.10: +Sam Lantinga - Sat Nov 14 11:22:14 PST 2009 + * Fixed bug loading multiple images + +1.2.9: +Sam Lantinga - Tue Nov 10 00:29:20 PST 2009 + * Fixed alpha premultiplication on Mac OS X and iPhone OS +Sam Lantinga - Sun Nov 8 07:52:11 PST 2009 + * Fixed checking for IMG_Init() return value in image loaders + +1.2.8: +Sam Lantinga - Sun Oct 4 13:12:54 PDT 2009 + * Added support for uncompressed PCX files +Mason Wheeler - 2009-06-10 06:29:45 PDT + * Added IMG_Init()/IMG_Quit() to prevent constantly loading and unloading DLLs +Couriersud - Mon, 12 Jan 2009 17:21:13 -0800 + * Added support for ICO and CUR image files +Eric Wing - Fri, 2 Jan 2009 02:01:16 -0800 + * Added ImageIO loading infrastructure for Mac OS X + * Added UIImage loading infrastructure for iPhone / iPod Touch + +1.2.7: +Sam Lantinga - Sun Nov 2 15:08:27 PST 2008 + * Fixed buffer overflow in BMP loading code, discovered by j00ru//vx +Sam Lantinga - Fri Dec 28 08:34:54 PST 2007 + * Fixed buffer overflow in GIF loading code, discovered by Michael Skladnikiewicz + +1.2.6: +Sam lantinga - Wed Jul 18 00:30:32 PDT 2007 + * Improved detection of libjpeg, libpng, and libtiff at configure time + * PNG and TIFF images are correctly identified even if dynamic libraries + to load them aren't available. + * Fixed loading of TIFF images using libtiff 3.6 +Sam Lantinga - Thu Jul 5 07:52:35 2007 + * Fixed static linking with libjpeg +Michael Koch - Tue Feb 13 10:09:17 2007 + * Fixed crash in IMG_ReadXPMFromArray() + +1.2.5: +Maurizio Monge - Sun May 14 13:57:32 PDT 2006 + * Fixed loading BMP palettes at unusual offsets +Sam Lantinga - Thu May 11 21:51:19 PDT 2006 + * Added support for dynamically loading libjpeg, libpng, and libtiff. +Sam Lantinga - Sun Apr 30 01:48:40 PDT 2006 + * Added gcc-fat.sh for generating Universal binaries on Mac OS X + * Updated libtool support to version 1.5.22 +Sam Lantinga - Sat Feb 4 15:17:44 PST 2006 + * Added support for XV thumbnail images +Gautier Portet - Fri, 19 Mar 2004 17:35:12 +0100 + * Added support for 32-bit BMP files with alpha + +1.2.4: +Pierre G. Richard - Fri, 30 Jul 2004 11:13:11 +0000 (UTC) + * Added support for RLE encoded BMP files +Marc Le Douarain - Fri, 26 Dec 2003 18:23:42 +0100 + * Added EHB and HAM mode support to the ILBM loader +Sam Lantinga - Wed Nov 19 00:23:44 PST 2003 + * Updated libtool support for new mingw32 DLL build process +Holger Schemel - Mon, 04 Aug 2003 21:50:52 +0200 + * Fixed crash loading certain PCX images +Kyle Davenport - Sat, 19 Apr 2003 17:13:31 -0500 + * Added .la files to the development RPM, fixing RPM build on RedHat 8 + +1.2.3: +Ryan C. Gordon - Sat, 8 Feb 2003 09:36:33 -0500 + * Fixed memory leak with non-seekable SDL_RWops +Marc Le Douarain - Sun, 22 Dec 2002 22:59:51 +0100 + * Added 24-bit support to the ILBM format loader +Sam Lantinga - Sun Oct 20 20:55:46 PDT 2002 + * Added shared library support for MacOS X +Pete Shinners - Thu Jun 20 10:05:54 PDT 2002 + * The JPEG loader can now load EXIF format JPEG images +Dag-Erling Smorgrav - Thu May 2 19:09:48 PDT 2002 + * The XCF loader now ignores invisible layers and channels + +1.2.2: +Sam Lantinga - Sat Apr 13 07:49:47 PDT 2002 + * Updated autogen.sh for new versions of automake + * Specify the SDL API calling convention (C by default) +Mattias Engdegård - Fri Dec 28 17:54:31 PST 2001 + * Worked around exit() in the jpeg image library + +1.2.1: +Mattias Engdegård - Tue Nov 20 08:08:53 PST 2001 + * Fixed transparency in the GIF loading code +Daniel Morais - Sun Sep 23 16:32:13 PDT 2001 + * Added support for the IFF (LBM) image format +Sam Lantinga - Sun Aug 19 01:51:44 PDT 2001 + * Added Project Builder projects for building MacOS X framework +Mattias Engdegård - Tue Jul 31 04:32:29 PDT 2001 + * Fixed transparency in 8-bit PNG files +Mattias Engdegård - Sat Apr 28 11:30:22 PDT 2001 + * Added support for loading XPM image data directly +Paul Jenner - Sat, 14 Apr 2001 09:20:38 -0700 (PDT) + * Added support for building RPM directly from tar archive + +1.2.0: +Sam Lantinga - Wed Apr 4 12:42:20 PDT 2001 + * Synchronized release version with SDL 1.2.0 + +1.1.1: +Berni - Wed Mar 7 09:18:02 PST 2001 + * Added initial GIMP XCF support (disabled by default) +Mattias Engdegård - Wed Mar 7 09:01:49 PST 2001 + * Added general PNM (PPM/PGM/PBM) support +Mattias Engdegård - Sun Mar 4 14:23:42 PST 2001 + * Fixed bugs in PPM support, added ASCII PPM support +Mattias Engdegård - Fri Mar 2 14:48:09 PST 2001 + * Cleaned up some compiler warnings +Mattias Engdegård - Tue Feb 27 12:44:43 PST 2001 + * Improved the PCX loading code + * Modified showimage to set hardware palette for 8-bit displays +Robert Stein - Thu, 22 Feb 2001 14:26:19 -0600 + * Improved the PPM loading code +Sam Lantinga - Tue Jan 30 14:24:06 PST 2001 + * Modified showimage to accept multiple images on the command line +Sam Lantinga - Mon Dec 18 02:49:29 PST 2000 + * Added a Visual C++ project including JPEG and PNG loading support +Mattias Engdegård - Wed Dec 6 10:00:07 PST 2000 + * Improved the XPM loading code + +1.1.0: +Sam Lantinga - Wed Nov 29 00:46:27 PST 2000 + * Added XPM file format support + Supports color, greyscale, and mono XPMs with and without transparency +Mattias Engdegård - Thu, 2 Nov 2000 23:23:17 +0100 (MET) + * Fixed array overrun when loading an unsupported format + * Minor compilation fixes for various platforms + +1.0.10: +Mattias Engdegård - Wed Aug 9 20:32:22 MET DST 2000 + * Removed the alpha flipping, made IMG_InvertAlpha() a noop + * Fixed nonexisting PCX alpha support + * Some TIFF bugfixes + * PNG greyscale images are loaded as 8bpp with a greyscale palette +Ray Kelm - Fri, 04 Aug 2000 20:58:00 -0400 + * Added support for cross-compiling Windows DLL from Linux + +1.0.9: +Mattias Engdegård - Sat Jul 1 17:57:37 PDT 2000 + * PNG loader properly sets the colorkey on 8-bit transparent images +Mattias Engdegård - Sat Jul 1 13:24:47 PDT 2000 + * Fixed a bug in PCX detection + * Added support for TGA files + * showimage shows a checker background for transparent images + +1.0.8: +Mark Baker - Tue May 30 12:20:00 PDT 2000 + * Added TIFF format loading support + +1.0.7: +Mattias Engdegård - Sat May 27 14:18:33 PDT 2000 + * Added fixes for loading images on big-endian systems + +1.0.6: +Sam Lantinga - Sat Apr 29 10:18:32 PDT 2000 + * showimage puts the name of the image in the title bar caption +Sam Lantinga - Sat Apr 29 10:05:58 PDT 2000 + * Removed pitch check, since PNG already loads to a list of row pointers + +1.0.5: +Sam Lantinga - Sun Apr 23 14:41:32 PDT 2000 + * Added support for GIF transparency +Sam Lantinga - Wed Apr 12 14:39:20 PDT 2000 + * Fixed memory heap crash on NT using PNG images +Matt Campbell - Thu, 13 Apr 2000 13:29:17 -0700 + * Fixed PNG detection on some Linux systems + +1.0.4: +Sam Lantinga - Tue Feb 1 13:33:53 PST 2000 + * Cleaned up for Visual C++ + * Added Visual C++ project file + +1.0.3: +Sam Lantinga - Wed Jan 19 22:10:52 PST 2000 + * Added CHANGES + * Added rpm spec file contributed by Hakan Tandogan + * Changed the name of the example program from "show" to "showimage" diff --git a/apps/plugins/sdl/SDL_image/COPYING b/apps/plugins/sdl/SDL_image/COPYING new file mode 100644 index 0000000..4e93f20 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/COPYING @@ -0,0 +1,20 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ diff --git a/apps/plugins/sdl/SDL_image/IMG.c b/apps/plugins/sdl/SDL_image/IMG.c new file mode 100644 index 0000000..5870767 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG.c @@ -0,0 +1,214 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* A simple library to load images of various formats as SDL surfaces */ + +#include +#include +#include + +#include "SDL_image.h" + +#define ARRAYSIZE(a) (sizeof(a) / sizeof((a)[0])) + +/* Table of image detection and loading functions */ +static struct { + char *type; + int (SDLCALL *is)(SDL_RWops *src); + SDL_Surface *(SDLCALL *load)(SDL_RWops *src); +} supported[] = { + /* keep magicless formats first */ + { "TGA", NULL, IMG_LoadTGA_RW }, + { "CUR", IMG_isCUR, IMG_LoadCUR_RW }, + { "ICO", IMG_isICO, IMG_LoadICO_RW }, + { "BMP", IMG_isBMP, IMG_LoadBMP_RW }, + { "GIF", IMG_isGIF, IMG_LoadGIF_RW }, + { "JPG", IMG_isJPG, IMG_LoadJPG_RW }, + { "LBM", IMG_isLBM, IMG_LoadLBM_RW }, + { "PCX", IMG_isPCX, IMG_LoadPCX_RW }, + { "PNG", IMG_isPNG, IMG_LoadPNG_RW }, + { "PNM", IMG_isPNM, IMG_LoadPNM_RW }, /* P[BGP]M share code */ + { "TIF", IMG_isTIF, IMG_LoadTIF_RW }, + { "XCF", IMG_isXCF, IMG_LoadXCF_RW }, + { "XPM", IMG_isXPM, IMG_LoadXPM_RW }, + { "XV", IMG_isXV, IMG_LoadXV_RW }, + { "WEBP", IMG_isWEBP, IMG_LoadWEBP_RW }, +}; + +const SDL_version *IMG_Linked_Version(void) +{ + static SDL_version linked_version; + SDL_IMAGE_VERSION(&linked_version); + return(&linked_version); +} + +extern int IMG_InitJPG(); +extern void IMG_QuitJPG(); +extern int IMG_InitPNG(); +extern void IMG_QuitPNG(); +extern int IMG_InitTIF(); +extern void IMG_QuitTIF(); + +extern int IMG_InitWEBP(); +extern void IMG_QuitWEBP(); + +static int initialized = 0; + +int IMG_Init(int flags) +{ + int result = 0; + + if (flags & IMG_INIT_JPG) { + if ((initialized & IMG_INIT_JPG) || IMG_InitJPG() == 0) { + result |= IMG_INIT_JPG; + } + } + if (flags & IMG_INIT_PNG) { + if ((initialized & IMG_INIT_PNG) || IMG_InitPNG() == 0) { + result |= IMG_INIT_PNG; + } + } + if (flags & IMG_INIT_TIF) { + if ((initialized & IMG_INIT_TIF) || IMG_InitTIF() == 0) { + result |= IMG_INIT_TIF; + } + } + if (flags & IMG_INIT_WEBP) { + if ((initialized & IMG_INIT_WEBP) || IMG_InitWEBP() == 0) { + result |= IMG_INIT_WEBP; + } + } + initialized |= result; + + return (initialized); +} + +void IMG_Quit() +{ + if (initialized & IMG_INIT_JPG) { + IMG_QuitJPG(); + } + if (initialized & IMG_INIT_PNG) { + IMG_QuitPNG(); + } + if (initialized & IMG_INIT_TIF) { + IMG_QuitTIF(); + } + if (initialized & IMG_INIT_WEBP) { + IMG_QuitWEBP(); + } + initialized = 0; +} + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) +/* Load an image from a file */ +SDL_Surface *IMG_Load(const char *file) +{ + SDL_RWops *src = SDL_RWFromFile(file, "rb"); + char *ext = strrchr(file, '.'); + if(ext) { + ext++; + } + if(!src) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + return IMG_LoadTyped_RW(src, 1, ext); +} +#endif + +/* Load an image from an SDL datasource (for compatibility) */ +SDL_Surface *IMG_Load_RW(SDL_RWops *src, int freesrc) +{ + return IMG_LoadTyped_RW(src, freesrc, NULL); +} + +/* Portable case-insensitive string compare function */ +static int IMG_string_equals(const char *str1, const char *str2) +{ + while ( *str1 && *str2 ) { + if ( toupper((unsigned char)*str1) != + toupper((unsigned char)*str2) ) + break; + ++str1; + ++str2; + } + return (!*str1 && !*str2); +} + +/* Load an image from an SDL datasource, optionally specifying the type */ +SDL_Surface *IMG_LoadTyped_RW(SDL_RWops *src, int freesrc, char *type) +{ + int i; + SDL_Surface *image; + + /* Make sure there is something to do.. */ + if ( src == NULL ) { + IMG_SetError("Passed a NULL data source"); + return(NULL); + } + + /* See whether or not this data source can handle seeking */ + if ( SDL_RWseek(src, 0, RW_SEEK_CUR) < 0 ) { + IMG_SetError("Can't seek in this data source"); + if(freesrc) + SDL_RWclose(src); + return(NULL); + } + + /* Detect the type of image being loaded */ + image = NULL; + for ( i=0; i < ARRAYSIZE(supported); ++i ) { + if(supported[i].is) { + if(!supported[i].is(src)) + { + continue; + } + } else { + /* magicless format */ + if(!type + || !IMG_string_equals(type, supported[i].type)) + continue; + } +#ifdef DEBUG_IMGLIB + fprintf(stderr, "IMGLIB: Loading image as %s\n", + supported[i].type); +#endif + image = supported[i].load(src); + if(freesrc) + SDL_RWclose(src); + return image; + } + + if ( freesrc ) { + SDL_RWclose(src); + } + IMG_SetError("Unsupported image format"); + return NULL; +} + +/* Invert the alpha of a surface for use with OpenGL + This function is a no-op and only kept for backwards compatibility. + */ +int IMG_InvertAlpha(int on) +{ + return 1; +} diff --git a/apps/plugins/sdl/SDL_image/IMG_bmp.c b/apps/plugins/sdl/SDL_image/IMG_bmp.c new file mode 100644 index 0000000..b3c7580 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_bmp.c @@ -0,0 +1,848 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) + +/* This is a BMP image file loading framework */ +/* ICO/CUR file support is here as well since it uses similar internal + * representation */ + +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_BMP + +/* See if an image is contained in a data source */ +int IMG_isBMP(SDL_RWops *src) +{ + int start; + int is_BMP; + char magic[2]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_BMP = 0; + if ( SDL_RWread(src, magic, sizeof(magic), 1) ) { + if ( strncmp(magic, "BM", 2) == 0 ) { + is_BMP = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_BMP); +} + +static int IMG_isICOCUR(SDL_RWops *src, int type) +{ + int start; + int is_ICOCUR; + + /* The Win32 ICO file header (14 bytes) */ + Uint16 bfReserved; + Uint16 bfType; + Uint16 bfCount; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_ICOCUR = 0; + bfReserved = SDL_ReadLE16(src); + bfType = SDL_ReadLE16(src); + bfCount = SDL_ReadLE16(src); + if ((bfReserved == 0) && (bfType == type) && (bfCount != 0)) + is_ICOCUR = 1; + SDL_RWseek(src, start, RW_SEEK_SET); + + return (is_ICOCUR); +} + +int IMG_isICO(SDL_RWops *src) +{ + return IMG_isICOCUR(src, 1); +} + +int IMG_isCUR(SDL_RWops *src) +{ + return IMG_isICOCUR(src, 2); +} + +#include "SDL_error.h" +#include "SDL_video.h" +#include "SDL_endian.h" + +/* Compression encodings for BMP files */ +#ifndef BI_RGB +#define BI_RGB 0 +#define BI_RLE8 1 +#define BI_RLE4 2 +#define BI_BITFIELDS 3 +#endif + +static int readRlePixels(SDL_Surface * surface, SDL_RWops * src, int isRle8) +{ + /* + | Sets the surface pixels from src. A bmp image is upside down. + */ + int pitch = surface->pitch; + int height = surface->h; + Uint8 *start = (Uint8 *)surface->pixels; + Uint8 *end = start + (height*pitch); + Uint8 *bits = end-pitch, *spot; + int ofs = 0; + Uint8 ch; + Uint8 needsPad; + +#define COPY_PIXEL(x) spot = &bits[ofs++]; if(spot >= start && spot < end) *spot = (x) + + for (;;) { + if ( !SDL_RWread(src, &ch, 1, 1) ) return 1; + /* + | encoded mode starts with a run length, and then a byte + | with two colour indexes to alternate between for the run + */ + if ( ch ) { + Uint8 pixel; + if ( !SDL_RWread(src, &pixel, 1, 1) ) return 1; + if ( isRle8 ) { /* 256-color bitmap, compressed */ + do { + COPY_PIXEL(pixel); + } while (--ch); + } else { /* 16-color bitmap, compressed */ + Uint8 pixel0 = pixel >> 4; + Uint8 pixel1 = pixel & 0x0F; + for (;;) { + COPY_PIXEL(pixel0); /* even count, high nibble */ + if (!--ch) break; + COPY_PIXEL(pixel1); /* odd count, low nibble */ + if (!--ch) break; + } + } + } else { + /* + | A leading zero is an escape; it may signal the end of the bitmap, + | a cursor move, or some absolute data. + | zero tag may be absolute mode or an escape + */ + if ( !SDL_RWread(src, &ch, 1, 1) ) return 1; + switch (ch) { + case 0: /* end of line */ + ofs = 0; + bits -= pitch; /* go to previous */ + break; + case 1: /* end of bitmap */ + return 0; /* success! */ + case 2: /* delta */ + if ( !SDL_RWread(src, &ch, 1, 1) ) return 1; + ofs += ch; + if ( !SDL_RWread(src, &ch, 1, 1) ) return 1; + bits -= (ch * pitch); + break; + default: /* no compression */ + if (isRle8) { + needsPad = ( ch & 1 ); + do { + Uint8 pixel; + if ( !SDL_RWread(src, &pixel, 1, 1) ) return 1; + COPY_PIXEL(pixel); + } while (--ch); + } else { + needsPad = ( ((ch+1)>>1) & 1 ); /* (ch+1)>>1: bytes size */ + for (;;) { + Uint8 pixel; + if ( !SDL_RWread(src, &pixel, 1, 1) ) return 1; + COPY_PIXEL(pixel >> 4); + if (!--ch) break; + COPY_PIXEL(pixel & 0x0F); + if (!--ch) break; + } + } + /* pad at even boundary */ + if ( needsPad && !SDL_RWread(src, &ch, 1, 1) ) return 1; + break; + } + } + } +} + +static SDL_Surface *LoadBMP_RW (SDL_RWops *src, int freesrc) +{ + SDL_bool was_error; + long fp_offset; + int bmpPitch; + int i, pad; + SDL_Surface *surface; + Uint32 Rmask; + Uint32 Gmask; + Uint32 Bmask; + Uint32 Amask; + SDL_Palette *palette; + Uint8 *bits; + Uint8 *top, *end; + SDL_bool topDown; + int ExpandBMP; + + /* The Win32 BMP file header (14 bytes) */ + char magic[2]; + Uint32 bfSize; + Uint16 bfReserved1; + Uint16 bfReserved2; + Uint32 bfOffBits; + + /* The Win32 BITMAPINFOHEADER struct (40 bytes) */ + Uint32 biSize; + Sint32 biWidth; + Sint32 biHeight; + Uint16 biPlanes; + Uint16 biBitCount; + Uint32 biCompression; + Uint32 biSizeImage; + Sint32 biXPelsPerMeter; + Sint32 biYPelsPerMeter; + Uint32 biClrUsed; + Uint32 biClrImportant; + + /* Make sure we are passed a valid data source */ + surface = NULL; + was_error = SDL_FALSE; + if ( src == NULL ) { + was_error = SDL_TRUE; + goto done; + } + + /* Read in the BMP file header */ + fp_offset = SDL_RWtell(src); + SDL_ClearError(); + if ( SDL_RWread(src, magic, 1, 2) != 2 ) { + SDL_Error(SDL_EFREAD); + was_error = SDL_TRUE; + goto done; + } + if ( strncmp(magic, "BM", 2) != 0 ) { + IMG_SetError("File is not a Windows BMP file"); + was_error = SDL_TRUE; + goto done; + } + bfSize = SDL_ReadLE32(src); + bfReserved1 = SDL_ReadLE16(src); + bfReserved2 = SDL_ReadLE16(src); + bfOffBits = SDL_ReadLE32(src); + + /* Read the Win32 BITMAPINFOHEADER */ + biSize = SDL_ReadLE32(src); + if ( biSize == 12 ) { + biWidth = (Uint32)SDL_ReadLE16(src); + biHeight = (Uint32)SDL_ReadLE16(src); + biPlanes = SDL_ReadLE16(src); + biBitCount = SDL_ReadLE16(src); + biCompression = BI_RGB; + biSizeImage = 0; + biXPelsPerMeter = 0; + biYPelsPerMeter = 0; + biClrUsed = 0; + biClrImportant = 0; + } else { + biWidth = SDL_ReadLE32(src); + biHeight = SDL_ReadLE32(src); + biPlanes = SDL_ReadLE16(src); + biBitCount = SDL_ReadLE16(src); + biCompression = SDL_ReadLE32(src); + biSizeImage = SDL_ReadLE32(src); + biXPelsPerMeter = SDL_ReadLE32(src); + biYPelsPerMeter = SDL_ReadLE32(src); + biClrUsed = SDL_ReadLE32(src); + biClrImportant = SDL_ReadLE32(src); + } + if (biHeight < 0) { + topDown = SDL_TRUE; + biHeight = -biHeight; + } else { + topDown = SDL_FALSE; + } + + /* Check for read error */ + if ( strcmp(SDL_GetError(), "") != 0 ) { + was_error = SDL_TRUE; + goto done; + } + + /* Expand 1 and 4 bit bitmaps to 8 bits per pixel */ + switch (biBitCount) { + case 1: + case 4: + ExpandBMP = biBitCount; + biBitCount = 8; + break; + default: + ExpandBMP = 0; + break; + } + + /* RLE4 and RLE8 BMP compression is supported */ + Rmask = Gmask = Bmask = Amask = 0; + switch (biCompression) { + case BI_RGB: + /* If there are no masks, use the defaults */ + if ( bfOffBits == (14+biSize) ) { + /* Default values for the BMP format */ + switch (biBitCount) { + case 15: + case 16: + Rmask = 0x7C00; + Gmask = 0x03E0; + Bmask = 0x001F; + break; + case 24: +#if SDL_BYTEORDER == SDL_BIG_ENDIAN + Rmask = 0x000000FF; + Gmask = 0x0000FF00; + Bmask = 0x00FF0000; +#else + Rmask = 0x00FF0000; + Gmask = 0x0000FF00; + Bmask = 0x000000FF; +#endif + break; + case 32: + Amask = 0xFF000000; + Rmask = 0x00FF0000; + Gmask = 0x0000FF00; + Bmask = 0x000000FF; + break; + default: + break; + } + break; + } + /* Fall through -- read the RGB masks */ + + default: + switch (biBitCount) { + case 15: + case 16: + Rmask = SDL_ReadLE32(src); + Gmask = SDL_ReadLE32(src); + Bmask = SDL_ReadLE32(src); + break; + case 32: + Rmask = SDL_ReadLE32(src); + Gmask = SDL_ReadLE32(src); + Bmask = SDL_ReadLE32(src); + Amask = SDL_ReadLE32(src); + break; + default: + break; + } + break; + } + + /* Create a compatible surface, note that the colors are RGB ordered */ + surface = SDL_CreateRGBSurface(SDL_SWSURFACE, + biWidth, biHeight, biBitCount, Rmask, Gmask, Bmask, Amask); + if ( surface == NULL ) { + was_error = SDL_TRUE; + goto done; + } + + /* Load the palette, if any */ + palette = (surface->format)->palette; + if ( palette ) { + if ( SDL_RWseek(src, fp_offset+14+biSize, RW_SEEK_SET) < 0 ) { + SDL_Error(SDL_EFSEEK); + was_error = SDL_TRUE; + goto done; + } + + /* + | guich: always use 1<colors[i].b, 1, 1); + SDL_RWread(src, &palette->colors[i].g, 1, 1); + SDL_RWread(src, &palette->colors[i].r, 1, 1); + palette->colors[i].unused = 0; + } + } else { + for ( i = 0; i < (int)biClrUsed; ++i ) { + SDL_RWread(src, &palette->colors[i].b, 1, 1); + SDL_RWread(src, &palette->colors[i].g, 1, 1); + SDL_RWread(src, &palette->colors[i].r, 1, 1); + SDL_RWread(src, &palette->colors[i].unused, 1, 1); + } + } + palette->ncolors = biClrUsed; + } + + /* Read the surface pixels. Note that the bmp image is upside down */ + if ( SDL_RWseek(src, fp_offset+bfOffBits, RW_SEEK_SET) < 0 ) { + SDL_Error(SDL_EFSEEK); + was_error = SDL_TRUE; + goto done; + } + if ((biCompression == BI_RLE4) || (biCompression == BI_RLE8)) { + was_error = readRlePixels(surface, src, biCompression == BI_RLE8); + if (was_error) IMG_SetError("Error reading from BMP"); + goto done; + } + top = (Uint8 *)surface->pixels; + end = (Uint8 *)surface->pixels+(surface->h*surface->pitch); + switch (ExpandBMP) { + case 1: + bmpPitch = (biWidth + 7) >> 3; + pad = (((bmpPitch)%4) ? (4-((bmpPitch)%4)) : 0); + break; + case 4: + bmpPitch = (biWidth + 1) >> 1; + pad = (((bmpPitch)%4) ? (4-((bmpPitch)%4)) : 0); + break; + default: + pad = ((surface->pitch%4) ? + (4-(surface->pitch%4)) : 0); + break; + } + if ( topDown ) { + bits = top; + } else { + bits = end - surface->pitch; + } + while ( bits >= top && bits < end ) { + switch (ExpandBMP) { + case 1: + case 4: { + Uint8 pixel = 0; + int shift = (8-ExpandBMP); + for ( i=0; iw; ++i ) { + if ( i%(8/ExpandBMP) == 0 ) { + if ( !SDL_RWread(src, &pixel, 1, 1) ) { + IMG_SetError( + "Error reading from BMP"); + was_error = SDL_TRUE; + goto done; + } + } + *(bits+i) = (pixel>>shift); + pixel <<= ExpandBMP; + } } + break; + + default: + if ( SDL_RWread(src, bits, 1, surface->pitch) + != surface->pitch ) { + SDL_Error(SDL_EFREAD); + was_error = SDL_TRUE; + goto done; + } +#if SDL_BYTEORDER == SDL_BIG_ENDIAN + /* Byte-swap the pixels if needed. Note that the 24bpp + case has already been taken care of above. */ + switch(biBitCount) { + case 15: + case 16: { + Uint16 *pix = (Uint16 *)bits; + for(i = 0; i < surface->w; i++) + pix[i] = SDL_Swap16(pix[i]); + break; + } + + case 32: { + Uint32 *pix = (Uint32 *)bits; + for(i = 0; i < surface->w; i++) + pix[i] = SDL_Swap32(pix[i]); + break; + } + } +#endif + break; + } + /* Skip padding bytes, ugh */ + if ( pad ) { + Uint8 padbyte; + for ( i=0; ipitch; + } else { + bits -= surface->pitch; + } + } +done: + if ( was_error ) { + if ( src ) { + SDL_RWseek(src, fp_offset, RW_SEEK_SET); + } + if ( surface ) { + SDL_FreeSurface(surface); + } + surface = NULL; + } + if ( freesrc && src ) { + SDL_RWclose(src); + } + return(surface); +} + +static Uint8 +SDL_Read8(SDL_RWops * src) +{ + Uint8 value; + + SDL_RWread(src, &value, 1, 1); + return (value); +} + +static SDL_Surface * +LoadICOCUR_RW(SDL_RWops * src, int type, int freesrc) +{ + SDL_bool was_error; + long fp_offset; + int bmpPitch; + int i, pad; + SDL_Surface *surface; + Uint32 Rmask; + Uint32 Gmask; + Uint32 Bmask; + Uint8 *bits; + int ExpandBMP; + int maxCol = 0; + int icoOfs = 0; + Uint32 palette[256]; + + /* The Win32 ICO file header (14 bytes) */ + Uint16 bfReserved; + Uint16 bfType; + Uint16 bfCount; + + /* The Win32 BITMAPINFOHEADER struct (40 bytes) */ + Uint32 biSize; + Sint32 biWidth; + Sint32 biHeight; + Uint16 biPlanes; + Uint16 biBitCount; + Uint32 biCompression; + Uint32 biSizeImage; + Sint32 biXPelsPerMeter; + Sint32 biYPelsPerMeter; + Uint32 biClrUsed; + Uint32 biClrImportant; + + /* Make sure we are passed a valid data source */ + surface = NULL; + was_error = SDL_FALSE; + if (src == NULL) { + was_error = SDL_TRUE; + goto done; + } + + /* Read in the ICO file header */ + fp_offset = SDL_RWtell(src); + SDL_ClearError(); + + bfReserved = SDL_ReadLE16(src); + bfType = SDL_ReadLE16(src); + bfCount = SDL_ReadLE16(src); + if ((bfReserved != 0) || (bfType != type) || (bfCount == 0)) { + IMG_SetError("File is not a Windows %s file", type == 1 ? "ICO" : "CUR"); + was_error = SDL_TRUE; + goto done; + } + + /* Read the Win32 Icon Directory */ + for (i = 0; i < bfCount; i++) { + /* Icon Directory Entries */ + int bWidth = SDL_Read8(src); /* Uint8, but 0 = 256 ! */ + int bHeight = SDL_Read8(src); /* Uint8, but 0 = 256 ! */ + int bColorCount = SDL_Read8(src); /* Uint8, but 0 = 256 ! */ + Uint8 bReserved = SDL_Read8(src); + Uint16 wPlanes = SDL_ReadLE16(src); + Uint16 wBitCount = SDL_ReadLE16(src); + Uint32 dwBytesInRes = SDL_ReadLE32(src); + Uint32 dwImageOffset = SDL_ReadLE32(src); + + if (!bWidth) + bWidth = 256; + if (!bHeight) + bHeight = 256; + if (!bColorCount) + bColorCount = 256; + + //printf("%dx%d@%d - %08x\n", bWidth, bHeight, bColorCount, dwImageOffset); + if (bColorCount > maxCol) { + maxCol = bColorCount; + icoOfs = dwImageOffset; + //printf("marked\n"); + } + } + + /* Advance to the DIB Data */ + if (SDL_RWseek(src, icoOfs, RW_SEEK_SET) < 0) { + SDL_Error(SDL_EFSEEK); + was_error = SDL_TRUE; + goto done; + } + + /* Read the Win32 BITMAPINFOHEADER */ + biSize = SDL_ReadLE32(src); + if (biSize == 40) { + biWidth = SDL_ReadLE32(src); + biHeight = SDL_ReadLE32(src); + biPlanes = SDL_ReadLE16(src); + biBitCount = SDL_ReadLE16(src); + biCompression = SDL_ReadLE32(src); + biSizeImage = SDL_ReadLE32(src); + biXPelsPerMeter = SDL_ReadLE32(src); + biYPelsPerMeter = SDL_ReadLE32(src); + biClrUsed = SDL_ReadLE32(src); + biClrImportant = SDL_ReadLE32(src); + } else { + IMG_SetError("Unsupported ICO bitmap format"); + was_error = SDL_TRUE; + goto done; + } + + /* Check for read error */ + if (SDL_strcmp(SDL_GetError(), "") != 0) { + was_error = SDL_TRUE; + goto done; + } + + /* We don't support any BMP compression right now */ + switch (biCompression) { + case BI_RGB: + /* Default values for the BMP format */ + switch (biBitCount) { + case 1: + case 4: + ExpandBMP = biBitCount; + biBitCount = 8; + break; + case 8: + ExpandBMP = 8; + break; + case 32: + Rmask = 0x00FF0000; + Gmask = 0x0000FF00; + Bmask = 0x000000FF; + ExpandBMP = 0; + break; + default: + IMG_SetError("ICO file with unsupported bit count"); + was_error = SDL_TRUE; + goto done; + } + break; + default: + IMG_SetError("Compressed ICO files not supported"); + was_error = SDL_TRUE; + goto done; + } + + /* Create a RGBA surface */ + biHeight = biHeight >> 1; + //printf("%d x %d\n", biWidth, biHeight); + surface = + SDL_CreateRGBSurface(0, biWidth, biHeight, 32, 0x00FF0000, + 0x0000FF00, 0x000000FF, 0xFF000000); + if (surface == NULL) { + was_error = SDL_TRUE; + goto done; + } + + /* Load the palette, if any */ + //printf("bc %d bused %d\n", biBitCount, biClrUsed); + if (biBitCount <= 8) { + if (biClrUsed == 0) { + biClrUsed = 1 << biBitCount; + } + for (i = 0; i < (int) biClrUsed; ++i) { + SDL_RWread(src, &palette[i], 4, 1); + } + } + + /* Read the surface pixels. Note that the bmp image is upside down */ + bits = (Uint8 *) surface->pixels + (surface->h * surface->pitch); + switch (ExpandBMP) { + case 1: + bmpPitch = (biWidth + 7) >> 3; + pad = (((bmpPitch) % 4) ? (4 - ((bmpPitch) % 4)) : 0); + break; + case 4: + bmpPitch = (biWidth + 1) >> 1; + pad = (((bmpPitch) % 4) ? (4 - ((bmpPitch) % 4)) : 0); + break; + case 8: + bmpPitch = biWidth; + pad = (((bmpPitch) % 4) ? (4 - ((bmpPitch) % 4)) : 0); + break; + default: + bmpPitch = biWidth * 4; + pad = 0; + break; + } + while (bits > (Uint8 *) surface->pixels) { + bits -= surface->pitch; + switch (ExpandBMP) { + case 1: + case 4: + case 8: + { + Uint8 pixel = 0; + int shift = (8 - ExpandBMP); + for (i = 0; i < surface->w; ++i) { + if (i % (8 / ExpandBMP) == 0) { + if (!SDL_RWread(src, &pixel, 1, 1)) { + IMG_SetError("Error reading from ICO"); + was_error = SDL_TRUE; + goto done; + } + } + *((Uint32 *) bits + i) = (palette[pixel >> shift]); + pixel <<= ExpandBMP; + } + } + break; + + default: + if (SDL_RWread(src, bits, 1, surface->pitch) + != surface->pitch) { + SDL_Error(SDL_EFREAD); + was_error = SDL_TRUE; + goto done; + } + break; + } + /* Skip padding bytes, ugh */ + if (pad) { + Uint8 padbyte; + for (i = 0; i < pad; ++i) { + SDL_RWread(src, &padbyte, 1, 1); + } + } + } + /* Read the mask pixels. Note that the bmp image is upside down */ + bits = (Uint8 *) surface->pixels + (surface->h * surface->pitch); + ExpandBMP = 1; + bmpPitch = (biWidth + 7) >> 3; + pad = (((bmpPitch) % 4) ? (4 - ((bmpPitch) % 4)) : 0); + while (bits > (Uint8 *) surface->pixels) { + Uint8 pixel = 0; + int shift = (8 - ExpandBMP); + + bits -= surface->pitch; + for (i = 0; i < surface->w; ++i) { + if (i % (8 / ExpandBMP) == 0) { + if (!SDL_RWread(src, &pixel, 1, 1)) { + IMG_SetError("Error reading from ICO"); + was_error = SDL_TRUE; + goto done; + } + } + *((Uint32 *) bits + i) |= ((pixel >> shift) ? 0 : 0xFF000000); + pixel <<= ExpandBMP; + } + /* Skip padding bytes, ugh */ + if (pad) { + Uint8 padbyte; + for (i = 0; i < pad; ++i) { + SDL_RWread(src, &padbyte, 1, 1); + } + } + } + done: + if (was_error) { + if (src) { + SDL_RWseek(src, fp_offset, RW_SEEK_SET); + } + if (surface) { + SDL_FreeSurface(surface); + } + surface = NULL; + } + if (freesrc && src) { + SDL_RWclose(src); + } + return (surface); +} + +/* Load a BMP type image from an SDL datasource */ +SDL_Surface *IMG_LoadBMP_RW(SDL_RWops *src) +{ + return(LoadBMP_RW(src, 0)); +} + +/* Load a ICO type image from an SDL datasource */ +SDL_Surface *IMG_LoadICO_RW(SDL_RWops *src) +{ + return(LoadICOCUR_RW(src, 1, 0)); +} + +/* Load a CUR type image from an SDL datasource */ +SDL_Surface *IMG_LoadCUR_RW(SDL_RWops *src) +{ + return(LoadICOCUR_RW(src, 2, 0)); +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isBMP(SDL_RWops *src) +{ + return(0); +} + +int IMG_isICO(SDL_RWops *src) +{ + return(0); +} + +int IMG_isCUR(SDL_RWops *src) +{ + return(0); +} + +/* Load a BMP type image from an SDL datasource */ +SDL_Surface *IMG_LoadBMP_RW(SDL_RWops *src) +{ + return(NULL); +} + +/* Load a BMP type image from an SDL datasource */ +SDL_Surface *IMG_LoadCUR_RW(SDL_RWops *src) +{ + return(NULL); +} + +/* Load a BMP type image from an SDL datasource */ +SDL_Surface *IMG_LoadICO_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_BMP */ + +#endif /* !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) */ diff --git a/apps/plugins/sdl/SDL_image/IMG_gif.c b/apps/plugins/sdl/SDL_image/IMG_gif.c new file mode 100644 index 0000000..de93fa7 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_gif.c @@ -0,0 +1,625 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) + +/* This is a GIF image file loading framework */ + +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_GIF + +/* See if an image is contained in a data source */ +int IMG_isGIF(SDL_RWops *src) +{ + int start; + int is_GIF; + char magic[6]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_GIF = 0; + if ( SDL_RWread(src, magic, sizeof(magic), 1) ) { + if ( (strncmp(magic, "GIF", 3) == 0) && + ((memcmp(magic + 3, "87a", 3) == 0) || + (memcmp(magic + 3, "89a", 3) == 0)) ) { + is_GIF = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_GIF); +} + +/* Code from here to end of file has been adapted from XPaint: */ +/* +-------------------------------------------------------------------+ */ +/* | Copyright 1990, 1991, 1993 David Koblas. | */ +/* | Copyright 1996 Torsten Martinsen. | */ +/* | Permission to use, copy, modify, and distribute this software | */ +/* | and its documentation for any purpose and without fee is hereby | */ +/* | granted, provided that the above copyright notice appear in all | */ +/* | copies and that both that copyright notice and this permission | */ +/* | notice appear in supporting documentation. This software is | */ +/* | provided "as is" without express or implied warranty. | */ +/* +-------------------------------------------------------------------+ */ + +/* Adapted for use in SDL by Sam Lantinga -- 7/20/98 */ +#define USED_BY_SDL + +#include +#include + +#ifdef USED_BY_SDL +/* Changes to work with SDL: + + Include SDL header file + Use SDL_Surface rather than xpaint Image structure + Define SDL versions of RWSetMsg(), ImageNewCmap() and ImageSetCmap() +*/ +#include "SDL.h" + +#define Image SDL_Surface +#define RWSetMsg IMG_SetError +#define ImageNewCmap(w, h, s) SDL_AllocSurface(SDL_SWSURFACE,w,h,8,0,0,0,0) +#define ImageSetCmap(s, i, R, G, B) do { \ + s->format->palette->colors[i].r = R; \ + s->format->palette->colors[i].g = G; \ + s->format->palette->colors[i].b = B; \ + } while (0) +/* * * * * */ + +#else + +/* Original XPaint sources */ + +#include "image.h" +#include "rwTable.h" + +#define SDL_RWops FILE +#define SDL_RWclose fclose + +#endif /* USED_BY_SDL */ + + +#define MAXCOLORMAPSIZE 256 + +#define TRUE 1 +#define FALSE 0 + +#define CM_RED 0 +#define CM_GREEN 1 +#define CM_BLUE 2 + +#define MAX_LWZ_BITS 12 + +#define INTERLACE 0x40 +#define LOCALCOLORMAP 0x80 +#define BitSet(byte, bit) (((byte) & (bit)) == (bit)) + +#define ReadOK(file,buffer,len) SDL_RWread(file, buffer, len, 1) + +#define LM_to_uint(a,b) (((b)<<8)|(a)) + +static struct { + unsigned int Width; + unsigned int Height; + unsigned char ColorMap[3][MAXCOLORMAPSIZE]; + unsigned int BitPixel; + unsigned int ColorResolution; + unsigned int Background; + unsigned int AspectRatio; + int GrayScale; +} GifScreen; + +static struct { + int transparent; + int delayTime; + int inputFlag; + int disposal; +} Gif89; + +static int ReadColorMap(SDL_RWops * src, int number, + unsigned char buffer[3][MAXCOLORMAPSIZE], int *flag); +static int DoExtension(SDL_RWops * src, int label); +static int GetDataBlock(SDL_RWops * src, unsigned char *buf); +static int GetCode(SDL_RWops * src, int code_size, int flag); +static int LWZReadByte(SDL_RWops * src, int flag, int input_code_size); +static Image *ReadImage(SDL_RWops * src, int len, int height, int, + unsigned char cmap[3][MAXCOLORMAPSIZE], + int gray, int interlace, int ignore); + +Image * +IMG_LoadGIF_RW(SDL_RWops *src) +{ + int start; + unsigned char buf[16]; + unsigned char c; + unsigned char localColorMap[3][MAXCOLORMAPSIZE]; + int grayScale; + int useGlobalColormap; + int bitPixel; + int imageCount = 0; + char version[4]; + int imageNumber = 1; + Image *image = NULL; + + if ( src == NULL ) { + return NULL; + } + start = SDL_RWtell(src); + + if (!ReadOK(src, buf, 6)) { + RWSetMsg("error reading magic number"); + goto done; + } + if (strncmp((char *) buf, "GIF", 3) != 0) { + RWSetMsg("not a GIF file"); + goto done; + } + memcpy(version, (char *) buf + 3, 3); + version[3] = '\0'; + + if ((strcmp(version, "87a") != 0) && (strcmp(version, "89a") != 0)) { + RWSetMsg("bad version number, not '87a' or '89a'"); + goto done; + } + Gif89.transparent = -1; + Gif89.delayTime = -1; + Gif89.inputFlag = -1; + Gif89.disposal = 0; + + if (!ReadOK(src, buf, 7)) { + RWSetMsg("failed to read screen descriptor"); + goto done; + } + GifScreen.Width = LM_to_uint(buf[0], buf[1]); + GifScreen.Height = LM_to_uint(buf[2], buf[3]); + GifScreen.BitPixel = 2 << (buf[4] & 0x07); + GifScreen.ColorResolution = (((buf[4] & 0x70) >> 3) + 1); + GifScreen.Background = buf[5]; + GifScreen.AspectRatio = buf[6]; + + if (BitSet(buf[4], LOCALCOLORMAP)) { /* Global Colormap */ + if (ReadColorMap(src, GifScreen.BitPixel, GifScreen.ColorMap, + &GifScreen.GrayScale)) { + RWSetMsg("error reading global colormap"); + goto done; + } + } + do { + if (!ReadOK(src, &c, 1)) { + RWSetMsg("EOF / read error on image data"); + goto done; + } + if (c == ';') { /* GIF terminator */ + if (imageCount < imageNumber) { + RWSetMsg("only %d image%s found in file", + imageCount, imageCount > 1 ? "s" : ""); + goto done; + } + } + if (c == '!') { /* Extension */ + if (!ReadOK(src, &c, 1)) { + RWSetMsg("EOF / read error on extention function code"); + goto done; + } + DoExtension(src, c); + continue; + } + if (c != ',') { /* Not a valid start character */ + continue; + } + ++imageCount; + + if (!ReadOK(src, buf, 9)) { + RWSetMsg("couldn't read left/top/width/height"); + goto done; + } + useGlobalColormap = !BitSet(buf[8], LOCALCOLORMAP); + + bitPixel = 1 << ((buf[8] & 0x07) + 1); + + if (!useGlobalColormap) { + if (ReadColorMap(src, bitPixel, localColorMap, &grayScale)) { + RWSetMsg("error reading local colormap"); + goto done; + } + image = ReadImage(src, LM_to_uint(buf[4], buf[5]), + LM_to_uint(buf[6], buf[7]), + bitPixel, localColorMap, grayScale, + BitSet(buf[8], INTERLACE), + imageCount != imageNumber); + } else { + image = ReadImage(src, LM_to_uint(buf[4], buf[5]), + LM_to_uint(buf[6], buf[7]), + GifScreen.BitPixel, GifScreen.ColorMap, + GifScreen.GrayScale, BitSet(buf[8], INTERLACE), + imageCount != imageNumber); + } + } while (image == NULL); + +#ifdef USED_BY_SDL + if ( Gif89.transparent >= 0 ) { + SDL_SetColorKey(image, SDL_SRCCOLORKEY, Gif89.transparent); + } +#endif + +done: + if ( image == NULL ) { + SDL_RWseek(src, start, RW_SEEK_SET); + } + return image; +} + +static int +ReadColorMap(SDL_RWops *src, int number, + unsigned char buffer[3][MAXCOLORMAPSIZE], int *gray) +{ + int i; + unsigned char rgb[3]; + int flag; + + flag = TRUE; + + for (i = 0; i < number; ++i) { + if (!ReadOK(src, rgb, sizeof(rgb))) { + RWSetMsg("bad colormap"); + return 1; + } + buffer[CM_RED][i] = rgb[0]; + buffer[CM_GREEN][i] = rgb[1]; + buffer[CM_BLUE][i] = rgb[2]; + flag &= (rgb[0] == rgb[1] && rgb[1] == rgb[2]); + } + +#if 0 + if (flag) + *gray = (number == 2) ? PBM_TYPE : PGM_TYPE; + else + *gray = PPM_TYPE; +#else + *gray = 0; +#endif + + return FALSE; +} + +static int +DoExtension(SDL_RWops *src, int label) +{ + static unsigned char buf[256]; + char *str; + + switch (label) { + case 0x01: /* Plain Text Extension */ + str = "Plain Text Extension"; + break; + case 0xff: /* Application Extension */ + str = "Application Extension"; + break; + case 0xfe: /* Comment Extension */ + str = "Comment Extension"; + while (GetDataBlock(src, (unsigned char *) buf) != 0) + ; + return FALSE; + case 0xf9: /* Graphic Control Extension */ + str = "Graphic Control Extension"; + (void) GetDataBlock(src, (unsigned char *) buf); + Gif89.disposal = (buf[0] >> 2) & 0x7; + Gif89.inputFlag = (buf[0] >> 1) & 0x1; + Gif89.delayTime = LM_to_uint(buf[1], buf[2]); + if ((buf[0] & 0x1) != 0) + Gif89.transparent = buf[3]; + + while (GetDataBlock(src, (unsigned char *) buf) != 0) + ; + return FALSE; + default: + str = (char *)buf; + sprintf(str, "UNKNOWN (0x%02x)", label); + break; + } + + while (GetDataBlock(src, (unsigned char *) buf) != 0) + ; + + return FALSE; +} + +static int ZeroDataBlock = FALSE; + +static int +GetDataBlock(SDL_RWops *src, unsigned char *buf) +{ + unsigned char count; + + if (!ReadOK(src, &count, 1)) { + /* pm_message("error in getting DataBlock size" ); */ + return -1; + } + ZeroDataBlock = count == 0; + + if ((count != 0) && (!ReadOK(src, buf, count))) { + /* pm_message("error in reading DataBlock" ); */ + return -1; + } + return count; +} + +static int +GetCode(SDL_RWops *src, int code_size, int flag) +{ + static unsigned char buf[280]; + static int curbit, lastbit, done, last_byte; + int i, j, ret; + unsigned char count; + + if (flag) { + curbit = 0; + lastbit = 0; + done = FALSE; + return 0; + } + if ((curbit + code_size) >= lastbit) { + if (done) { + if (curbit >= lastbit) + RWSetMsg("ran off the end of my bits"); + return -1; + } + buf[0] = buf[last_byte - 2]; + buf[1] = buf[last_byte - 1]; + + if ((count = GetDataBlock(src, &buf[2])) == 0) + done = TRUE; + + last_byte = 2 + count; + curbit = (curbit - lastbit) + 16; + lastbit = (2 + count) * 8; + } + ret = 0; + for (i = curbit, j = 0; j < code_size; ++i, ++j) + ret |= ((buf[i / 8] & (1 << (i % 8))) != 0) << j; + + curbit += code_size; + + return ret; +} + +static int +LWZReadByte(SDL_RWops *src, int flag, int input_code_size) +{ + static int fresh = FALSE; + int code, incode; + static int code_size, set_code_size; + static int max_code, max_code_size; + static int firstcode, oldcode; + static int clear_code, end_code; + static int table[2][(1 << MAX_LWZ_BITS)]; + static int stack[(1 << (MAX_LWZ_BITS)) * 2], *sp; + register int i; + + /* Fixed buffer overflow found by Michael Skladnikiewicz */ + if (input_code_size > MAX_LWZ_BITS) + return -1; + + if (flag) { + set_code_size = input_code_size; + code_size = set_code_size + 1; + clear_code = 1 << set_code_size; + end_code = clear_code + 1; + max_code_size = 2 * clear_code; + max_code = clear_code + 2; + + GetCode(src, 0, TRUE); + + fresh = TRUE; + + for (i = 0; i < clear_code; ++i) { + table[0][i] = 0; + table[1][i] = i; + } + for (; i < (1 << MAX_LWZ_BITS); ++i) + table[0][i] = table[1][0] = 0; + + sp = stack; + + return 0; + } else if (fresh) { + fresh = FALSE; + do { + firstcode = oldcode = GetCode(src, code_size, FALSE); + } while (firstcode == clear_code); + return firstcode; + } + if (sp > stack) + return *--sp; + + while ((code = GetCode(src, code_size, FALSE)) >= 0) { + if (code == clear_code) { + for (i = 0; i < clear_code; ++i) { + table[0][i] = 0; + table[1][i] = i; + } + for (; i < (1 << MAX_LWZ_BITS); ++i) + table[0][i] = table[1][i] = 0; + code_size = set_code_size + 1; + max_code_size = 2 * clear_code; + max_code = clear_code + 2; + sp = stack; + firstcode = oldcode = GetCode(src, code_size, FALSE); + return firstcode; + } else if (code == end_code) { + int count; + unsigned char buf[260]; + + if (ZeroDataBlock) + return -2; + + while ((count = GetDataBlock(src, buf)) > 0) + ; + + if (count != 0) { + /* + * pm_message("missing EOD in data stream (common occurence)"); + */ + } + return -2; + } + incode = code; + + if (code >= max_code) { + *sp++ = firstcode; + code = oldcode; + } + while (code >= clear_code) { + *sp++ = table[1][code]; + if (code == table[0][code]) + RWSetMsg("circular table entry BIG ERROR"); + code = table[0][code]; + } + + *sp++ = firstcode = table[1][code]; + + if ((code = max_code) < (1 << MAX_LWZ_BITS)) { + table[0][code] = oldcode; + table[1][code] = firstcode; + ++max_code; + if ((max_code >= max_code_size) && + (max_code_size < (1 << MAX_LWZ_BITS))) { + max_code_size *= 2; + ++code_size; + } + } + oldcode = incode; + + if (sp > stack) + return *--sp; + } + return code; +} + +static Image * +ReadImage(SDL_RWops * src, int len, int height, int cmapSize, + unsigned char cmap[3][MAXCOLORMAPSIZE], + int gray, int interlace, int ignore) +{ + Image *image; + unsigned char c; + int i, v; + int xpos = 0, ypos = 0, pass = 0; + + /* + ** Initialize the compression routines + */ + if (!ReadOK(src, &c, 1)) { + RWSetMsg("EOF / read error on image data"); + return NULL; + } + if (LWZReadByte(src, TRUE, c) < 0) { + RWSetMsg("error reading image"); + return NULL; + } + /* + ** If this is an "uninteresting picture" ignore it. + */ + if (ignore) { + while (LWZReadByte(src, FALSE, c) >= 0) + ; + return NULL; + } + image = ImageNewCmap(len, height, cmapSize); + + for (i = 0; i < cmapSize; i++) + ImageSetCmap(image, i, cmap[CM_RED][i], + cmap[CM_GREEN][i], cmap[CM_BLUE][i]); + + while ((v = LWZReadByte(src, FALSE, c)) >= 0) { +#ifdef USED_BY_SDL + ((Uint8 *)image->pixels)[xpos + ypos * image->pitch] = v; +#else + image->data[xpos + ypos * len] = v; +#endif + ++xpos; + if (xpos == len) { + xpos = 0; + if (interlace) { + switch (pass) { + case 0: + case 1: + ypos += 8; + break; + case 2: + ypos += 4; + break; + case 3: + ypos += 2; + break; + } + + if (ypos >= height) { + ++pass; + switch (pass) { + case 1: + ypos = 4; + break; + case 2: + ypos = 2; + break; + case 3: + ypos = 1; + break; + default: + goto fini; + } + } + } else { + ++ypos; + } + } + if (ypos >= height) + break; + } + + fini: + + return image; +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isGIF(SDL_RWops *src) +{ + return(0); +} + +/* Load a GIF type image from an SDL datasource */ +SDL_Surface *IMG_LoadGIF_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_GIF */ + +#endif /* !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) */ diff --git a/apps/plugins/sdl/SDL_image/IMG_jpg.c b/apps/plugins/sdl/SDL_image/IMG_jpg.c new file mode 100644 index 0000000..7484ab1 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_jpg.c @@ -0,0 +1,495 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) + +/* This is a JPEG image file loading framework */ + +#include +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_JPG + +#include + +#ifdef JPEG_TRUE /* MinGW version of jpeg-8.x renamed TRUE to JPEG_TRUE etc. */ + typedef JPEG_boolean boolean; + #define TRUE JPEG_TRUE + #define FALSE JPEG_FALSE +#endif + +/* Define this for fast loading and not as good image quality */ +/*#define FAST_JPEG*/ + +/* Define this for quicker (but less perfect) JPEG identification */ +#define FAST_IS_JPEG + +static struct { + int loaded; + void *handle; + void (*jpeg_calc_output_dimensions) (j_decompress_ptr cinfo); + void (*jpeg_CreateDecompress) (j_decompress_ptr cinfo, int version, size_t structsize); + void (*jpeg_destroy_decompress) (j_decompress_ptr cinfo); + boolean (*jpeg_finish_decompress) (j_decompress_ptr cinfo); + int (*jpeg_read_header) (j_decompress_ptr cinfo, boolean require_image); + JDIMENSION (*jpeg_read_scanlines) (j_decompress_ptr cinfo, JSAMPARRAY scanlines, JDIMENSION max_lines); + boolean (*jpeg_resync_to_restart) (j_decompress_ptr cinfo, int desired); + boolean (*jpeg_start_decompress) (j_decompress_ptr cinfo); + struct jpeg_error_mgr * (*jpeg_std_error) (struct jpeg_error_mgr * err); +} lib; + +#ifdef LOAD_JPG_DYNAMIC +int IMG_InitJPG() +{ + if ( lib.loaded == 0 ) { + lib.handle = SDL_LoadObject(LOAD_JPG_DYNAMIC); + if ( lib.handle == NULL ) { + return -1; + } + lib.jpeg_calc_output_dimensions = + (void (*) (j_decompress_ptr)) + SDL_LoadFunction(lib.handle, "jpeg_calc_output_dimensions"); + if ( lib.jpeg_calc_output_dimensions == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_CreateDecompress = + (void (*) (j_decompress_ptr, int, size_t)) + SDL_LoadFunction(lib.handle, "jpeg_CreateDecompress"); + if ( lib.jpeg_CreateDecompress == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_destroy_decompress = + (void (*) (j_decompress_ptr)) + SDL_LoadFunction(lib.handle, "jpeg_destroy_decompress"); + if ( lib.jpeg_destroy_decompress == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_finish_decompress = + (boolean (*) (j_decompress_ptr)) + SDL_LoadFunction(lib.handle, "jpeg_finish_decompress"); + if ( lib.jpeg_finish_decompress == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_read_header = + (int (*) (j_decompress_ptr, boolean)) + SDL_LoadFunction(lib.handle, "jpeg_read_header"); + if ( lib.jpeg_read_header == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_read_scanlines = + (JDIMENSION (*) (j_decompress_ptr, JSAMPARRAY, JDIMENSION)) + SDL_LoadFunction(lib.handle, "jpeg_read_scanlines"); + if ( lib.jpeg_read_scanlines == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_resync_to_restart = + (boolean (*) (j_decompress_ptr, int)) + SDL_LoadFunction(lib.handle, "jpeg_resync_to_restart"); + if ( lib.jpeg_resync_to_restart == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_start_decompress = + (boolean (*) (j_decompress_ptr)) + SDL_LoadFunction(lib.handle, "jpeg_start_decompress"); + if ( lib.jpeg_start_decompress == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.jpeg_std_error = + (struct jpeg_error_mgr * (*) (struct jpeg_error_mgr *)) + SDL_LoadFunction(lib.handle, "jpeg_std_error"); + if ( lib.jpeg_std_error == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + } + ++lib.loaded; + + return 0; +} +void IMG_QuitJPG() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + SDL_UnloadObject(lib.handle); + } + --lib.loaded; +} +#else +int IMG_InitJPG() +{ + if ( lib.loaded == 0 ) { + lib.jpeg_calc_output_dimensions = jpeg_calc_output_dimensions; + lib.jpeg_CreateDecompress = jpeg_CreateDecompress; + lib.jpeg_destroy_decompress = jpeg_destroy_decompress; + lib.jpeg_finish_decompress = jpeg_finish_decompress; + lib.jpeg_read_header = jpeg_read_header; + lib.jpeg_read_scanlines = jpeg_read_scanlines; + lib.jpeg_resync_to_restart = jpeg_resync_to_restart; + lib.jpeg_start_decompress = jpeg_start_decompress; + lib.jpeg_std_error = jpeg_std_error; + } + ++lib.loaded; + + return 0; +} +void IMG_QuitJPG() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + } + --lib.loaded; +} +#endif /* LOAD_JPG_DYNAMIC */ + +/* See if an image is contained in a data source */ +int IMG_isJPG(SDL_RWops *src) +{ + int start; + int is_JPG; + int in_scan; + Uint8 magic[4]; + + /* This detection code is by Steaphan Greene */ + /* Blame me, not Sam, if this doesn't work right. */ + /* And don't forget to report the problem to the the sdl list too! */ + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_JPG = 0; + in_scan = 0; + if ( SDL_RWread(src, magic, 2, 1) ) { + if ( (magic[0] == 0xFF) && (magic[1] == 0xD8) ) { + is_JPG = 1; + while (is_JPG == 1) { + if(SDL_RWread(src, magic, 1, 2) != 2) { + is_JPG = 0; + } else if( (magic[0] != 0xFF) && (in_scan == 0) ) { + is_JPG = 0; + } else if( (magic[0] != 0xFF) || (magic[1] == 0xFF) ) { + /* Extra padding in JPEG (legal) */ + /* or this is data and we are scanning */ + SDL_RWseek(src, -1, RW_SEEK_CUR); + } else if(magic[1] == 0xD9) { + /* Got to end of good JPEG */ + break; + } else if( (in_scan == 1) && (magic[1] == 0x00) ) { + /* This is an encoded 0xFF within the data */ + } else if( (magic[1] >= 0xD0) && (magic[1] < 0xD9) ) { + /* These have nothing else */ + } else if(SDL_RWread(src, magic+2, 1, 2) != 2) { + is_JPG = 0; + } else { + /* Yes, it's big-endian */ + Uint32 start; + Uint32 size; + Uint32 end; + start = SDL_RWtell(src); + size = (magic[2] << 8) + magic[3]; + end = SDL_RWseek(src, size-2, RW_SEEK_CUR); + if ( end != start + size - 2 ) is_JPG = 0; + if ( magic[1] == 0xDA ) { + /* Now comes the actual JPEG meat */ +#ifdef FAST_IS_JPEG + /* Ok, I'm convinced. It is a JPEG. */ + break; +#else + /* I'm not convinced. Prove it! */ + in_scan = 1; +#endif + } + } + } + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_JPG); +} + +#define INPUT_BUFFER_SIZE 4096 +typedef struct { + struct jpeg_source_mgr pub; + + SDL_RWops *ctx; + Uint8 buffer[INPUT_BUFFER_SIZE]; +} my_source_mgr; + +/* + * Initialize source --- called by jpeg_read_header + * before any data is actually read. + */ +static void init_source (j_decompress_ptr cinfo) +{ + /* We don't actually need to do anything */ + return; +} + +/* + * Fill the input buffer --- called whenever buffer is emptied. + */ +static boolean fill_input_buffer (j_decompress_ptr cinfo) +{ + my_source_mgr * src = (my_source_mgr *) cinfo->src; + int nbytes; + + nbytes = SDL_RWread(src->ctx, src->buffer, 1, INPUT_BUFFER_SIZE); + if (nbytes <= 0) { + /* Insert a fake EOI marker */ + src->buffer[0] = (Uint8) 0xFF; + src->buffer[1] = (Uint8) JPEG_EOI; + nbytes = 2; + } + src->pub.next_input_byte = src->buffer; + src->pub.bytes_in_buffer = nbytes; + + return TRUE; +} + + +/* + * Skip data --- used to skip over a potentially large amount of + * uninteresting data (such as an APPn marker). + * + * Writers of suspendable-input applications must note that skip_input_data + * is not granted the right to give a suspension return. If the skip extends + * beyond the data currently in the buffer, the buffer can be marked empty so + * that the next read will cause a fill_input_buffer call that can suspend. + * Arranging for additional bytes to be discarded before reloading the input + * buffer is the application writer's problem. + */ +static void skip_input_data (j_decompress_ptr cinfo, long num_bytes) +{ + my_source_mgr * src = (my_source_mgr *) cinfo->src; + + /* Just a dumb implementation for now. Could use fseek() except + * it doesn't work on pipes. Not clear that being smart is worth + * any trouble anyway --- large skips are infrequent. + */ + if (num_bytes > 0) { + while (num_bytes > (long) src->pub.bytes_in_buffer) { + num_bytes -= (long) src->pub.bytes_in_buffer; + (void) src->pub.fill_input_buffer(cinfo); + /* note we assume that fill_input_buffer will never + * return FALSE, so suspension need not be handled. + */ + } + src->pub.next_input_byte += (size_t) num_bytes; + src->pub.bytes_in_buffer -= (size_t) num_bytes; + } +} + +/* + * Terminate source --- called by jpeg_finish_decompress + * after all data has been read. + */ +static void term_source (j_decompress_ptr cinfo) +{ + /* We don't actually need to do anything */ + return; +} + +/* + * Prepare for input from a stdio stream. + * The caller must have already opened the stream, and is responsible + * for closing it after finishing decompression. + */ +static void jpeg_SDL_RW_src (j_decompress_ptr cinfo, SDL_RWops *ctx) +{ + my_source_mgr *src; + + /* The source object and input buffer are made permanent so that a series + * of JPEG images can be read from the same file by calling jpeg_stdio_src + * only before the first one. (If we discarded the buffer at the end of + * one image, we'd likely lose the start of the next one.) + * This makes it unsafe to use this manager and a different source + * manager serially with the same JPEG object. Caveat programmer. + */ + if (cinfo->src == NULL) { /* first time for this JPEG object? */ + cinfo->src = (struct jpeg_source_mgr *) + (*cinfo->mem->alloc_small) ((j_common_ptr) cinfo, JPOOL_PERMANENT, + sizeof(my_source_mgr)); + src = (my_source_mgr *) cinfo->src; + } + + src = (my_source_mgr *) cinfo->src; + src->pub.init_source = init_source; + src->pub.fill_input_buffer = fill_input_buffer; + src->pub.skip_input_data = skip_input_data; + src->pub.resync_to_restart = lib.jpeg_resync_to_restart; /* use default method */ + src->pub.term_source = term_source; + src->ctx = ctx; + src->pub.bytes_in_buffer = 0; /* forces fill_input_buffer on first read */ + src->pub.next_input_byte = NULL; /* until buffer loaded */ +} + +struct my_error_mgr { + struct jpeg_error_mgr errmgr; + jmp_buf escape; +}; + +static void my_error_exit(j_common_ptr cinfo) +{ + struct my_error_mgr *err = (struct my_error_mgr *)cinfo->err; + longjmp(err->escape, 1); +} + +static void output_no_message(j_common_ptr cinfo) +{ + /* do nothing */ +} + +/* Load a JPEG type image from an SDL datasource */ +SDL_Surface *IMG_LoadJPG_RW(SDL_RWops *src) +{ + int start; + struct jpeg_decompress_struct cinfo; + JSAMPROW rowptr[1]; + SDL_Surface *volatile surface = NULL; + struct my_error_mgr jerr; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + if ( !IMG_Init(IMG_INIT_JPG) ) { + return NULL; + } + + /* Create a decompression structure and load the JPEG header */ + cinfo.err = lib.jpeg_std_error(&jerr.errmgr); + jerr.errmgr.error_exit = my_error_exit; + jerr.errmgr.output_message = output_no_message; + if(setjmp(jerr.escape)) { + /* If we get here, libjpeg found an error */ + lib.jpeg_destroy_decompress(&cinfo); + if ( surface != NULL ) { + SDL_FreeSurface(surface); + } + SDL_RWseek(src, start, RW_SEEK_SET); + IMG_SetError("JPEG loading error"); + return NULL; + } + + lib.jpeg_create_decompress(&cinfo); + jpeg_SDL_RW_src(&cinfo, src); + lib.jpeg_read_header(&cinfo, TRUE); + + if(cinfo.num_components == 4) { + /* Set 32-bit Raw output */ + cinfo.out_color_space = JCS_CMYK; + cinfo.quantize_colors = FALSE; + lib.jpeg_calc_output_dimensions(&cinfo); + + /* Allocate an output surface to hold the image */ + surface = SDL_AllocSurface(SDL_SWSURFACE, + cinfo.output_width, cinfo.output_height, 32, +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + 0x00FF0000, 0x0000FF00, 0x000000FF, 0xFF000000); +#else + 0x0000FF00, 0x00FF0000, 0xFF000000, 0x000000FF); +#endif + } else { + /* Set 24-bit RGB output */ + cinfo.out_color_space = JCS_RGB; + cinfo.quantize_colors = FALSE; +#ifdef FAST_JPEG + cinfo.scale_num = 1; + cinfo.scale_denom = 1; + cinfo.dct_method = JDCT_FASTEST; + cinfo.do_fancy_upsampling = FALSE; +#endif + lib.jpeg_calc_output_dimensions(&cinfo); + + /* Allocate an output surface to hold the image */ + surface = SDL_AllocSurface(SDL_SWSURFACE, + cinfo.output_width, cinfo.output_height, 24, +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + 0x0000FF, 0x00FF00, 0xFF0000, +#else + 0xFF0000, 0x00FF00, 0x0000FF, +#endif + 0); + } + + if ( surface == NULL ) { + lib.jpeg_destroy_decompress(&cinfo); + SDL_RWseek(src, start, RW_SEEK_SET); + IMG_SetError("Out of memory"); + return NULL; + } + + /* Decompress the image */ + lib.jpeg_start_decompress(&cinfo); + while ( cinfo.output_scanline < cinfo.output_height ) { + rowptr[0] = (JSAMPROW)(Uint8 *)surface->pixels + + cinfo.output_scanline * surface->pitch; + lib.jpeg_read_scanlines(&cinfo, rowptr, (JDIMENSION) 1); + } + lib.jpeg_finish_decompress(&cinfo); + lib.jpeg_destroy_decompress(&cinfo); + + return(surface); +} + +#else + +int IMG_InitJPG() +{ + IMG_SetError("JPEG images are not supported"); + return(-1); +} + +void IMG_QuitJPG() +{ +} + +/* See if an image is contained in a data source */ +int IMG_isJPG(SDL_RWops *src) +{ + return(0); +} + +/* Load a JPEG type image from an SDL datasource */ +SDL_Surface *IMG_LoadJPG_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_JPG */ + +#endif /* !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) */ diff --git a/apps/plugins/sdl/SDL_image/IMG_lbm.c b/apps/plugins/sdl/SDL_image/IMG_lbm.c new file mode 100644 index 0000000..f475c60 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_lbm.c @@ -0,0 +1,503 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This is a ILBM image file loading framework + Load IFF pictures, PBM & ILBM packing methods, with or without stencil + Written by Daniel Morais ( Daniel AT Morais DOT com ) in September 2001. + 24 bits ILBM files support added by Marc Le Douarain (http://www.multimania.com/mavati) + in December 2002. + EHB and HAM (specific Amiga graphic chip modes) support added by Marc Le Douarain + (http://www.multimania.com/mavati) in December 2003. + Stencil and colorkey fixes by David Raulo (david.raulo AT free DOT fr) in February 2004. + Buffer overflow fix in RLE decompression by David Raulo in January 2008. +*/ + +#include +#include +#include + +#include "SDL_endian.h" +#include "SDL_image.h" + +#ifdef LOAD_LBM + + +#define MAXCOLORS 256 + +/* Structure for an IFF picture ( BMHD = Bitmap Header ) */ + +typedef struct +{ + Uint16 w, h; /* width & height of the bitmap in pixels */ + Sint16 x, y; /* screen coordinates of the bitmap */ + Uint8 planes; /* number of planes of the bitmap */ + Uint8 mask; /* mask type ( 0 => no mask ) */ + Uint8 tcomp; /* compression type */ + Uint8 pad1; /* dummy value, for padding */ + Uint16 tcolor; /* transparent color */ + Uint8 xAspect, /* pixel aspect ratio */ + yAspect; + Sint16 Lpage; /* width of the screen in pixels */ + Sint16 Hpage; /* height of the screen in pixels */ +} BMHD; + +int IMG_isLBM( SDL_RWops *src ) +{ + int start; + int is_LBM; + Uint8 magic[4+4+4]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_LBM = 0; + if ( SDL_RWread( src, magic, sizeof(magic), 1 ) ) + { + if ( !memcmp( magic, "FORM", 4 ) && + ( !memcmp( magic + 8, "PBM ", 4 ) || + !memcmp( magic + 8, "ILBM", 4 ) ) ) + { + is_LBM = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return( is_LBM ); +} + +SDL_Surface *IMG_LoadLBM_RW( SDL_RWops *src ) +{ + int start; + SDL_Surface *Image; + Uint8 id[4], pbm, colormap[MAXCOLORS*3], *MiniBuf, *ptr, count, color, msk; + Uint32 size, bytesloaded, nbcolors; + Uint32 i, j, bytesperline, nbplanes, stencil, plane, h; + Uint32 remainingbytes; + Uint32 width; + BMHD bmhd; + char *error; + Uint8 flagHAM,flagEHB; + + Image = NULL; + error = NULL; + MiniBuf = NULL; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + if ( !SDL_RWread( src, id, 4, 1 ) ) + { + error="error reading IFF chunk"; + goto done; + } + + /* Should be the size of the file minus 4+4 ( 'FORM'+size ) */ + if ( !SDL_RWread( src, &size, 4, 1 ) ) + { + error="error reading IFF chunk size"; + goto done; + } + + /* As size is not used here, no need to swap it */ + + if ( memcmp( id, "FORM", 4 ) != 0 ) + { + error="not a IFF file"; + goto done; + } + + if ( !SDL_RWread( src, id, 4, 1 ) ) + { + error="error reading IFF chunk"; + goto done; + } + + pbm = 0; + + /* File format : PBM=Packed Bitmap, ILBM=Interleaved Bitmap */ + if ( !memcmp( id, "PBM ", 4 ) ) pbm = 1; + else if ( memcmp( id, "ILBM", 4 ) ) + { + error="not a IFF picture"; + goto done; + } + + nbcolors = 0; + + memset( &bmhd, 0, sizeof( BMHD ) ); + flagHAM = 0; + flagEHB = 0; + + while ( memcmp( id, "BODY", 4 ) != 0 ) + { + if ( !SDL_RWread( src, id, 4, 1 ) ) + { + error="error reading IFF chunk"; + goto done; + } + + if ( !SDL_RWread( src, &size, 4, 1 ) ) + { + error="error reading IFF chunk size"; + goto done; + } + + bytesloaded = 0; + + size = SDL_SwapBE32( size ); + + if ( !memcmp( id, "BMHD", 4 ) ) /* Bitmap header */ + { + if ( !SDL_RWread( src, &bmhd, sizeof( BMHD ), 1 ) ) + { + error="error reading BMHD chunk"; + goto done; + } + + bytesloaded = sizeof( BMHD ); + + bmhd.w = SDL_SwapBE16( bmhd.w ); + bmhd.h = SDL_SwapBE16( bmhd.h ); + bmhd.x = SDL_SwapBE16( bmhd.x ); + bmhd.y = SDL_SwapBE16( bmhd.y ); + bmhd.tcolor = SDL_SwapBE16( bmhd.tcolor ); + bmhd.Lpage = SDL_SwapBE16( bmhd.Lpage ); + bmhd.Hpage = SDL_SwapBE16( bmhd.Hpage ); + } + + if ( !memcmp( id, "CMAP", 4 ) ) /* palette ( Color Map ) */ + { + if ( !SDL_RWread( src, &colormap, size, 1 ) ) + { + error="error reading CMAP chunk"; + goto done; + } + + bytesloaded = size; + nbcolors = size / 3; + } + + if ( !memcmp( id, "CAMG", 4 ) ) /* Amiga ViewMode */ + { + Uint32 viewmodes; + if ( !SDL_RWread( src, &viewmodes, sizeof(viewmodes), 1 ) ) + { + error="error reading CAMG chunk"; + goto done; + } + + bytesloaded = size; + viewmodes = SDL_SwapBE32( viewmodes ); + if ( viewmodes & 0x0800 ) + flagHAM = 1; + if ( viewmodes & 0x0080 ) + flagEHB = 1; + } + + if ( memcmp( id, "BODY", 4 ) ) + { + if ( size & 1 ) ++size; /* padding ! */ + size -= bytesloaded; + /* skip the remaining bytes of this chunk */ + if ( size ) SDL_RWseek( src, size, RW_SEEK_CUR ); + } + } + + /* compute some usefull values, based on the bitmap header */ + + width = ( bmhd.w + 15 ) & 0xFFFFFFF0; /* Width in pixels modulo 16 */ + + bytesperline = ( ( bmhd.w + 15 ) / 16 ) * 2; + + nbplanes = bmhd.planes; + + if ( pbm ) /* File format : 'Packed Bitmap' */ + { + bytesperline *= 8; + nbplanes = 1; + } + + stencil = (bmhd.mask & 1); /* There is a mask ( 'stencil' ) */ + + /* Allocate memory for a temporary buffer ( used for + decompression/deinterleaving ) */ + + MiniBuf = (void *)malloc( bytesperline * (nbplanes + stencil) ); + if ( MiniBuf == NULL ) + { + error="no enough memory for temporary buffer"; + goto done; + } + + if ( ( Image = SDL_CreateRGBSurface( SDL_SWSURFACE, width, bmhd.h, (bmhd.planes==24 || flagHAM==1)?24:8, 0, 0, 0, 0 ) ) == NULL ) + goto done; + + if ( bmhd.mask & 2 ) /* There is a transparent color */ + SDL_SetColorKey( Image, SDL_SRCCOLORKEY, bmhd.tcolor ); + + /* Update palette informations */ + + /* There is no palette in 24 bits ILBM file */ + if ( nbcolors>0 && flagHAM==0 ) + { + /* FIXME: Should this include the stencil? See comment below */ + int nbrcolorsfinal = 1 << (nbplanes + stencil); + ptr = &colormap[0]; + + for ( i=0; iformat->palette->colors[i].r = *ptr++; + Image->format->palette->colors[i].g = *ptr++; + Image->format->palette->colors[i].b = *ptr++; + } + + /* Amiga EHB mode (Extra-Half-Bright) */ + /* 6 bitplanes mode with a 32 colors palette */ + /* The 32 last colors are the same but divided by 2 */ + /* Some Amiga pictures save 64 colors with 32 last wrong colors, */ + /* they shouldn't !, and here we overwrite these 32 bad colors. */ + if ( (nbcolors==32 || flagEHB ) && (1<format->palette->colors[i].r = (*ptr++)/2; + Image->format->palette->colors[i].g = (*ptr++)/2; + Image->format->palette->colors[i].b = (*ptr++)/2; + } + } + + /* If nbcolors < 2^nbplanes, repeat the colormap */ + /* This happens when pictures have a stencil mask */ + if ( nbrcolorsfinal > (1<format->palette->colors[i].r = Image->format->palette->colors[i%nbcolors].r; + Image->format->palette->colors[i].g = Image->format->palette->colors[i%nbcolors].g; + Image->format->palette->colors[i].b = Image->format->palette->colors[i%nbcolors].b; + } + if ( !pbm ) + Image->format->palette->ncolors = nbrcolorsfinal; + } + + /* Get the bitmap */ + + for ( h=0; h < bmhd.h; h++ ) + { + /* uncompress the datas of each planes */ + + for ( plane=0; plane < (nbplanes+stencil); plane++ ) + { + ptr = MiniBuf + ( plane * bytesperline ); + + remainingbytes = bytesperline; + + if ( bmhd.tcomp == 1 ) /* Datas are compressed */ + { + do + { + if ( !SDL_RWread( src, &count, 1, 1 ) ) + { + error="error reading BODY chunk"; + goto done; + } + + if ( count & 0x80 ) + { + count ^= 0xFF; + count += 2; /* now it */ + + if ( ( count > remainingbytes ) || !SDL_RWread( src, &color, 1, 1 ) ) + { + error="error reading BODY chunk"; + goto done; + } + memset( ptr, color, count ); + } + else + { + ++count; + + if ( ( count > remainingbytes ) || !SDL_RWread( src, ptr, count, 1 ) ) + { + error="error reading BODY chunk"; + goto done; + } + } + + ptr += count; + remainingbytes -= count; + + } while ( remainingbytes > 0 ); + } + else + { + if ( !SDL_RWread( src, ptr, bytesperline, 1 ) ) + { + error="error reading BODY chunk"; + goto done; + } + } + } + + /* One line has been read, store it ! */ + + ptr = Image->pixels; + if ( nbplanes==24 || flagHAM==1 ) + ptr += h * width * 3; + else + ptr += h * width; + + if ( pbm ) /* File format : 'Packed Bitmap' */ + { + memcpy( ptr, MiniBuf, width ); + } + else /* We have to un-interlace the bits ! */ + { + if ( nbplanes!=24 && flagHAM==0 ) + { + size = ( width + 7 ) / 8; + + for ( i=0; i < size; i++ ) + { + memset( ptr, 0, 8 ); + + for ( plane=0; plane < (nbplanes + stencil); plane++ ) + { + color = *( MiniBuf + i + ( plane * bytesperline ) ); + msk = 0x80; + + for ( j=0; j<8; j++ ) + { + if ( ( plane + j ) <= 7 ) ptr[j] |= (Uint8)( color & msk ) >> ( 7 - plane - j ); + else ptr[j] |= (Uint8)( color & msk ) << ( plane + j - 7 ); + + msk >>= 1; + } + } + ptr += 8; + } + } + else + { + Uint32 finalcolor = 0; + size = ( width + 7 ) / 8; + /* 24 bitplanes ILBM : R0...R7,G0...G7,B0...B7 */ + /* or HAM (6 bitplanes) or HAM8 (8 bitplanes) modes */ + for ( i=0; i>(nbplanes-2) ) + { + case 0: /* take direct color from palette */ + finalcolor = colormap[ pixelcolor*3 ] + (colormap[ pixelcolor*3+1 ]<<8) + (colormap[ pixelcolor*3+2 ]<<16); + break; + case 1: /* modify only blue component */ + finalcolor = finalcolor&0x00FFFF; + finalcolor = finalcolor | (pixelcolor<<(16+(10-nbplanes))); + break; + case 2: /* modify only red component */ + finalcolor = finalcolor&0xFFFF00; + finalcolor = finalcolor | pixelcolor<<(10-nbplanes); + break; + case 3: /* modify only green component */ + finalcolor = finalcolor&0xFF00FF; + finalcolor = finalcolor | (pixelcolor<<(8+(10-nbplanes))); + break; + } + } + else + { + finalcolor = pixelcolor; + } + if ( SDL_BYTEORDER == SDL_LIL_ENDIAN ) + { + *ptr++ = (Uint8)(finalcolor>>16); + *ptr++ = (Uint8)(finalcolor>>8); + *ptr++ = (Uint8)(finalcolor); + } + else + { + *ptr++ = (Uint8)(finalcolor); + *ptr++ = (Uint8)(finalcolor>>8); + *ptr++ = (Uint8)(finalcolor>>16); + } + + maskBit = maskBit>>1; + } + } + } + } + } + +done: + + if ( MiniBuf ) free( MiniBuf ); + + if ( error ) + { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( Image ) { + SDL_FreeSurface( Image ); + Image = NULL; + } + IMG_SetError( error ); + } + + return( Image ); +} + +#else /* LOAD_LBM */ + +/* See if an image is contained in a data source */ +int IMG_isLBM(SDL_RWops *src) +{ + return(0); +} + +/* Load an IFF type image from an SDL datasource */ +SDL_Surface *IMG_LoadLBM_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_LBM */ diff --git a/apps/plugins/sdl/SDL_image/IMG_pcx.c b/apps/plugins/sdl/SDL_image/IMG_pcx.c new file mode 100644 index 0000000..f62eac1 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_pcx.c @@ -0,0 +1,276 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* + * PCX file reader: + * Supports: + * 1..4 bits/pixel in multiplanar format (1 bit/plane/pixel) + * 8 bits/pixel in single-planar format (8 bits/plane/pixel) + * 24 bits/pixel in 3-plane format (8 bits/plane/pixel) + * + * (The <8bpp formats are expanded to 8bpp surfaces) + * + * Doesn't support: + * single-planar packed-pixel formats other than 8bpp + * 4-plane 32bpp format with a fourth "intensity" plane + */ +#include +#include + +#include "SDL_endian.h" + +#include "SDL_image.h" + +#ifdef LOAD_PCX + +struct PCXheader { + Uint8 Manufacturer; + Uint8 Version; + Uint8 Encoding; + Uint8 BitsPerPixel; + Sint16 Xmin, Ymin, Xmax, Ymax; + Sint16 HDpi, VDpi; + Uint8 Colormap[48]; + Uint8 Reserved; + Uint8 NPlanes; + Sint16 BytesPerLine; + Sint16 PaletteInfo; + Sint16 HscreenSize; + Sint16 VscreenSize; + Uint8 Filler[54]; +}; + +/* See if an image is contained in a data source */ +int IMG_isPCX(SDL_RWops *src) +{ + int start; + int is_PCX; + const int ZSoft_Manufacturer = 10; + const int PC_Paintbrush_Version = 5; + const int PCX_Uncompressed_Encoding = 0; + const int PCX_RunLength_Encoding = 1; + struct PCXheader pcxh; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_PCX = 0; + if ( SDL_RWread(src, &pcxh, sizeof(pcxh), 1) == 1 ) { + if ( (pcxh.Manufacturer == ZSoft_Manufacturer) && + (pcxh.Version == PC_Paintbrush_Version) && + (pcxh.Encoding == PCX_RunLength_Encoding || + pcxh.Encoding == PCX_Uncompressed_Encoding) ) { + is_PCX = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_PCX); +} + +/* Load a PCX type image from an SDL datasource */ +SDL_Surface *IMG_LoadPCX_RW(SDL_RWops *src) +{ + int start; + struct PCXheader pcxh; + Uint32 Rmask; + Uint32 Gmask; + Uint32 Bmask; + Uint32 Amask; + SDL_Surface *surface = NULL; + int width, height; + int y, bpl; + Uint8 *row, *buf = NULL; + char *error = NULL; + int bits, src_bits; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + if ( ! SDL_RWread(src, &pcxh, sizeof(pcxh), 1) ) { + error = "file truncated"; + goto done; + } + pcxh.Xmin = SDL_SwapLE16(pcxh.Xmin); + pcxh.Ymin = SDL_SwapLE16(pcxh.Ymin); + pcxh.Xmax = SDL_SwapLE16(pcxh.Xmax); + pcxh.Ymax = SDL_SwapLE16(pcxh.Ymax); + pcxh.BytesPerLine = SDL_SwapLE16(pcxh.BytesPerLine); + + /* Create the surface of the appropriate type */ + width = (pcxh.Xmax - pcxh.Xmin) + 1; + height = (pcxh.Ymax - pcxh.Ymin) + 1; + Rmask = Gmask = Bmask = Amask = 0; + src_bits = pcxh.BitsPerPixel * pcxh.NPlanes; + if((pcxh.BitsPerPixel == 1 && pcxh.NPlanes >= 1 && pcxh.NPlanes <= 4) + || (pcxh.BitsPerPixel == 8 && pcxh.NPlanes == 1)) { + bits = 8; + } else if(pcxh.BitsPerPixel == 8 && pcxh.NPlanes == 3) { + bits = 24; + if ( SDL_BYTEORDER == SDL_LIL_ENDIAN ) { + Rmask = 0x000000FF; + Gmask = 0x0000FF00; + Bmask = 0x00FF0000; + } else { + Rmask = 0xFF0000; + Gmask = 0x00FF00; + Bmask = 0x0000FF; + } + } else { + error = "unsupported PCX format"; + goto done; + } + surface = SDL_AllocSurface(SDL_SWSURFACE, width, height, + bits, Rmask, Gmask, Bmask, Amask); + if ( surface == NULL ) + goto done; + + bpl = pcxh.NPlanes * pcxh.BytesPerLine; + if (bpl > surface->pitch) { + error = "bytes per line is too large (corrupt?)"; + } + buf = malloc(bpl); + row = surface->pixels; + for ( y=0; yh; ++y ) { + /* decode a scan line to a temporary buffer first */ + int i, count = 0; + Uint8 ch; + Uint8 *dst = (src_bits == 8) ? row : buf; + if ( pcxh.Encoding == 0 ) { + if(!SDL_RWread(src, dst, bpl, 1)) { + error = "file truncated"; + goto done; + } + } else { + for(i = 0; i < bpl; i++) { + if(!count) { + if(!SDL_RWread(src, &ch, 1, 1)) { + error = "file truncated"; + goto done; + } + if( (ch & 0xc0) == 0xc0) { + count = ch & 0x3f; + if(!SDL_RWread(src, &ch, 1, 1)) { + error = "file truncated"; + goto done; + } + } else + count = 1; + } + dst[i] = ch; + count--; + } + } + + if(src_bits <= 4) { + /* expand planes to 1 byte/pixel */ + Uint8 *src = buf; + int plane; + for(plane = 0; plane < pcxh.NPlanes; plane++) { + int i, j, x = 0; + for(i = 0; i < pcxh.BytesPerLine; i++) { + Uint8 byte = *src++; + for(j = 7; j >= 0; j--) { + unsigned bit = (byte >> j) & 1; + /* skip padding bits */ + if (i * 8 + j >= width) + continue; + row[x++] |= bit << plane; + } + } + } + } else if(src_bits == 24) { + /* de-interlace planes */ + Uint8 *src = buf; + int plane; + for(plane = 0; plane < pcxh.NPlanes; plane++) { + int x; + dst = row + plane; + for(x = 0; x < width; x++) { + *dst = *src++; + dst += pcxh.NPlanes; + } + } + } + + row += surface->pitch; + } + + if(bits == 8) { + SDL_Color *colors = surface->format->palette->colors; + int nc = 1 << src_bits; + int i; + + surface->format->palette->ncolors = nc; + if(src_bits == 8) { + Uint8 ch; + /* look for a 256-colour palette */ + do { + if ( !SDL_RWread(src, &ch, 1, 1)) { + error = "file truncated"; + goto done; + } + } while ( ch != 12 ); + + for(i = 0; i < 256; i++) { + SDL_RWread(src, &colors[i].r, 1, 1); + SDL_RWread(src, &colors[i].g, 1, 1); + SDL_RWread(src, &colors[i].b, 1, 1); + } + } else { + for(i = 0; i < nc; i++) { + colors[i].r = pcxh.Colormap[i * 3]; + colors[i].g = pcxh.Colormap[i * 3 + 1]; + colors[i].b = pcxh.Colormap[i * 3 + 2]; + } + } + } + +done: + free(buf); + if ( error ) { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + surface = NULL; + } + IMG_SetError(error); + } + return(surface); +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isPCX(SDL_RWops *src) +{ + return(0); +} + +/* Load a PCX type image from an SDL datasource */ +SDL_Surface *IMG_LoadPCX_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_PCX */ diff --git a/apps/plugins/sdl/SDL_image/IMG_png.c b/apps/plugins/sdl/SDL_image/IMG_png.c new file mode 100644 index 0000000..93c7ee5 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_png.c @@ -0,0 +1,584 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) + +/* This is a PNG image file loading framework */ + +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_PNG + +/*============================================================================= + File: SDL_png.c + Purpose: A PNG loader and saver for the SDL library + Revision: + Created by: Philippe Lavoie (2 November 1998) + lavoie@zeus.genie.uottawa.ca + Modified by: + + Copyright notice: + Copyright (C) 1998 Philippe Lavoie + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Library General Public + License as published by the Free Software Foundation; either + version 2 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Library General Public License for more details. + + You should have received a copy of the GNU Library General Public + License along with this library; if not, write to the Free + Software Foundation, Inc., 675 Mass Ave, Cambridge, MA 02139, USA. + + Comments: The load and save routine are basically the ones you can find + in the example.c file from the libpng distribution. + + Changes: + 5/17/99 - Modified to use the new SDL data sources - Sam Lantinga + +=============================================================================*/ + +#include "SDL_endian.h" + +#ifdef macintosh +#define MACOS +#endif +#include + +/* Check for the older version of libpng */ +#if (PNG_LIBPNG_VER_MAJOR == 1) && (PNG_LIBPNG_VER_MINOR < 4) +#define LIBPNG_VERSION_12 +#endif + +static struct { + int loaded; + void *handle; + png_infop (*png_create_info_struct) (png_structp png_ptr); + png_structp (*png_create_read_struct) (png_const_charp user_png_ver, png_voidp error_ptr, png_error_ptr error_fn, png_error_ptr warn_fn); + void (*png_destroy_read_struct) (png_structpp png_ptr_ptr, png_infopp info_ptr_ptr, png_infopp end_info_ptr_ptr); + png_uint_32 (*png_get_IHDR) (png_structp png_ptr, png_infop info_ptr, png_uint_32 *width, png_uint_32 *height, int *bit_depth, int *color_type, int *interlace_method, int *compression_method, int *filter_method); + png_voidp (*png_get_io_ptr) (png_structp png_ptr); + png_byte (*png_get_channels) (png_structp png_ptr, png_infop info_ptr); + png_uint_32 (*png_get_PLTE) (png_structp png_ptr, png_infop info_ptr, png_colorp *palette, int *num_palette); + png_uint_32 (*png_get_tRNS) (png_structp png_ptr, png_infop info_ptr, png_bytep *trans, int *num_trans, png_color_16p *trans_values); + png_uint_32 (*png_get_valid) (png_structp png_ptr, png_infop info_ptr, png_uint_32 flag); + void (*png_read_image) (png_structp png_ptr, png_bytepp image); + void (*png_read_info) (png_structp png_ptr, png_infop info_ptr); + void (*png_read_update_info) (png_structp png_ptr, png_infop info_ptr); + void (*png_set_expand) (png_structp png_ptr); + void (*png_set_gray_to_rgb) (png_structp png_ptr); + void (*png_set_packing) (png_structp png_ptr); + void (*png_set_read_fn) (png_structp png_ptr, png_voidp io_ptr, png_rw_ptr read_data_fn); + void (*png_set_strip_16) (png_structp png_ptr); + int (*png_sig_cmp) (png_bytep sig, png_size_t start, png_size_t num_to_check); +#ifndef LIBPNG_VERSION_12 + jmp_buf* (*png_set_longjmp_fn) (png_structp, png_longjmp_ptr, size_t); +#endif +} lib; + +#ifdef LOAD_PNG_DYNAMIC +int IMG_InitPNG() +{ + if ( lib.loaded == 0 ) { + lib.handle = SDL_LoadObject(LOAD_PNG_DYNAMIC); + if ( lib.handle == NULL ) { + return -1; + } + lib.png_create_info_struct = + (png_infop (*) (png_structp)) + SDL_LoadFunction(lib.handle, "png_create_info_struct"); + if ( lib.png_create_info_struct == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_create_read_struct = + (png_structp (*) (png_const_charp, png_voidp, png_error_ptr, png_error_ptr)) + SDL_LoadFunction(lib.handle, "png_create_read_struct"); + if ( lib.png_create_read_struct == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_destroy_read_struct = + (void (*) (png_structpp, png_infopp, png_infopp)) + SDL_LoadFunction(lib.handle, "png_destroy_read_struct"); + if ( lib.png_destroy_read_struct == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_get_IHDR = + (png_uint_32 (*) (png_structp, png_infop, png_uint_32 *, png_uint_32 *, int *, int *, int *, int *, int *)) + SDL_LoadFunction(lib.handle, "png_get_IHDR"); + if ( lib.png_get_IHDR == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_get_channels = + (png_byte (*) (png_structp, png_infop)) + SDL_LoadFunction(lib.handle, "png_get_channels"); + if ( lib.png_get_channels == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_get_io_ptr = + (png_voidp (*) (png_structp)) + SDL_LoadFunction(lib.handle, "png_get_io_ptr"); + if ( lib.png_get_io_ptr == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_get_PLTE = + (png_uint_32 (*) (png_structp, png_infop, png_colorp *, int *)) + SDL_LoadFunction(lib.handle, "png_get_PLTE"); + if ( lib.png_get_PLTE == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_get_tRNS = + (png_uint_32 (*) (png_structp, png_infop, png_bytep *, int *, png_color_16p *)) + SDL_LoadFunction(lib.handle, "png_get_tRNS"); + if ( lib.png_get_tRNS == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_get_valid = + (png_uint_32 (*) (png_structp, png_infop, png_uint_32)) + SDL_LoadFunction(lib.handle, "png_get_valid"); + if ( lib.png_get_valid == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_read_image = + (void (*) (png_structp, png_bytepp)) + SDL_LoadFunction(lib.handle, "png_read_image"); + if ( lib.png_read_image == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_read_info = + (void (*) (png_structp, png_infop)) + SDL_LoadFunction(lib.handle, "png_read_info"); + if ( lib.png_read_info == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_read_update_info = + (void (*) (png_structp, png_infop)) + SDL_LoadFunction(lib.handle, "png_read_update_info"); + if ( lib.png_read_update_info == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_set_expand = + (void (*) (png_structp)) + SDL_LoadFunction(lib.handle, "png_set_expand"); + if ( lib.png_set_expand == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_set_gray_to_rgb = + (void (*) (png_structp)) + SDL_LoadFunction(lib.handle, "png_set_gray_to_rgb"); + if ( lib.png_set_gray_to_rgb == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_set_packing = + (void (*) (png_structp)) + SDL_LoadFunction(lib.handle, "png_set_packing"); + if ( lib.png_set_packing == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_set_read_fn = + (void (*) (png_structp, png_voidp, png_rw_ptr)) + SDL_LoadFunction(lib.handle, "png_set_read_fn"); + if ( lib.png_set_read_fn == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_set_strip_16 = + (void (*) (png_structp)) + SDL_LoadFunction(lib.handle, "png_set_strip_16"); + if ( lib.png_set_strip_16 == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.png_sig_cmp = + (int (*) (png_bytep, png_size_t, png_size_t)) + SDL_LoadFunction(lib.handle, "png_sig_cmp"); + if ( lib.png_sig_cmp == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } +#ifndef LIBPNG_VERSION_12 + lib.png_set_longjmp_fn = + (jmp_buf * (*) (png_structp, png_longjmp_ptr, size_t)) + SDL_LoadFunction(lib.handle, "png_set_longjmp_fn"); + if ( lib.png_set_longjmp_fn == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } +#endif + } + ++lib.loaded; + + return 0; +} +void IMG_QuitPNG() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + SDL_UnloadObject(lib.handle); + } + --lib.loaded; +} +#else +int IMG_InitPNG() +{ + if ( lib.loaded == 0 ) { + lib.png_create_info_struct = png_create_info_struct; + lib.png_create_read_struct = png_create_read_struct; + lib.png_destroy_read_struct = png_destroy_read_struct; + lib.png_get_IHDR = png_get_IHDR; + lib.png_get_channels = png_get_channels; + lib.png_get_io_ptr = png_get_io_ptr; + lib.png_get_PLTE = png_get_PLTE; + lib.png_get_tRNS = png_get_tRNS; + lib.png_get_valid = png_get_valid; + lib.png_read_image = png_read_image; + lib.png_read_info = png_read_info; + lib.png_read_update_info = png_read_update_info; + lib.png_set_expand = png_set_expand; + lib.png_set_gray_to_rgb = png_set_gray_to_rgb; + lib.png_set_packing = png_set_packing; + lib.png_set_read_fn = png_set_read_fn; + lib.png_set_strip_16 = png_set_strip_16; + lib.png_sig_cmp = png_sig_cmp; +#ifndef LIBPNG_VERSION_12 + lib.png_set_longjmp_fn = png_set_longjmp_fn; +#endif + } + ++lib.loaded; + + return 0; +} +void IMG_QuitPNG() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + } + --lib.loaded; +} +#endif /* LOAD_PNG_DYNAMIC */ + +/* See if an image is contained in a data source */ +int IMG_isPNG(SDL_RWops *src) +{ + int start; + int is_PNG; + Uint8 magic[4]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_PNG = 0; + if ( SDL_RWread(src, magic, 1, sizeof(magic)) == sizeof(magic) ) { + if ( magic[0] == 0x89 && + magic[1] == 'P' && + magic[2] == 'N' && + magic[3] == 'G' ) { + is_PNG = 1; + } + else + rb->splashf(HZ, "magic is %4s", magic); + } + else + { + rb->splashf(HZ, "read() failed!"); + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_PNG); +} + +/* Load a PNG type image from an SDL datasource */ +static void png_read_data(png_structp ctx, png_bytep area, png_size_t size) +{ + SDL_RWops *src; + + src = (SDL_RWops *)lib.png_get_io_ptr(ctx); + SDL_RWread(src, area, size, 1); +} +SDL_Surface *IMG_LoadPNG_RW(SDL_RWops *src) +{ + int start; + const char *error; + SDL_Surface *volatile surface; + png_structp png_ptr; + png_infop info_ptr; + png_uint_32 width, height; + int bit_depth, color_type, interlace_type, num_channels; + Uint32 Rmask; + Uint32 Gmask; + Uint32 Bmask; + Uint32 Amask; + SDL_Palette *palette; + png_bytep *volatile row_pointers; + int row, i; + volatile int ckey = -1; + png_color_16 *transv; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + if ( !IMG_Init(IMG_INIT_PNG) ) { + return NULL; + } + + /* Initialize the data we will clean up when we're done */ + error = NULL; + png_ptr = NULL; info_ptr = NULL; row_pointers = NULL; surface = NULL; + + /* Create the PNG loading context structure */ + png_ptr = lib.png_create_read_struct(PNG_LIBPNG_VER_STRING, + NULL,NULL,NULL); + if (png_ptr == NULL){ + error = "Couldn't allocate memory for PNG file or incompatible PNG dll"; + goto done; + } + + /* Allocate/initialize the memory for image information. REQUIRED. */ + info_ptr = lib.png_create_info_struct(png_ptr); + if (info_ptr == NULL) { + error = "Couldn't create image information for PNG file"; + goto done; + } + + /* Set error handling if you are using setjmp/longjmp method (this is + * the normal method of doing things with libpng). REQUIRED unless you + * set up your own error handlers in png_create_read_struct() earlier. + */ +#ifndef LIBPNG_VERSION_12 + if ( setjmp(*lib.png_set_longjmp_fn(png_ptr, longjmp, sizeof (jmp_buf))) ) +#else + if ( setjmp(png_ptr->jmpbuf) ) +#endif + { + error = "Error reading the PNG file."; + goto done; + } + + /* Set up the input control */ + lib.png_set_read_fn(png_ptr, src, png_read_data); + + /* Read PNG header info */ + lib.png_read_info(png_ptr, info_ptr); + lib.png_get_IHDR(png_ptr, info_ptr, &width, &height, &bit_depth, + &color_type, &interlace_type, NULL, NULL); + + /* tell libpng to strip 16 bit/color files down to 8 bits/color */ + lib.png_set_strip_16(png_ptr) ; + + /* Extract multiple pixels with bit depths of 1, 2, and 4 from a single + * byte into separate bytes (useful for paletted and grayscale images). + */ + lib.png_set_packing(png_ptr); + + /* scale greyscale values to the range 0..255 */ + if(color_type == PNG_COLOR_TYPE_GRAY) + lib.png_set_expand(png_ptr); + + /* For images with a single "transparent colour", set colour key; + if more than one index has transparency, or if partially transparent + entries exist, use full alpha channel */ + if (lib.png_get_valid(png_ptr, info_ptr, PNG_INFO_tRNS)) { + int num_trans; + Uint8 *trans; + lib.png_get_tRNS(png_ptr, info_ptr, &trans, &num_trans, + &transv); + if(color_type == PNG_COLOR_TYPE_PALETTE) { + /* Check if all tRNS entries are opaque except one */ + int i, t = -1; + for(i = 0; i < num_trans; i++) + if(trans[i] == 0) { + if(t >= 0) + break; + t = i; + } else if(trans[i] != 255) + break; + if(i == num_trans) { + /* exactly one transparent index */ + ckey = t; + } else { + /* more than one transparent index, or translucency */ + lib.png_set_expand(png_ptr); + } + } else + ckey = 0; /* actual value will be set later */ + } + + if ( color_type == PNG_COLOR_TYPE_GRAY_ALPHA ) + lib.png_set_gray_to_rgb(png_ptr); + + lib.png_read_update_info(png_ptr, info_ptr); + + lib.png_get_IHDR(png_ptr, info_ptr, &width, &height, &bit_depth, + &color_type, &interlace_type, NULL, NULL); + + /* Allocate the SDL surface to hold the image */ + Rmask = Gmask = Bmask = Amask = 0 ; + num_channels = lib.png_get_channels(png_ptr, info_ptr); + if ( color_type != PNG_COLOR_TYPE_PALETTE ) { + if ( SDL_BYTEORDER == SDL_LIL_ENDIAN ) { + Rmask = 0x000000FF; + Gmask = 0x0000FF00; + Bmask = 0x00FF0000; + Amask = (num_channels == 4) ? 0xFF000000 : 0; + } else { + int s = (num_channels == 4) ? 0 : 8; + Rmask = 0xFF000000 >> s; + Gmask = 0x00FF0000 >> s; + Bmask = 0x0000FF00 >> s; + Amask = 0x000000FF >> s; + } + } + surface = SDL_AllocSurface(SDL_SWSURFACE, width, height, + bit_depth*num_channels, Rmask,Gmask,Bmask,Amask); + if ( surface == NULL ) { + error = "Out of memory"; + goto done; + } + + if(ckey != -1) { + if(color_type != PNG_COLOR_TYPE_PALETTE) + /* FIXME: Should these be truncated or shifted down? */ + ckey = SDL_MapRGB(surface->format, + (Uint8)transv->red, + (Uint8)transv->green, + (Uint8)transv->blue); + SDL_SetColorKey(surface, SDL_SRCCOLORKEY, ckey); + } + + /* Create the array of pointers to image data */ + row_pointers = (png_bytep*) malloc(sizeof(png_bytep)*height); + if ( (row_pointers == NULL) ) { + error = "Out of memory"; + goto done; + } + for (row = 0; row < (int)height; row++) { + row_pointers[row] = (png_bytep) + (Uint8 *)surface->pixels + row*surface->pitch; + } + + /* Read the entire image in one go */ + lib.png_read_image(png_ptr, row_pointers); + + /* and we're done! (png_read_end() can be omitted if no processing of + * post-IDAT text/time/etc. is desired) + * In some cases it can't read PNG's created by some popular programs (ACDSEE), + * we do not want to process comments, so we omit png_read_end + + lib.png_read_end(png_ptr, info_ptr); + */ + + /* Load the palette, if any */ + palette = surface->format->palette; + if ( palette ) { + int png_num_palette; + png_colorp png_palette; + lib.png_get_PLTE(png_ptr, info_ptr, &png_palette, &png_num_palette); + if(color_type == PNG_COLOR_TYPE_GRAY) { + palette->ncolors = 256; + for(i = 0; i < 256; i++) { + palette->colors[i].r = i; + palette->colors[i].g = i; + palette->colors[i].b = i; + } + } else if (png_num_palette > 0 ) { + palette->ncolors = png_num_palette; + for( i=0; icolors[i].b = png_palette[i].blue; + palette->colors[i].g = png_palette[i].green; + palette->colors[i].r = png_palette[i].red; + } + } + } + +done: /* Clean up and return */ + if ( png_ptr ) { + lib.png_destroy_read_struct(&png_ptr, + info_ptr ? &info_ptr : (png_infopp)0, + (png_infopp)0); + } + if ( row_pointers ) { + free(row_pointers); + } + if ( error ) { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + surface = NULL; + } + IMG_SetError(error); + } + return(surface); +} + +#else + +int IMG_InitPNG() +{ + IMG_SetError("PNG images are not supported"); + return(-1); +} + +void IMG_QuitPNG() +{ +} + +/* See if an image is contained in a data source */ +int IMG_isPNG(SDL_RWops *src) +{ + return(0); +} + +/* Load a PNG type image from an SDL datasource */ +SDL_Surface *IMG_LoadPNG_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_PNG */ + +#endif /* !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) */ diff --git a/apps/plugins/sdl/SDL_image/IMG_pnm.c b/apps/plugins/sdl/SDL_image/IMG_pnm.c new file mode 100644 index 0000000..0787f52 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_pnm.c @@ -0,0 +1,258 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* + * PNM (portable anymap) image loader: + * + * Supports: PBM, PGM and PPM, ASCII and binary formats + * (PBM and PGM are loaded as 8bpp surfaces) + * Does not support: maximum component value > 255 + */ + +#include +#include +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_PNM + +/* See if an image is contained in a data source */ +int IMG_isPNM(SDL_RWops *src) +{ + int start; + int is_PNM; + char magic[2]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_PNM = 0; + if ( SDL_RWread(src, magic, sizeof(magic), 1) ) { + /* + * PNM magic signatures: + * P1 PBM, ascii format + * P2 PGM, ascii format + * P3 PPM, ascii format + * P4 PBM, binary format + * P5 PGM, binary format + * P6 PPM, binary format + * P7 PAM, a general wrapper for PNM data + */ + if ( magic[0] == 'P' && magic[1] >= '1' && magic[1] <= '6' ) { + is_PNM = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_PNM); +} + +/* read a non-negative integer from the source. return -1 upon error */ +static int ReadNumber(SDL_RWops *src) +{ + int number; + unsigned char ch; + + /* Initialize return value */ + number = 0; + + /* Skip leading whitespace */ + do { + if ( ! SDL_RWread(src, &ch, 1, 1) ) { + return(0); + } + /* Eat comments as whitespace */ + if ( ch == '#' ) { /* Comment is '#' to end of line */ + do { + if ( ! SDL_RWread(src, &ch, 1, 1) ) { + return -1; + } + } while ( (ch != '\r') && (ch != '\n') ); + } + } while ( isspace(ch) ); + + /* Add up the number */ + do { + number *= 10; + number += ch-'0'; + + if ( !SDL_RWread(src, &ch, 1, 1) ) { + return -1; + } + } while ( isdigit(ch) ); + + return(number); +} + +SDL_Surface *IMG_LoadPNM_RW(SDL_RWops *src) +{ + int start; + SDL_Surface *surface = NULL; + int width, height; + int maxval, y, bpl; + Uint8 *row; + Uint8 *buf = NULL; + char *error = NULL; + Uint8 magic[2]; + int ascii; + enum { PBM, PGM, PPM, PAM } kind; + +#define ERROR(s) do { error = (s); goto done; } while(0) + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + SDL_RWread(src, magic, 2, 1); + kind = magic[1] - '1'; + ascii = 1; + if(kind >= 3) { + ascii = 0; + kind -= 3; + } + + width = ReadNumber(src); + height = ReadNumber(src); + if(width <= 0 || height <= 0) + ERROR("Unable to read image width and height"); + + if(kind != PBM) { + maxval = ReadNumber(src); + if(maxval <= 0 || maxval > 255) + ERROR("unsupported PNM format"); + } else + maxval = 255; /* never scale PBMs */ + + /* binary PNM allows just a single character of whitespace after + the last parameter, and we've already consumed it */ + + if(kind == PPM) { + /* 24-bit surface in R,G,B byte order */ + surface = SDL_AllocSurface(SDL_SWSURFACE, width, height, 24, +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + 0x000000ff, 0x0000ff00, 0x00ff0000, +#else + 0x00ff0000, 0x0000ff00, 0x000000ff, +#endif + 0); + } else { + /* load PBM/PGM as 8-bit indexed images */ + surface = SDL_AllocSurface(SDL_SWSURFACE, width, height, 8, + 0, 0, 0, 0); + } + if ( surface == NULL ) + ERROR("Out of memory"); + bpl = width * surface->format->BytesPerPixel; + if(kind == PGM) { + SDL_Color *c = surface->format->palette->colors; + int i; + for(i = 0; i < 256; i++) + c[i].r = c[i].g = c[i].b = i; + surface->format->palette->ncolors = 256; + } else if(kind == PBM) { + /* for some reason PBM has 1=black, 0=white */ + SDL_Color *c = surface->format->palette->colors; + c[0].r = c[0].g = c[0].b = 255; + c[1].r = c[1].g = c[1].b = 0; + surface->format->palette->ncolors = 2; + bpl = (width + 7) >> 3; + buf = malloc(bpl); + if(buf == NULL) + ERROR("Out of memory"); + } + + /* Read the image into the surface */ + row = surface->pixels; + for(y = 0; y < height; y++) { + if(ascii) { + int i; + if(kind == PBM) { + for(i = 0; i < width; i++) { + Uint8 ch; + do { + if(!SDL_RWread(src, &ch, + 1, 1)) + ERROR("file truncated"); + ch -= '0'; + } while(ch > 1); + row[i] = ch; + } + } else { + for(i = 0; i < bpl; i++) { + int c; + c = ReadNumber(src); + if(c < 0) + ERROR("file truncated"); + row[i] = c; + } + } + } else { + Uint8 *dst = (kind == PBM) ? buf : row; + if(!SDL_RWread(src, dst, bpl, 1)) + ERROR("file truncated"); + if(kind == PBM) { + /* expand bitmap to 8bpp */ + int i; + for(i = 0; i < width; i++) { + int bit = 7 - (i & 7); + row[i] = (buf[i >> 3] >> bit) & 1; + } + } + } + if(maxval < 255) { + /* scale up to full dynamic range (slow) */ + int i; + for(i = 0; i < bpl; i++) + row[i] = row[i] * 255 / maxval; + } + row += surface->pitch; + } +done: + free(buf); + if(error) { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + surface = NULL; + } + IMG_SetError(error); + } + return(surface); +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isPNM(SDL_RWops *src) +{ + return(0); +} + +/* Load a PNM type image from an SDL datasource */ +SDL_Surface *IMG_LoadPNM_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_PNM */ diff --git a/apps/plugins/sdl/SDL_image/IMG_tga.c b/apps/plugins/sdl/SDL_image/IMG_tga.c new file mode 100644 index 0000000..0e65c5d --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_tga.c @@ -0,0 +1,336 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) + +/* This is a Targa image file loading framework */ + +#include +#include +#include + +#include "SDL_endian.h" + +#include "SDL_image.h" + +#ifdef LOAD_TGA + +/* + * A TGA loader for the SDL library + * Supports: Reading 8, 15, 16, 24 and 32bpp images, with alpha or colourkey, + * uncompressed or RLE encoded. + * + * 2000-06-10 Mattias Engdegård : initial version + * 2000-06-26 Mattias Engdegård : read greyscale TGAs + * 2000-08-09 Mattias Engdegård : alpha inversion removed + */ + +struct TGAheader { + Uint8 infolen; /* length of info field */ + Uint8 has_cmap; /* 1 if image has colormap, 0 otherwise */ + Uint8 type; + + Uint8 cmap_start[2]; /* index of first colormap entry */ + Uint8 cmap_len[2]; /* number of entries in colormap */ + Uint8 cmap_bits; /* bits per colormap entry */ + + Uint8 yorigin[2]; /* image origin (ignored here) */ + Uint8 xorigin[2]; + Uint8 width[2]; /* image size */ + Uint8 height[2]; + Uint8 pixel_bits; /* bits/pixel */ + Uint8 flags; +}; + +enum tga_type { + TGA_TYPE_INDEXED = 1, + TGA_TYPE_RGB = 2, + TGA_TYPE_BW = 3, + TGA_TYPE_RLE_INDEXED = 9, + TGA_TYPE_RLE_RGB = 10, + TGA_TYPE_RLE_BW = 11 +}; + +#define TGA_INTERLEAVE_MASK 0xc0 +#define TGA_INTERLEAVE_NONE 0x00 +#define TGA_INTERLEAVE_2WAY 0x40 +#define TGA_INTERLEAVE_4WAY 0x80 + +#define TGA_ORIGIN_MASK 0x30 +#define TGA_ORIGIN_LEFT 0x00 +#define TGA_ORIGIN_RIGHT 0x10 +#define TGA_ORIGIN_LOWER 0x00 +#define TGA_ORIGIN_UPPER 0x20 + +/* read/write unaligned little-endian 16-bit ints */ +#define LE16(p) ((p)[0] + ((p)[1] << 8)) +#define SETLE16(p, v) ((p)[0] = (v), (p)[1] = (v) >> 8) + +/* Load a TGA type image from an SDL datasource */ +SDL_Surface *IMG_LoadTGA_RW(SDL_RWops *src) +{ + int start; + const char *error = NULL; + struct TGAheader hdr; + int rle = 0; + int alpha = 0; + int indexed = 0; + int grey = 0; + int ckey = -1; + int ncols, w, h; + SDL_Surface *img = NULL; + Uint32 rmask, gmask, bmask, amask; + Uint8 *dst; + int i; + int bpp; + int lstep; + Uint32 pixel; + int count, rep; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + if(!SDL_RWread(src, &hdr, sizeof(hdr), 1)) { + error = "Error reading TGA data"; + goto error; + } + ncols = LE16(hdr.cmap_len); + switch(hdr.type) { + case TGA_TYPE_RLE_INDEXED: + rle = 1; + /* fallthrough */ + case TGA_TYPE_INDEXED: + if(!hdr.has_cmap || hdr.pixel_bits != 8 || ncols > 256) + goto unsupported; + indexed = 1; + break; + + case TGA_TYPE_RLE_RGB: + rle = 1; + /* fallthrough */ + case TGA_TYPE_RGB: + indexed = 0; + break; + + case TGA_TYPE_RLE_BW: + rle = 1; + /* fallthrough */ + case TGA_TYPE_BW: + if(hdr.pixel_bits != 8) + goto unsupported; + /* Treat greyscale as 8bpp indexed images */ + indexed = grey = 1; + break; + + default: + goto unsupported; + } + + bpp = (hdr.pixel_bits + 7) >> 3; + rmask = gmask = bmask = amask = 0; + switch(hdr.pixel_bits) { + case 8: + if(!indexed) { + goto unsupported; + } + break; + + case 15: + case 16: + /* 15 and 16bpp both seem to use 5 bits/plane. The extra alpha bit + is ignored for now. */ + rmask = 0x7c00; + gmask = 0x03e0; + bmask = 0x001f; + break; + + case 32: + alpha = 1; + /* fallthrough */ + case 24: + if(SDL_BYTEORDER == SDL_BIG_ENDIAN) { + int s = alpha ? 0 : 8; + amask = 0x000000ff >> s; + rmask = 0x0000ff00 >> s; + gmask = 0x00ff0000 >> s; + bmask = 0xff000000 >> s; + } else { + amask = alpha ? 0xff000000 : 0; + rmask = 0x00ff0000; + gmask = 0x0000ff00; + bmask = 0x000000ff; + } + break; + + default: + goto unsupported; + } + + if((hdr.flags & TGA_INTERLEAVE_MASK) != TGA_INTERLEAVE_NONE + || hdr.flags & TGA_ORIGIN_RIGHT) { + goto unsupported; + } + + SDL_RWseek(src, hdr.infolen, RW_SEEK_CUR); /* skip info field */ + + w = LE16(hdr.width); + h = LE16(hdr.height); + img = SDL_CreateRGBSurface(SDL_SWSURFACE, w, h, + bpp * 8, + rmask, gmask, bmask, amask); + if(img == NULL) { + error = "Out of memory"; + goto error; + } + + if(hdr.has_cmap) { + int palsiz = ncols * ((hdr.cmap_bits + 7) >> 3); + if(indexed && !grey) { + Uint8 *pal = malloc(palsiz), *p = pal; + SDL_Color *colors = img->format->palette->colors; + img->format->palette->ncolors = ncols; + SDL_RWread(src, pal, palsiz, 1); + for(i = 0; i < ncols; i++) { + switch(hdr.cmap_bits) { + case 15: + case 16: + { + Uint16 c = p[0] + (p[1] << 8); + p += 2; + colors[i].r = (c >> 7) & 0xf8; + colors[i].g = (c >> 2) & 0xf8; + colors[i].b = c << 3; + } + break; + case 24: + case 32: + colors[i].b = *p++; + colors[i].g = *p++; + colors[i].r = *p++; + if(hdr.cmap_bits == 32 && *p++ < 128) + ckey = i; + break; + } + } + free(pal); + if(ckey >= 0) + SDL_SetColorKey(img, SDL_SRCCOLORKEY, ckey); + } else { + /* skip unneeded colormap */ + SDL_RWseek(src, palsiz, RW_SEEK_CUR); + } + } + + if(grey) { + SDL_Color *colors = img->format->palette->colors; + for(i = 0; i < 256; i++) + colors[i].r = colors[i].g = colors[i].b = i; + img->format->palette->ncolors = 256; + } + + if(hdr.flags & TGA_ORIGIN_UPPER) { + lstep = img->pitch; + dst = img->pixels; + } else { + lstep = -img->pitch; + dst = (Uint8 *)img->pixels + (h - 1) * img->pitch; + } + + /* The RLE decoding code is slightly convoluted since we can't rely on + spans not to wrap across scan lines */ + count = rep = 0; + for(i = 0; i < h; i++) { + if(rle) { + int x = 0; + for(;;) { + Uint8 c; + + if(count) { + int n = count; + if(n > w - x) + n = w - x; + SDL_RWread(src, dst + x * bpp, n * bpp, 1); + count -= n; + x += n; + if(x == w) + break; + } else if(rep) { + int n = rep; + if(n > w - x) + n = w - x; + rep -= n; + while(n--) { + memcpy(dst + x * bpp, &pixel, bpp); + x++; + } + if(x == w) + break; + } + + SDL_RWread(src, &c, 1, 1); + if(c & 0x80) { + SDL_RWread(src, &pixel, bpp, 1); + rep = (c & 0x7f) + 1; + } else { + count = c + 1; + } + } + + } else { + SDL_RWread(src, dst, w * bpp, 1); + } + if(SDL_BYTEORDER == SDL_BIG_ENDIAN && bpp == 2) { + /* swap byte order */ + int x; + Uint16 *p = (Uint16 *)dst; + for(x = 0; x < w; x++) + p[x] = SDL_Swap16(p[x]); + } + dst += lstep; + } + return img; + +unsupported: + error = "Unsupported TGA format"; + +error: + SDL_RWseek(src, start, RW_SEEK_SET); + if ( img ) { + SDL_FreeSurface(img); + } + IMG_SetError(error); + return NULL; +} + +#else + +/* dummy TGA load routine */ +SDL_Surface *IMG_LoadTGA_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_TGA */ + +#endif /* !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) */ diff --git a/apps/plugins/sdl/SDL_image/IMG_tif.c b/apps/plugins/sdl/SDL_image/IMG_tif.c new file mode 100644 index 0000000..25084ad --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_tif.c @@ -0,0 +1,298 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#if !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) + +/* This is a TIFF image file loading framework */ + +#include + +#include "SDL_image.h" + +#ifdef LOAD_TIF + +#include + +static struct { + int loaded; + void *handle; + TIFF* (*TIFFClientOpen)(const char*, const char*, thandle_t, TIFFReadWriteProc, TIFFReadWriteProc, TIFFSeekProc, TIFFCloseProc, TIFFSizeProc, TIFFMapFileProc, TIFFUnmapFileProc); + void (*TIFFClose)(TIFF*); + int (*TIFFGetField)(TIFF*, ttag_t, ...); + int (*TIFFReadRGBAImage)(TIFF*, uint32, uint32, uint32*, int); + TIFFErrorHandler (*TIFFSetErrorHandler)(TIFFErrorHandler); +} lib; + +#ifdef LOAD_TIF_DYNAMIC +int IMG_InitTIF() +{ + if ( lib.loaded == 0 ) { + lib.handle = SDL_LoadObject(LOAD_TIF_DYNAMIC); + if ( lib.handle == NULL ) { + return -1; + } + lib.TIFFClientOpen = + (TIFF* (*)(const char*, const char*, thandle_t, TIFFReadWriteProc, TIFFReadWriteProc, TIFFSeekProc, TIFFCloseProc, TIFFSizeProc, TIFFMapFileProc, TIFFUnmapFileProc)) + SDL_LoadFunction(lib.handle, "TIFFClientOpen"); + if ( lib.TIFFClientOpen == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.TIFFClose = + (void (*)(TIFF*)) + SDL_LoadFunction(lib.handle, "TIFFClose"); + if ( lib.TIFFClose == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.TIFFGetField = + (int (*)(TIFF*, ttag_t, ...)) + SDL_LoadFunction(lib.handle, "TIFFGetField"); + if ( lib.TIFFGetField == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.TIFFReadRGBAImage = + (int (*)(TIFF*, uint32, uint32, uint32*, int)) + SDL_LoadFunction(lib.handle, "TIFFReadRGBAImage"); + if ( lib.TIFFReadRGBAImage == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + lib.TIFFSetErrorHandler = + (TIFFErrorHandler (*)(TIFFErrorHandler)) + SDL_LoadFunction(lib.handle, "TIFFSetErrorHandler"); + if ( lib.TIFFSetErrorHandler == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + } + ++lib.loaded; + + return 0; +} +void IMG_QuitTIF() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + SDL_UnloadObject(lib.handle); + } + --lib.loaded; +} +#else +int IMG_InitTIF() +{ + if ( lib.loaded == 0 ) { + lib.TIFFClientOpen = TIFFClientOpen; + lib.TIFFClose = TIFFClose; + lib.TIFFGetField = TIFFGetField; + lib.TIFFReadRGBAImage = TIFFReadRGBAImage; + lib.TIFFSetErrorHandler = TIFFSetErrorHandler; + } + ++lib.loaded; + + return 0; +} +void IMG_QuitTIF() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + } + --lib.loaded; +} +#endif /* LOAD_TIF_DYNAMIC */ + +/* + * These are the thunking routine to use the SDL_RWops* routines from + * libtiff's internals. +*/ + +static tsize_t tiff_read(thandle_t fd, tdata_t buf, tsize_t size) +{ + return SDL_RWread((SDL_RWops*)fd, buf, 1, size); +} + +static toff_t tiff_seek(thandle_t fd, toff_t offset, int origin) +{ + return SDL_RWseek((SDL_RWops*)fd, offset, origin); +} + +static tsize_t tiff_write(thandle_t fd, tdata_t buf, tsize_t size) +{ + return SDL_RWwrite((SDL_RWops*)fd, buf, 1, size); +} + +static int tiff_close(thandle_t fd) +{ + /* + * We don't want libtiff closing our SDL_RWops*, but if it's not given + * a routine to try, and if the image isn't a TIFF, it'll segfault. + */ + return 0; +} + +static int tiff_map(thandle_t fd, tdata_t* pbase, toff_t* psize) +{ + return (0); +} + +static void tiff_unmap(thandle_t fd, tdata_t base, toff_t size) +{ + return; +} + +static toff_t tiff_size(thandle_t fd) +{ + Uint32 save_pos; + toff_t size; + + save_pos = SDL_RWtell((SDL_RWops*)fd); + SDL_RWseek((SDL_RWops*)fd, 0, RW_SEEK_END); + size = SDL_RWtell((SDL_RWops*)fd); + SDL_RWseek((SDL_RWops*)fd, save_pos, RW_SEEK_SET); + return size; +} + +int IMG_isTIF(SDL_RWops* src) +{ + int start; + int is_TIF; + Uint8 magic[4]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_TIF = 0; + if ( SDL_RWread(src, magic, 1, sizeof(magic)) == sizeof(magic) ) { + if ( (magic[0] == 'I' && + magic[1] == 'I' && + magic[2] == 0x2a && + magic[3] == 0x00) || + (magic[0] == 'M' && + magic[1] == 'M' && + magic[2] == 0x00 && + magic[3] == 0x2a) ) { + is_TIF = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_TIF); +} + +SDL_Surface* IMG_LoadTIF_RW(SDL_RWops* src) +{ + int start; + TIFF* tiff; + SDL_Surface* surface = NULL; + Uint32 img_width, img_height; + Uint32 Rmask, Gmask, Bmask, Amask; + Uint32 x, y; + Uint32 half; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + if ( !IMG_Init(IMG_INIT_TIF) ) { + return NULL; + } + + /* turn off memory mapped access with the m flag */ + tiff = lib.TIFFClientOpen("SDL_image", "rm", (thandle_t)src, + tiff_read, tiff_write, tiff_seek, tiff_close, tiff_size, tiff_map, tiff_unmap); + if(!tiff) + goto error; + + /* Retrieve the dimensions of the image from the TIFF tags */ + lib.TIFFGetField(tiff, TIFFTAG_IMAGEWIDTH, &img_width); + lib.TIFFGetField(tiff, TIFFTAG_IMAGELENGTH, &img_height); + + Rmask = 0x000000FF; + Gmask = 0x0000FF00; + Bmask = 0x00FF0000; + Amask = 0xFF000000; + surface = SDL_AllocSurface(SDL_SWSURFACE, img_width, img_height, 32, + Rmask, Gmask, Bmask, Amask); + if(!surface) + goto error; + + if(!lib.TIFFReadRGBAImage(tiff, img_width, img_height, surface->pixels, 0)) + goto error; + + /* libtiff loads the image upside-down, flip it back */ + half = img_height / 2; + for(y = 0; y < half; y++) + { + Uint32 *top = (Uint32 *)surface->pixels + y * surface->pitch/4; + Uint32 *bot = (Uint32 *)surface->pixels + + (img_height - y - 1) * surface->pitch/4; + for(x = 0; x < img_width; x++) + { + Uint32 tmp = top[x]; + top[x] = bot[x]; + bot[x] = tmp; + } + } + lib.TIFFClose(tiff); + + return surface; + +error: + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + } + return NULL; +} + +#else + +int IMG_InitTIF() +{ + IMG_SetError("TIFF images are not supported"); + return(-1); +} + +void IMG_QuitTIF() +{ +} + +/* See if an image is contained in a data source */ +int IMG_isTIF(SDL_RWops *src) +{ + return(0); +} + +/* Load a TIFF type image from an SDL datasource */ +SDL_Surface *IMG_LoadTIF_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_TIF */ + +#endif /* !defined(__APPLE__) || defined(SDL_IMAGE_USE_COMMON_BACKEND) */ diff --git a/apps/plugins/sdl/SDL_image/IMG_webp.c b/apps/plugins/sdl/SDL_image/IMG_webp.c new file mode 100644 index 0000000..94727ce --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_webp.c @@ -0,0 +1,295 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This is a WEBP image file loading framework */ + +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_WEBP + +/*============================================================================= + File: SDL_webp.c + Purpose: A WEBP loader for the SDL library + Revision: + Created by: Michael Bonfils (Murlock) (26 November 2011) + murlock42@gmail.com + +=============================================================================*/ + +#include "SDL_endian.h" + +#ifdef macintosh +#define MACOS +#endif +#include + +static struct { + int loaded; + void *handle; + int/*VP8StatuCode*/ (*webp_get_features_internal) (const uint8_t *data, uint32_t data_size, WebPBitstreamFeatures* const features, int decoder_abi_version); + uint8_t* (*webp_decode_rgb_into) (const uint8_t* data, uint32_t data_size, uint8_t* output_buffer, int output_buffer_size, int output_stride); + uint8_t* (*webp_decode_rgba_into) (const uint8_t* data, uint32_t data_size, uint8_t* output_buffer, int output_buffer_size, int output_stride); +} lib; + +#ifdef LOAD_WEBP_DYNAMIC +int IMG_InitWEBP() +{ + if ( lib.loaded == 0 ) { + lib.handle = SDL_LoadObject(LOAD_WEBP_DYNAMIC); + if ( lib.handle == NULL ) { + return -1; + } + lib.webp_get_features_internal = + ( int (*) (const uint8_t *, uint32_t, WebPBitstreamFeatures* const, int) ) + SDL_LoadFunction(lib.handle, "WebPGetFeaturesInternal" ); + if ( lib.webp_get_features_internal == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + + lib.webp_decode_rgb_into = + ( uint8_t* (*) (const uint8_t*, uint32_t, uint8_t*, int, int ) ) + SDL_LoadFunction(lib.handle, "WebPDecodeRGBInto" ); + if ( lib.webp_decode_rgb_into == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + + lib.webp_decode_rgba_into = + ( uint8_t* (*) (const uint8_t*, uint32_t, uint8_t*, int, int ) ) + SDL_LoadFunction(lib.handle, "WebPDecodeRGBInto" ); + if ( lib.webp_decode_rgba_into == NULL ) { + SDL_UnloadObject(lib.handle); + return -1; + } + } + ++lib.loaded; + + return 0; +} +void IMG_QuitWEBP() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + SDL_UnloadObject(lib.handle); + } + --lib.loaded; +} +#else +int IMG_InitWEBP() +{ + if ( lib.loaded == 0 ) { + lib.webp_get_features_internal = WebPGetFeaturesInternal; + lib.webp_decode_rgb_into = WebPDecodeRGBInto; + lib.webp_decode_rgba_into = WebPDecodeRGBAInto; + } + ++lib.loaded; + + return 0; +} +void IMG_QuitWEBP() +{ + if ( lib.loaded == 0 ) { + return; + } + if ( lib.loaded == 1 ) { + } + --lib.loaded; +} +#endif /* LOAD_WEBP_DYNAMIC */ + +static int webp_getinfo( SDL_RWops *src, int *datasize ) { + int start; + int is_WEBP; + int data; + Uint8 magic[20]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_WEBP = 0; + if ( SDL_RWread(src, magic, 1, sizeof(magic)) == sizeof(magic) ) { + if ( magic[ 0] == 'R' && + magic[ 1] == 'I' && + magic[ 2] == 'F' && + magic[ 3] == 'F' && + magic[ 8] == 'W' && + magic[ 9] == 'E' && + magic[10] == 'B' && + magic[11] == 'P' && + magic[12] == 'V' && + magic[13] == 'P' && + magic[14] == '8' && + magic[15] == ' ' ) { + is_WEBP = 1; + data = magic[16] | magic[17]<<8 | magic[18]<<16 | magic[19]<<24; + if ( datasize ) + *datasize = data; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_WEBP); +} + +/* See if an image is contained in a data source */ +int IMG_isWEBP(SDL_RWops *src) +{ + return webp_getinfo( src, NULL ); +} + +SDL_Surface *IMG_LoadWEBP_RW(SDL_RWops *src) +{ + int start; + const char *error = NULL; + SDL_Surface *volatile surface = NULL; + Uint32 Rmask; + Uint32 Gmask; + Uint32 Bmask; + Uint32 Amask; + WebPBitstreamFeatures features; + int raw_data_size; + uint8_t *raw_data; + int r; + uint8_t *ret; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + + start = SDL_RWtell(src); + + if ( !IMG_Init(IMG_INIT_WEBP) ) { + goto error; + } + + + raw_data_size = -1; + if ( !webp_getinfo( src, &raw_data_size ) ) { + error = "Invalid WEBP"; + goto error; + } + + // skip header + SDL_RWseek(src, start+20, RW_SEEK_SET ); + + raw_data = (uint8_t*) malloc( raw_data_size ); + if ( raw_data == NULL ) { + error = "Failed to allocate enought buffer for WEBP"; + goto error; + } + + r = SDL_RWread(src, raw_data, 1, raw_data_size ); + if ( r != raw_data_size ) { + error = "Failed to read WEBP"; + goto error; + } + +#if 0 + // extract size of picture, not interesting since we don't know about alpha channel + int width = -1, height = -1; + if ( !WebPGetInfo( raw_data, raw_data_size, &width, &height ) ) { + printf("WebPGetInfo has failed\n" ); + return NULL; + } +#endif + + if ( lib.webp_get_features_internal( raw_data, raw_data_size, &features, WEBP_DECODER_ABI_VERSION ) != VP8_STATUS_OK ) { + error = "WebPGetFeatures has failed"; + return NULL; + } + + /* Check if it's ok !*/ + Rmask = 0x000000FF; + Gmask = 0x0000FF00; + Bmask = 0x00FF0000; + Amask = features.has_alpha?0xFF000001:0; + + surface = SDL_AllocSurface(SDL_SWSURFACE, features.width, features.height, + features.has_alpha?32:24, Rmask,Gmask,Bmask,Amask); + + if ( surface == NULL ) { + error = "Failed to allocate SDL_Surface"; + goto error; + } + + if ( features.has_alpha ) { + ret = lib.webp_decode_rgba_into( raw_data, raw_data_size, surface->pixels, surface->pitch * surface->h, surface->pitch ); + } else { + ret = lib.webp_decode_rgb_into( raw_data, raw_data_size, surface->pixels, surface->pitch * surface->h, surface->pitch ); + } + + if ( !ret ) { + error = "Failed to decode WEBP"; + goto error; + } + + return surface; + + +error: + + if ( surface ) { + SDL_FreeSurface( surface ); + } + + if ( raw_data ) { + free( raw_data ); + } + + if ( error ) { + IMG_SetError( error ); + } + + SDL_RWseek(src, start, RW_SEEK_SET); + return(NULL); +} + +#else + +int IMG_InitWEBP() +{ + IMG_SetError("WEBP images are not supported"); + return(-1); +} + +void IMG_QuitWEBP() +{ +} + +/* See if an image is contained in a data source */ +int IMG_isWEBP(SDL_RWops *src) +{ + return(0); +} + +/* Load a WEBP type image from an SDL datasource */ +SDL_Surface *IMG_LoadWEBP_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_WEBP */ diff --git a/apps/plugins/sdl/SDL_image/IMG_xcf.c b/apps/plugins/sdl/SDL_image/IMG_xcf.c new file mode 100644 index 0000000..1dced65 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_xcf.c @@ -0,0 +1,824 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This is a XCF image file loading framework */ + +#include +#include +#include +#include + +#include "SDL_endian.h" +#include "SDL_image.h" + +#ifdef LOAD_XCF + +#if DEBUG +static char prop_names [][30] = { + "end", + "colormap", + "active_layer", + "active_channel", + "selection", + "floating_selection", + "opacity", + "mode", + "visible", + "linked", + "preserve_transparency", + "apply_mask", + "edit_mask", + "show_mask", + "show_masked", + "offsets", + "color", + "compression", + "guides", + "resolution", + "tattoo", + "parasites", + "unit", + "paths", + "user_unit" +}; +#endif + + +typedef enum +{ + PROP_END = 0, + PROP_COLORMAP = 1, + PROP_ACTIVE_LAYER = 2, + PROP_ACTIVE_CHANNEL = 3, + PROP_SELECTION = 4, + PROP_FLOATING_SELECTION = 5, + PROP_OPACITY = 6, + PROP_MODE = 7, + PROP_VISIBLE = 8, + PROP_LINKED = 9, + PROP_PRESERVE_TRANSPARENCY = 10, + PROP_APPLY_MASK = 11, + PROP_EDIT_MASK = 12, + PROP_SHOW_MASK = 13, + PROP_SHOW_MASKED = 14, + PROP_OFFSETS = 15, + PROP_COLOR = 16, + PROP_COMPRESSION = 17, + PROP_GUIDES = 18, + PROP_RESOLUTION = 19, + PROP_TATTOO = 20, + PROP_PARASITES = 21, + PROP_UNIT = 22, + PROP_PATHS = 23, + PROP_USER_UNIT = 24 +} xcf_prop_type; + +typedef enum { + COMPR_NONE = 0, + COMPR_RLE = 1, + COMPR_ZLIB = 2, + COMPR_FRACTAL = 3 +} xcf_compr_type; + +typedef enum { + IMAGE_RGB = 0, + IMAGE_GREYSCALE = 1, + IMAGE_INDEXED = 2 +} xcf_image_type; + +typedef struct { + Uint32 id; + Uint32 length; + union { + struct { + Uint32 num; + char * cmap; + } colormap; // 1 + struct { + Uint32 drawable_offset; + } floating_selection; // 5 + Sint32 opacity; + Sint32 mode; + int visible; + int linked; + int preserve_transparency; + int apply_mask; + int show_mask; + struct { + Sint32 x; + Sint32 y; + } offset; + unsigned char color [3]; + Uint8 compression; + struct { + Sint32 x; + Sint32 y; + } resolution; + struct { + char * name; + Uint32 flags; + Uint32 size; + char * data; + } parasite; + } data; +} xcf_prop; + +typedef struct { + char sign [14]; + Uint32 width; + Uint32 height; + Sint32 image_type; + xcf_prop * properties; + + Uint32 * layer_file_offsets; + Uint32 * channel_file_offsets; + + xcf_compr_type compr; + Uint32 cm_num; + unsigned char * cm_map; +} xcf_header; + +typedef struct { + Uint32 width; + Uint32 height; + Sint32 layer_type; + char * name; + xcf_prop * properties; + + Uint32 hierarchy_file_offset; + Uint32 layer_mask_offset; + + Uint32 offset_x; + Uint32 offset_y; + int visible; +} xcf_layer; + +typedef struct { + Uint32 width; + Uint32 height; + char * name; + xcf_prop * properties; + + Uint32 hierarchy_file_offset; + + Uint32 color; + Uint32 opacity; + int selection; + int visible; +} xcf_channel; + +typedef struct { + Uint32 width; + Uint32 height; + Uint32 bpp; + + Uint32 * level_file_offsets; +} xcf_hierarchy; + +typedef struct { + Uint32 width; + Uint32 height; + + Uint32 * tile_file_offsets; +} xcf_level; + +typedef unsigned char * xcf_tile; + +typedef unsigned char * (* load_tile_type) (SDL_RWops *, Uint32, int, int, int); + + +/* See if an image is contained in a data source */ +int IMG_isXCF(SDL_RWops *src) +{ + int start; + int is_XCF; + char magic[14]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_XCF = 0; + if ( SDL_RWread(src, magic, sizeof(magic), 1) ) { + if (strncmp(magic, "gimp xcf ", 9) == 0) { + is_XCF = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_XCF); +} + +static char * read_string (SDL_RWops * src) { + Uint32 tmp; + char * data; + + tmp = SDL_ReadBE32 (src); + if (tmp > 0) { + data = (char *) malloc (sizeof (char) * tmp); + SDL_RWread (src, data, tmp, 1); + } + else { + data = NULL; + } + + return data; +} + + +static Uint32 Swap32 (Uint32 v) { + return + ((v & 0x000000FF) << 16) + | ((v & 0x0000FF00)) + | ((v & 0x00FF0000) >> 16) + | ((v & 0xFF000000)); +} + +static void xcf_read_property (SDL_RWops * src, xcf_prop * prop) { + prop->id = SDL_ReadBE32 (src); + prop->length = SDL_ReadBE32 (src); + +#if DEBUG + printf ("%.8X: %s: %d\n", SDL_RWtell (src), prop->id < 25 ? prop_names [prop->id] : "unknown", prop->length); +#endif + + switch (prop->id) { + case PROP_COLORMAP: + prop->data.colormap.num = SDL_ReadBE32 (src); + prop->data.colormap.cmap = (char *) malloc (sizeof (char) * prop->data.colormap.num * 3); + SDL_RWread (src, prop->data.colormap.cmap, prop->data.colormap.num*3, 1); + break; + + case PROP_OFFSETS: + prop->data.offset.x = SDL_ReadBE32 (src); + prop->data.offset.y = SDL_ReadBE32 (src); + break; + case PROP_OPACITY: + prop->data.opacity = SDL_ReadBE32 (src); + break; + case PROP_COMPRESSION: + case PROP_COLOR: + SDL_RWread (src, &prop->data, prop->length, 1); + break; + case PROP_VISIBLE: + prop->data.visible = SDL_ReadBE32 (src); + break; + default: + // SDL_RWread (src, &prop->data, prop->length, 1); + SDL_RWseek (src, prop->length, RW_SEEK_CUR); + } +} + +static void free_xcf_header (xcf_header * h) { + if (h->cm_num) + free (h->cm_map); + + free (h); +} + +static xcf_header * read_xcf_header (SDL_RWops * src) { + xcf_header * h; + xcf_prop prop; + + h = (xcf_header *) malloc (sizeof (xcf_header)); + SDL_RWread (src, h->sign, 14, 1); + h->width = SDL_ReadBE32 (src); + h->height = SDL_ReadBE32 (src); + h->image_type = SDL_ReadBE32 (src); + + h->properties = NULL; + h->compr = COMPR_NONE; + h->cm_num = 0; + h->cm_map = NULL; + + // Just read, don't save + do { + xcf_read_property (src, &prop); + if (prop.id == PROP_COMPRESSION) + h->compr = prop.data.compression; + else if (prop.id == PROP_COLORMAP) { + // unused var: int i; + + h->cm_num = prop.data.colormap.num; + h->cm_map = (unsigned char *) malloc (sizeof (unsigned char) * 3 * h->cm_num); + memcpy (h->cm_map, prop.data.colormap.cmap, 3*sizeof (char)*h->cm_num); + free (prop.data.colormap.cmap); + } + } while (prop.id != PROP_END); + + return h; +} + +static void free_xcf_layer (xcf_layer * l) { + free (l->name); + free (l); +} + +static xcf_layer * read_xcf_layer (SDL_RWops * src) { + xcf_layer * l; + xcf_prop prop; + + l = (xcf_layer *) malloc (sizeof (xcf_layer)); + l->width = SDL_ReadBE32 (src); + l->height = SDL_ReadBE32 (src); + l->layer_type = SDL_ReadBE32 (src); + + l->name = read_string (src); + + do { + xcf_read_property (src, &prop); + if (prop.id == PROP_OFFSETS) { + l->offset_x = prop.data.offset.x; + l->offset_y = prop.data.offset.y; + } else if (prop.id == PROP_VISIBLE) { + l->visible = prop.data.visible ? 1 : 0; + } + } while (prop.id != PROP_END); + + l->hierarchy_file_offset = SDL_ReadBE32 (src); + l->layer_mask_offset = SDL_ReadBE32 (src); + + return l; +} + +static void free_xcf_channel (xcf_channel * c) { + free (c->name); + free (c); +} + +static xcf_channel * read_xcf_channel (SDL_RWops * src) { + xcf_channel * l; + xcf_prop prop; + + l = (xcf_channel *) malloc (sizeof (xcf_channel)); + l->width = SDL_ReadBE32 (src); + l->height = SDL_ReadBE32 (src); + + l->name = read_string (src); + + l->selection = 0; + do { + xcf_read_property (src, &prop); + switch (prop.id) { + case PROP_OPACITY: + l->opacity = prop.data.opacity << 24; + break; + case PROP_COLOR: + l->color = ((Uint32) prop.data.color[0] << 16) + | ((Uint32) prop.data.color[1] << 8) + | ((Uint32) prop.data.color[2]); + break; + case PROP_SELECTION: + l->selection = 1; + break; + case PROP_VISIBLE: + l->visible = prop.data.visible ? 1 : 0; + break; + default: + ; + } + } while (prop.id != PROP_END); + + l->hierarchy_file_offset = SDL_ReadBE32 (src); + + return l; +} + +static void free_xcf_hierarchy (xcf_hierarchy * h) { + free (h->level_file_offsets); + free (h); +} + +static xcf_hierarchy * read_xcf_hierarchy (SDL_RWops * src) { + xcf_hierarchy * h; + int i; + + h = (xcf_hierarchy *) malloc (sizeof (xcf_hierarchy)); + h->width = SDL_ReadBE32 (src); + h->height = SDL_ReadBE32 (src); + h->bpp = SDL_ReadBE32 (src); + + h->level_file_offsets = NULL; + i = 0; + do { + h->level_file_offsets = (Uint32 *) realloc (h->level_file_offsets, sizeof (Uint32) * (i+1)); + h->level_file_offsets [i] = SDL_ReadBE32 (src); + } while (h->level_file_offsets [i++]); + + return h; +} + +static void free_xcf_level (xcf_level * l) { + free (l->tile_file_offsets); + free (l); +} + +static xcf_level * read_xcf_level (SDL_RWops * src) { + xcf_level * l; + int i; + + l = (xcf_level *) malloc (sizeof (xcf_level)); + l->width = SDL_ReadBE32 (src); + l->height = SDL_ReadBE32 (src); + + l->tile_file_offsets = NULL; + i = 0; + do { + l->tile_file_offsets = (Uint32 *) realloc (l->tile_file_offsets, sizeof (Uint32) * (i+1)); + l->tile_file_offsets [i] = SDL_ReadBE32 (src); + } while (l->tile_file_offsets [i++]); + + return l; +} + +static void free_xcf_tile (unsigned char * t) { + free (t); +} + +static unsigned char * load_xcf_tile_none (SDL_RWops * src, Uint32 len, int bpp, int x, int y) { + unsigned char * load; + + load = (unsigned char *) malloc (len); // expect this is okay + SDL_RWread (src, load, len, 1); + + return load; +} + +static unsigned char * load_xcf_tile_rle (SDL_RWops * src, Uint32 len, int bpp, int x, int y) { + unsigned char * load, * t, * data, * d; + Uint32 reallen; + int i, size, count, j, length; + unsigned char val; + + t = load = (unsigned char *) malloc (len); + reallen = SDL_RWread (src, t, 1, len); + + data = (unsigned char *) malloc (x*y*bpp); + for (i = 0; i < bpp; i++) { + d = data + i; + size = x*y; + count = 0; + + while (size > 0) { + val = *t++; + + length = val; + if (length >= 128) { + length = 255 - (length - 1); + if (length == 128) { + length = (*t << 8) + t[1]; + t += 2; + } + + count += length; + size -= length; + + while (length-- > 0) { + *d = *t++; + d += bpp; + } + } + else { + length += 1; + if (length == 128) { + length = (*t << 8) + t[1]; + t += 2; + } + + count += length; + size -= length; + + val = *t++; + + for (j = 0; j < length; j++) { + *d = val; + d += bpp; + } + } + } + } + + free (load); + return (data); +} + +static Uint32 rgb2grey (Uint32 a) { + Uint8 l; + l = 0.2990 * ((a && 0x00FF0000) >> 16) + + 0.5870 * ((a && 0x0000FF00) >> 8) + + 0.1140 * ((a && 0x000000FF)); + + return (l << 16) | (l << 8) | l; +} + +static void create_channel_surface (SDL_Surface * surf, xcf_image_type itype, Uint32 color, Uint32 opacity) { + Uint32 c = 0; + + switch (itype) { + case IMAGE_RGB: + case IMAGE_INDEXED: + c = opacity | color; + break; + case IMAGE_GREYSCALE: + c = opacity | rgb2grey (color); + break; + } + SDL_FillRect (surf, NULL, c); +} + +static int do_layer_surface (SDL_Surface * surface, SDL_RWops * src, xcf_header * head, xcf_layer * layer, load_tile_type load_tile) { + xcf_hierarchy * hierarchy; + xcf_level * level; + unsigned char * tile; + Uint8 * p8; + Uint16 * p16; + Uint32 * p; + int x, y, tx, ty, ox, oy, i, j; + Uint32 *row; + + SDL_RWseek (src, layer->hierarchy_file_offset, RW_SEEK_SET); + hierarchy = read_xcf_hierarchy (src); + + level = NULL; + for (i = 0; hierarchy->level_file_offsets [i]; i++) { + SDL_RWseek (src, hierarchy->level_file_offsets [i], RW_SEEK_SET); + level = read_xcf_level (src); + + ty = tx = 0; + for (j = 0; level->tile_file_offsets [j]; j++) { + SDL_RWseek (src, level->tile_file_offsets [j], RW_SEEK_SET); + ox = tx+64 > level->width ? level->width % 64 : 64; + oy = ty+64 > level->height ? level->height % 64 : 64; + + if (level->tile_file_offsets [j+1]) { + tile = load_tile + (src, + level->tile_file_offsets [j+1] - level->tile_file_offsets [j], + hierarchy->bpp, + ox, oy); + } + else { + tile = load_tile + (src, + ox*oy*6, + hierarchy->bpp, + ox, oy); + } + + p8 = tile; + p16 = (Uint16 *) p8; + p = (Uint32 *) p8; + for (y=ty; y < ty+oy; y++) { + row = (Uint32 *)((Uint8 *)surface->pixels + y*surface->pitch + tx*4); + switch (hierarchy->bpp) { + case 4: + for (x=tx; x < tx+ox; x++) + *row++ = Swap32 (*p++); + break; + case 3: + for (x=tx; x < tx+ox; x++) { + *row = 0xFF000000; + *row |= ((Uint32) *(p8++) << 16); + *row |= ((Uint32) *(p8++) << 8); + *row |= ((Uint32) *(p8++) << 0); + row++; + } + break; + case 2: // Indexed/Greyscale + Alpha + switch (head->image_type) { + case IMAGE_INDEXED: + for (x=tx; x < tx+ox; x++) { + *row = ((Uint32) (head->cm_map [*p8*3]) << 16); + *row |= ((Uint32) (head->cm_map [*p8*3+1]) << 8); + *row |= ((Uint32) (head->cm_map [*p8++*3+2]) << 0); + *row |= ((Uint32) *p8++ << 24);; + row++; + } + break; + case IMAGE_GREYSCALE: + for (x=tx; x < tx+ox; x++) { + *row = ((Uint32) *p8 << 16); + *row |= ((Uint32) *p8 << 8); + *row |= ((Uint32) *p8++ << 0); + *row |= ((Uint32) *p8++ << 24);; + row++; + } + break; + default: + fprintf (stderr, "Unknown Gimp image type (%d)\n", head->image_type); + return 1; + } + break; + case 1: // Indexed/Greyscale + switch (head->image_type) { + case IMAGE_INDEXED: + for (x = tx; x < tx+ox; x++) { + *row++ = 0xFF000000 + | ((Uint32) (head->cm_map [*p8*3]) << 16) + | ((Uint32) (head->cm_map [*p8*3+1]) << 8) + | ((Uint32) (head->cm_map [*p8*3+2]) << 0); + p8++; + } + break; + case IMAGE_GREYSCALE: + for (x=tx; x < tx+ox; x++) { + *row++ = 0xFF000000 + | (((Uint32) (*p8)) << 16) + | (((Uint32) (*p8)) << 8) + | (((Uint32) (*p8)) << 0); + ++p8; + } + break; + default: + fprintf (stderr, "Unknown Gimp image type (%d)\n", head->image_type); + return 1; + } + break; + } + } + tx += 64; + if (tx >= level->width) { + tx = 0; + ty += 64; + } + if (ty >= level->height) { + break; + } + + free_xcf_tile (tile); + } + free_xcf_level (level); + } + + free_xcf_hierarchy (hierarchy); + + return 0; +} + +SDL_Surface *IMG_LoadXCF_RW(SDL_RWops *src) +{ + int start; + const char *error = NULL; + SDL_Surface *surface, *lays; + xcf_header * head; + xcf_layer * layer; + xcf_channel ** channel; + int chnls, i, offsets; + Uint32 offset, fp; + + unsigned char * (* load_tile) (SDL_RWops *, Uint32, int, int, int); + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + /* Initialize the data we will clean up when we're done */ + surface = NULL; + + head = read_xcf_header (src); + + switch (head->compr) { + case COMPR_NONE: + load_tile = load_xcf_tile_none; + break; + case COMPR_RLE: + load_tile = load_xcf_tile_rle; + break; + default: + fprintf (stderr, "Unsupported Compression.\n"); + free_xcf_header (head); + return NULL; + } + + /* Create the surface of the appropriate type */ + surface = SDL_AllocSurface(SDL_SWSURFACE, head->width, head->height, 32, + 0x00FF0000,0x0000FF00,0x000000FF,0xFF000000); + + if ( surface == NULL ) { + error = "Out of memory"; + goto done; + } + + head->layer_file_offsets = NULL; + offsets = 0; + + while ((offset = SDL_ReadBE32 (src))) { + head->layer_file_offsets = (Uint32 *) realloc (head->layer_file_offsets, sizeof (Uint32) * (offsets+1)); + head->layer_file_offsets [offsets] = offset; + offsets++; + } + fp = SDL_RWtell (src); + + lays = SDL_AllocSurface(SDL_SWSURFACE, head->width, head->height, 32, + 0x00FF0000,0x0000FF00,0x000000FF,0xFF000000); + + if ( lays == NULL ) { + error = "Out of memory"; + goto done; + } + + // Blit layers backwards, because Gimp saves them highest first + for (i = offsets; i > 0; i--) { + SDL_Rect rs, rd; + SDL_RWseek (src, head->layer_file_offsets [i-1], RW_SEEK_SET); + + layer = read_xcf_layer (src); + do_layer_surface (lays, src, head, layer, load_tile); + rs.x = 0; + rs.y = 0; + rs.w = layer->width; + rs.h = layer->height; + rd.x = layer->offset_x; + rd.y = layer->offset_y; + rd.w = layer->width; + rd.h = layer->height; + + if (layer->visible) + SDL_BlitSurface (lays, &rs, surface, &rd); + free_xcf_layer (layer); + } + + SDL_FreeSurface (lays); + + SDL_RWseek (src, fp, RW_SEEK_SET); + + // read channels + channel = NULL; + chnls = 0; + while ((offset = SDL_ReadBE32 (src))) { + channel = (xcf_channel **) realloc (channel, sizeof (xcf_channel *) * (chnls+1)); + fp = SDL_RWtell (src); + SDL_RWseek (src, offset, RW_SEEK_SET); + channel [chnls++] = (read_xcf_channel (src)); + SDL_RWseek (src, fp, RW_SEEK_SET); + } + + if (chnls) { + SDL_Surface * chs; + + chs = SDL_AllocSurface(SDL_SWSURFACE, head->width, head->height, 32, + 0x00FF0000,0x0000FF00,0x000000FF,0xFF000000); + + if (chs == NULL) { + error = "Out of memory"; + goto done; + } + for (i = 0; i < chnls; i++) { + // printf ("CNLBLT %i\n", i); + if (!channel [i]->selection && channel [i]->visible) { + create_channel_surface (chs, head->image_type, channel [i]->color, channel [i]->opacity); + SDL_BlitSurface (chs, NULL, surface, NULL); + } + free_xcf_channel (channel [i]); + } + + SDL_FreeSurface (chs); + } + +done: + free_xcf_header (head); + if ( error ) { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + surface = NULL; + } + IMG_SetError(error); + } + + return(surface); +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isXCF(SDL_RWops *src) +{ + return(0); +} + +/* Load a XCF type image from an SDL datasource */ +SDL_Surface *IMG_LoadXCF_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_XCF */ diff --git a/apps/plugins/sdl/SDL_image/IMG_xpm.c b/apps/plugins/sdl/SDL_image/IMG_xpm.c new file mode 100644 index 0000000..486992f --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_xpm.c @@ -0,0 +1,514 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* + * XPM (X PixMap) image loader: + * + * Supports the XPMv3 format, EXCEPT: + * - hotspot coordinates are ignored + * - only colour ('c') colour symbols are used + * - rgb.txt is not used (for portability), so only RGB colours + * are recognized (#rrggbb etc) - only a few basic colour names are + * handled + * + * The result is an 8bpp indexed surface if possible, otherwise 32bpp. + * The colourkey is correctly set if transparency is used. + * + * Besides the standard API, also provides + * + * SDL_Surface *IMG_ReadXPMFromArray(char **xpm) + * + * that reads the image data from an XPM file included in the C source. + * + * TODO: include rgb.txt here. The full table (from solaris 2.6) only + * requires about 13K in binary form. + */ + +#include +#include +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_XPM + +/* See if an image is contained in a data source */ +int IMG_isXPM(SDL_RWops *src) +{ + int start; + int is_XPM; + char magic[9]; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_XPM = 0; + if ( SDL_RWread(src, magic, sizeof(magic), 1) ) { + if ( memcmp(magic, "/* XPM */", sizeof(magic)) == 0 ) { + is_XPM = 1; + } + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_XPM); +} + +/* Hash table to look up colors from pixel strings */ +#define STARTING_HASH_SIZE 256 + +struct hash_entry { + char *key; + Uint32 color; + struct hash_entry *next; +}; + +struct color_hash { + struct hash_entry **table; + struct hash_entry *entries; /* array of all entries */ + struct hash_entry *next_free; + int size; + int maxnum; +}; + +static int hash_key(const char *key, int cpp, int size) +{ + int hash; + + hash = 0; + while ( cpp-- > 0 ) { + hash = hash * 33 + *key++; + } + return hash & (size - 1); +} + +static struct color_hash *create_colorhash(int maxnum) +{ + int bytes, s; + struct color_hash *hash; + + /* we know how many entries we need, so we can allocate + everything here */ + hash = malloc(sizeof *hash); + if(!hash) + return NULL; + + /* use power-of-2 sized hash table for decoding speed */ + for(s = STARTING_HASH_SIZE; s < maxnum; s <<= 1) + ; + hash->size = s; + hash->maxnum = maxnum; + bytes = hash->size * sizeof(struct hash_entry **); + hash->entries = NULL; /* in case malloc fails */ + hash->table = malloc(bytes); + if(!hash->table) + return NULL; + memset(hash->table, 0, bytes); + hash->entries = malloc(maxnum * sizeof(struct hash_entry)); + if(!hash->entries) { + free(hash->table); + return NULL; + } + hash->next_free = hash->entries; + return hash; +} + +static int add_colorhash(struct color_hash *hash, + char *key, int cpp, Uint32 color) +{ + int index = hash_key(key, cpp, hash->size); + struct hash_entry *e = hash->next_free++; + e->color = color; + e->key = key; + e->next = hash->table[index]; + hash->table[index] = e; + return 1; +} + +/* fast lookup that works if cpp == 1 */ +#define QUICK_COLORHASH(hash, key) ((hash)->table[*(Uint8 *)(key)]->color) + +static Uint32 get_colorhash(struct color_hash *hash, const char *key, int cpp) +{ + struct hash_entry *entry = hash->table[hash_key(key, cpp, hash->size)]; + while(entry) { + if(memcmp(key, entry->key, cpp) == 0) + return entry->color; + entry = entry->next; + } + return 0; /* garbage in - garbage out */ +} + +static void free_colorhash(struct color_hash *hash) +{ + if(hash && hash->table) { + free(hash->table); + free(hash->entries); + free(hash); + } +} + +/* portable case-insensitive string comparison */ +static int string_equal(const char *a, const char *b, int n) +{ + while(*a && *b && n) { + if(toupper((unsigned char)*a) != toupper((unsigned char)*b)) + return 0; + a++; + b++; + n--; + } + return *a == *b; +} + +#define ARRAYSIZE(a) (int)(sizeof(a) / sizeof((a)[0])) + +/* + * convert colour spec to RGB (in 0xrrggbb format). + * return 1 if successful. + */ +static int color_to_rgb(char *spec, int speclen, Uint32 *rgb) +{ + /* poor man's rgb.txt */ + static struct { char *name; Uint32 rgb; } known[] = { + {"none", 0xffffffff}, + {"black", 0x00000000}, + {"white", 0x00ffffff}, + {"red", 0x00ff0000}, + {"green", 0x0000ff00}, + {"blue", 0x000000ff} + }; + + if(spec[0] == '#') { + char buf[7]; + switch(speclen) { + case 4: + buf[0] = buf[1] = spec[1]; + buf[2] = buf[3] = spec[2]; + buf[4] = buf[5] = spec[3]; + break; + case 7: + memcpy(buf, spec + 1, 6); + break; + case 13: + buf[0] = spec[1]; + buf[1] = spec[2]; + buf[2] = spec[5]; + buf[3] = spec[6]; + buf[4] = spec[9]; + buf[5] = spec[10]; + break; + } + buf[6] = '\0'; + *rgb = strtol(buf, NULL, 16); + return 1; + } else { + int i; + for(i = 0; i < ARRAYSIZE(known); i++) + if(string_equal(known[i].name, spec, speclen)) { + *rgb = known[i].rgb; + return 1; + } + return 0; + } +} + +#ifndef MAX +#define MAX(a, b) ((a) > (b) ? (a) : (b)) +#endif + +static char *linebuf; +static int buflen; +static char *error; + +/* + * Read next line from the source. + * If len > 0, it's assumed to be at least len chars (for efficiency). + * Return NULL and set error upon EOF or parse error. + */ +static char *get_next_line(char ***lines, SDL_RWops *src, int len) +{ + char *linebufnew; + + if(lines) { + return *(*lines)++; + } else { + char c; + int n; + do { + if(SDL_RWread(src, &c, 1, 1) <= 0) { + error = "Premature end of data"; + return NULL; + } + } while(c != '"'); + if(len) { + len += 4; /* "\",\n\0" */ + if(len > buflen){ + buflen = len; + linebufnew = realloc(linebuf, buflen); + if(!linebufnew) { + free(linebuf); + error = "Out of memory"; + return NULL; + } + linebuf = linebufnew; + } + if(SDL_RWread(src, linebuf, len - 1, 1) <= 0) { + error = "Premature end of data"; + return NULL; + } + n = len - 2; + } else { + n = 0; + do { + if(n >= buflen - 1) { + if(buflen == 0) + buflen = 16; + buflen *= 2; + linebufnew = realloc(linebuf, buflen); + if(!linebufnew) { + free(linebuf); + error = "Out of memory"; + return NULL; + } + linebuf = linebufnew; + } + if(SDL_RWread(src, linebuf + n, 1, 1) <= 0) { + error = "Premature end of data"; + return NULL; + } + } while(linebuf[n++] != '"'); + n--; + } + linebuf[n] = '\0'; + return linebuf; + } +} + +#define SKIPSPACE(p) \ +do { \ + while(isspace((unsigned char)*(p))) \ + ++(p); \ +} while(0) + +#define SKIPNONSPACE(p) \ +do { \ + while(!isspace((unsigned char)*(p)) && *p) \ + ++(p); \ +} while(0) + +/* read XPM from either array or RWops */ +static SDL_Surface *load_xpm(char **xpm, SDL_RWops *src) +{ + int start = 0; + SDL_Surface *image = NULL; + int index; + int x, y; + int w, h, ncolors, cpp; + int indexed; + Uint8 *dst; + struct color_hash *colors = NULL; + SDL_Color *im_colors = NULL; + char *keystrings = NULL, *nextkey; + char *line; + char ***xpmlines = NULL; + int pixels_len; + + error = NULL; + linebuf = NULL; + buflen = 0; + + if ( src ) + start = SDL_RWtell(src); + + if(xpm) + xpmlines = &xpm; + + line = get_next_line(xpmlines, src, 0); + if(!line) + goto done; + /* + * The header string of an XPMv3 image has the format + * + * [ ] + * + * where the hotspot coords are intended for mouse cursors. + * Right now we don't use the hotspots but it should be handled + * one day. + */ + if(sscanf(line, "%d %d %d %d", &w, &h, &ncolors, &cpp) != 4 + || w <= 0 || h <= 0 || ncolors <= 0 || cpp <= 0) { + error = "Invalid format description"; + goto done; + } + + keystrings = malloc(ncolors * cpp); + if(!keystrings) { + error = "Out of memory"; + goto done; + } + nextkey = keystrings; + + /* Create the new surface */ + if(ncolors <= 256) { + indexed = 1; + image = SDL_CreateRGBSurface(SDL_SWSURFACE, w, h, 8, + 0, 0, 0, 0); + im_colors = image->format->palette->colors; + image->format->palette->ncolors = ncolors; + } else { + indexed = 0; + image = SDL_CreateRGBSurface(SDL_SWSURFACE, w, h, 32, + 0xff0000, 0x00ff00, 0x0000ff, 0); + } + if(!image) { + /* Hmm, some SDL error (out of memory?) */ + goto done; + } + + /* Read the colors */ + colors = create_colorhash(ncolors); + if (!colors) { + error = "Out of memory"; + goto done; + } + for(index = 0; index < ncolors; ++index ) { + char *p; + line = get_next_line(xpmlines, src, 0); + if(!line) + goto done; + + p = line + cpp + 1; + + /* parse a colour definition */ + for(;;) { + char nametype; + char *colname; + Uint32 rgb, pixel; + + SKIPSPACE(p); + if(!*p) { + error = "colour parse error"; + goto done; + } + nametype = *p; + SKIPNONSPACE(p); + SKIPSPACE(p); + colname = p; + SKIPNONSPACE(p); + if(nametype == 's') + continue; /* skip symbolic colour names */ + + if(!color_to_rgb(colname, p - colname, &rgb)) + continue; + + memcpy(nextkey, line, cpp); + if(indexed) { + SDL_Color *c = im_colors + index; + c->r = (Uint8)(rgb >> 16); + c->g = (Uint8)(rgb >> 8); + c->b = (Uint8)(rgb); + pixel = index; + } else + pixel = rgb; + add_colorhash(colors, nextkey, cpp, pixel); + nextkey += cpp; + if(rgb == 0xffffffff) + SDL_SetColorKey(image, SDL_SRCCOLORKEY, pixel); + break; + } + } + + /* Read the pixels */ + pixels_len = w * cpp; + dst = image->pixels; + for(y = 0; y < h; y++) { + line = get_next_line(xpmlines, src, pixels_len); + if(indexed) { + /* optimization for some common cases */ + if(cpp == 1) + for(x = 0; x < w; x++) + dst[x] = (Uint8)QUICK_COLORHASH(colors, + line + x); + else + for(x = 0; x < w; x++) + dst[x] = (Uint8)get_colorhash(colors, + line + x * cpp, + cpp); + } else { + for (x = 0; x < w; x++) + ((Uint32*)dst)[x] = get_colorhash(colors, + line + x * cpp, + cpp); + } + dst += image->pitch; + } + +done: + if(error) { + if ( src ) + SDL_RWseek(src, start, RW_SEEK_SET); + if ( image ) { + SDL_FreeSurface(image); + image = NULL; + } + IMG_SetError(error); + } + free(keystrings); + free_colorhash(colors); + free(linebuf); + return(image); +} + +/* Load a XPM type image from an RWops datasource */ +SDL_Surface *IMG_LoadXPM_RW(SDL_RWops *src) +{ + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + return load_xpm(NULL, src); +} + +SDL_Surface *IMG_ReadXPMFromArray(char **xpm) +{ + return load_xpm(xpm, NULL); +} + +#else /* not LOAD_XPM */ + +/* See if an image is contained in a data source */ +int IMG_isXPM(SDL_RWops *src) +{ + return(0); +} + + +/* Load a XPM type image from an SDL datasource */ +SDL_Surface *IMG_LoadXPM_RW(SDL_RWops *src) +{ + return(NULL); +} + +SDL_Surface *IMG_ReadXPMFromArray(char **xpm) +{ + return NULL; +} +#endif /* not LOAD_XPM */ diff --git a/apps/plugins/sdl/SDL_image/IMG_xv.c b/apps/plugins/sdl/SDL_image/IMG_xv.c new file mode 100644 index 0000000..0383ec9 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_xv.c @@ -0,0 +1,165 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This is a XV thumbnail image file loading framework */ + +#include +#include + +#include "SDL_image.h" + +#ifdef LOAD_XV + +static int get_line(SDL_RWops *src, char *line, int size) +{ + while ( size > 0 ) { + if ( SDL_RWread(src, line, 1, 1) <= 0 ) { + return -1; + } + if ( *line == '\r' ) { + continue; + } + if ( *line == '\n' ) { + *line = '\0'; + return 0; + } + ++line; + --size; + } + /* Out of space for the line */ + return -1; +} + +static int get_header(SDL_RWops *src, int *w, int *h) +{ + char line[1024]; + + *w = 0; + *h = 0; + + /* Check the header magic */ + if ( (get_line(src, line, sizeof(line)) < 0) || + (memcmp(line, "P7 332", 6) != 0) ) { + return -1; + } + + /* Read the header */ + while ( get_line(src, line, sizeof(line)) == 0 ) { + if ( memcmp(line, "#BUILTIN:", 9) == 0 ) { + /* Builtin image, no data */ + break; + } + if ( memcmp(line, "#END_OF_COMMENTS", 16) == 0 ) { + if ( get_line(src, line, sizeof(line)) == 0 ) { + sscanf(line, "%d %d", w, h); + if ( *w >= 0 && *h >= 0 ) { + return 0; + } + } + break; + } + } + /* No image data */ + return -1; +} + +/* See if an image is contained in a data source */ +int IMG_isXV(SDL_RWops *src) +{ + int start; + int is_XV; + int w, h; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_XV = 0; + if ( get_header(src, &w, &h) == 0 ) { + is_XV = 1; + } + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_XV); +} + +/* Load a XV thumbnail image from an SDL datasource */ +SDL_Surface *IMG_LoadXV_RW(SDL_RWops *src) +{ + int start; + const char *error = NULL; + SDL_Surface *surface = NULL; + int w, h; + Uint8 *pixels; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + /* Read the header */ + if ( get_header(src, &w, &h) < 0 ) { + error = "Unsupported image format"; + goto done; + } + + /* Create the 3-3-2 indexed palette surface */ + surface = SDL_CreateRGBSurface(SDL_SWSURFACE, w, h, 8, 0xe0, 0x1c, 0x03, 0); + if ( surface == NULL ) { + error = "Out of memory"; + goto done; + } + + /* Load the image data */ + for ( pixels = (Uint8 *)surface->pixels; h > 0; --h ) { + if ( SDL_RWread(src, pixels, w, 1) <= 0 ) { + error = "Couldn't read image data"; + goto done; + } + pixels += surface->pitch; + } + +done: + if ( error ) { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + surface = NULL; + } + IMG_SetError(error); + } + return surface; +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isXV(SDL_RWops *src) +{ + return(0); +} + +/* Load a XXX type image from an SDL datasource */ +SDL_Surface *IMG_LoadXV_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_XV */ diff --git a/apps/plugins/sdl/SDL_image/IMG_xxx.c b/apps/plugins/sdl/SDL_image/IMG_xxx.c new file mode 100644 index 0000000..924dd38 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/IMG_xxx.c @@ -0,0 +1,87 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This is a generic "format not supported" image framework */ + +#include + +#include "SDL_image.h" + +#ifdef LOAD_XXX + +/* See if an image is contained in a data source */ +int IMG_isXXX(SDL_RWops *src) +{ + int start; + int is_XXX; + + if ( !src ) + return 0; + start = SDL_RWtell(src); + is_XXX = 0; + + /* Detect the image here */ + + SDL_RWseek(src, start, RW_SEEK_SET); + return(is_XXX); +} + +/* Load a XXX type image from an SDL datasource */ +SDL_Surface *IMG_LoadXXX_RW(SDL_RWops *src) +{ + int start; + const char *error = NULL; + SDL_Surface *surface = NULL; + + if ( !src ) { + /* The error message has been set in SDL_RWFromFile */ + return NULL; + } + start = SDL_RWtell(src); + + /* Load the image here */ + + if ( error ) { + SDL_RWseek(src, start, RW_SEEK_SET); + if ( surface ) { + SDL_FreeSurface(surface); + surface = NULL; + } + IMG_SetError(error); + } + return surface; +} + +#else + +/* See if an image is contained in a data source */ +int IMG_isXXX(SDL_RWops *src) +{ + return(0); +} + +/* Load a XXX type image from an SDL datasource */ +SDL_Surface *IMG_LoadXXX_RW(SDL_RWops *src) +{ + return(NULL); +} + +#endif /* LOAD_XXX */ diff --git a/apps/plugins/sdl/SDL_image/README b/apps/plugins/sdl/SDL_image/README new file mode 100644 index 0000000..c989178 --- /dev/null +++ b/apps/plugins/sdl/SDL_image/README @@ -0,0 +1,40 @@ + +SDL_image 1.2 + +The latest version of this library is available from: +http://www.libsdl.org/projects/SDL_image/ + +This is a simple library to load images of various formats as SDL surfaces. +This library supports BMP, PNM (PPM/PGM/PBM), XPM, LBM, PCX, GIF, JPEG, PNG, +TGA, and TIFF formats. + +API: +#include "SDL_image.h" + + SDL_Surface *IMG_Load(const char *file); +or + SDL_Surface *IMG_Load_RW(SDL_RWops *src, int freesrc); +or + SDL_Surface *IMG_LoadTyped_RW(SDL_RWops *src, int freesrc, char *type); + +where type is a string specifying the format (i.e. "PNG" or "pcx"). +Note that IMG_Load_RW cannot load TGA images. + +To create a surface from an XPM image included in C source, use: + + SDL_Surface *IMG_ReadXPMFromArray(char **xpm); + +An example program 'showimage' is included, with source in showimage.c + +JPEG support requires the JPEG library: http://www.ijg.org/ +PNG support requires the PNG library: http://www.libpng.org/pub/png/libpng.html + and the Zlib library: http://www.gzip.org/zlib/ +TIFF support requires the TIFF library: ftp://ftp.sgi.com/graphics/tiff/ + +If you have these libraries installed in non-standard places, you can +try adding those paths to the configure script, e.g. +sh ./configure CPPFLAGS="-I/somewhere/include" LDFLAGS="-L/somewhere/lib" +If this works, you may need to add /somewhere/lib to your LD_LIBRARY_PATH +so shared library loading works correctly. + +This library is under the zlib License, see the file "COPYING" for details. diff --git a/apps/plugins/sdl/SDL_image/showimage.c b/apps/plugins/sdl/SDL_image/showimage.c new file mode 100644 index 0000000..6f29d7d --- /dev/null +++ b/apps/plugins/sdl/SDL_image/showimage.c @@ -0,0 +1,216 @@ +/* + showimage: A test application for the SDL image loading library. + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#include +#include +#include + +#include "SDL.h" +#include "SDL_image.h" + +/* #define XPM_INCLUDED and supply picture.xpm to test the XPM inclusion + feature */ + +#ifdef XPM_INCLUDED +#include "picture.xpm" +#endif + +/* Draw a Gimpish background pattern to show transparency in the image */ +static void draw_background(SDL_Surface *screen) +{ + Uint8 *dst = screen->pixels; + int x, y; + int bpp = screen->format->BytesPerPixel; + Uint32 col[2]; + col[0] = SDL_MapRGB(screen->format, 0x66, 0x66, 0x66); + col[1] = SDL_MapRGB(screen->format, 0x99, 0x99, 0x99); + for(y = 0; y < screen->h; y++) { + for(x = 0; x < screen->w; x++) { + /* use an 8x8 checkerboard pattern */ + Uint32 c = col[((x ^ y) >> 3) & 1]; + switch(bpp) { + case 1: + dst[x] = (Uint8)c; + break; + case 2: + ((Uint16 *)dst)[x] = (Uint16)c; + break; + case 3: +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + dst[x * 3] = (Uint8)(c); + dst[x * 3 + 1] = (Uint8)(c >> 8); + dst[x * 3 + 2] = (Uint8)(c >> 16); +#else + dst[x * 3] = (Uint8)(c >> 16); + dst[x * 3 + 1] = (Uint8)(c >> 8); + dst[x * 3 + 2] = (Uint8)(c); +#endif + break; + case 4: + ((Uint32 *)dst)[x] = c; + break; + } + } + dst += screen->pitch; + } +} + +int main(int argc, char *argv[]) +{ + Uint32 flags; + SDL_Surface *screen, *image; + int i, depth, done; + SDL_Event event; +#if 0 + SDL_RWops* rw_ops; +#endif + + /* Check command line usage */ + if ( ! argv[1] ) { + fprintf(stderr, "Usage: %s \n", argv[0]); + return(1); + } + + /* Initialize the SDL library */ + if ( SDL_Init(SDL_INIT_VIDEO) < 0 ) { + fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); + return(255); + } + + flags = SDL_SWSURFACE; + for ( i=1; argv[i]; ++i ) { + if ( strcmp(argv[i], "-fullscreen") == 0 ) { + SDL_ShowCursor(0); + flags |= SDL_FULLSCREEN; + continue; + } +#if 0 + rw_ops = SDL_RWFromFile(argv[1], "r"); + + fprintf(stderr, "BMP:\t%d\n", IMG_isBMP(rw_ops)); + fprintf(stderr, "GIF:\t%d\n", IMG_isGIF(rw_ops)); + fprintf(stderr, "JPG:\t%d\n", IMG_isJPG(rw_ops)); + fprintf(stderr, "PNG:\t%d\n", IMG_isPNG(rw_ops)); + fprintf(stderr, "TIF:\t%d\n", IMG_isTIF(rw_ops)); + /* fprintf(stderr, "TGA:\t%d\n", IMG_isTGA(rw_ops)); */ + fprintf(stderr, "PCX:\t%d\n", IMG_isPCX(rw_ops)); +#endif + + /* Open the image file */ +#ifdef XPM_INCLUDED + image = IMG_ReadXPMFromArray(picture_xpm); +#else + image = IMG_Load(argv[i]); +#endif + if ( image == NULL ) { + fprintf(stderr, "Couldn't load %s: %s\n", + argv[i], SDL_GetError()); + continue; + } + SDL_WM_SetCaption(argv[i], "showimage"); + + /* Create a display for the image */ + depth = SDL_VideoModeOK(image->w, image->h, 32, flags); + /* Use the deepest native mode, except that we emulate 32bpp + for viewing non-indexed images on 8bpp screens */ + if ( depth == 0 ) { + if ( image->format->BytesPerPixel > 1 ) { + depth = 32; + } else { + depth = 8; + } + } else + if ( (image->format->BytesPerPixel > 1) && (depth == 8) ) { + depth = 32; + } + if(depth == 8) + flags |= SDL_HWPALETTE; + screen = SDL_SetVideoMode(image->w, image->h, depth, flags); + if ( screen == NULL ) { + fprintf(stderr,"Couldn't set %dx%dx%d video mode: %s\n", + image->w, image->h, depth, SDL_GetError()); + continue; + } + + /* Set the palette, if one exists */ + if ( image->format->palette ) { + SDL_SetColors(screen, image->format->palette->colors, + 0, image->format->palette->ncolors); + } + + /* Draw a background pattern if the surface has transparency */ + if(image->flags & (SDL_SRCALPHA | SDL_SRCCOLORKEY)) + draw_background(screen); + + /* Display the image */ + SDL_BlitSurface(image, NULL, screen, NULL); + SDL_UpdateRect(screen, 0, 0, 0, 0); + + done = 0; + while ( ! done ) { + if ( SDL_PollEvent(&event) ) { + switch (event.type) { + case SDL_KEYUP: + switch (event.key.keysym.sym) { + case SDLK_LEFT: + if ( i > 1 ) { + i -= 2; + done = 1; + } + break; + case SDLK_RIGHT: + if ( argv[i+1] ) { + done = 1; + } + break; + case SDLK_ESCAPE: + case SDLK_q: + argv[i+1] = NULL; + /* Drop through to done */ + case SDLK_SPACE: + case SDLK_TAB: + done = 1; + break; + default: + break; + } + break; + case SDL_MOUSEBUTTONDOWN: + done = 1; + break; + case SDL_QUIT: + argv[i+1] = NULL; + done = 1; + break; + default: + break; + } + } else { + SDL_Delay(10); + } + } + SDL_FreeSurface(image); + } + + /* We're done! */ + SDL_Quit(); + return(0); +} diff --git a/apps/plugins/sdl/SDL_mixer/CHANGES b/apps/plugins/sdl/SDL_mixer/CHANGES new file mode 100644 index 0000000..9eb53f3 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/CHANGES @@ -0,0 +1,348 @@ +1.2.12: +Sam Lantinga - Sat Jan 14 22:00:29 2012 -0500 + * Fixed seek offset with SMPEG (was relative, should be absolute) +Sam Lantinga - Fri Jan 13 03:04:27 EST 2012 + * Fixed memory crash loading Ogg Vorbis files on Windows +Sam Lantinga - Thu Jan 05 22:51:54 2012 -0500 + * Added an Xcode project for iOS +Nikos Chantziaras - 2012-01-02 17:37:36 PST + * Added Mix_LoadMUSType_RW() so you can tell SDL_mixer what type the music is +Sam Lantinga - Sun Jan 01 16:45:58 2012 -0500 + * Fixed looping native MIDI on Mac OS X and Windows +Sam Lantinga - Sun Jan 01 01:00:51 2012 -0500 + * Added /usr/local/share/timidity to the timidity data path +Sam Lantinga - Sat Dec 31 21:26:46 2011 -0500 + * Fixed timidity loading of some MIDI files +Sam Lantinga - Sat Dec 31 19:11:59 EST 2011 + * Fixed dropping audio in the FLAC audio decoding +Sam Lantinga - Sat Dec 31 18:32:05 EST 2011 + * Fixed memory leak in SDL_LoadMUS() +Sam Lantinga - Sat Dec 31 10:22:05 EST 2011 + * Removed GPL native MIDI code for new licensing +Sam Lantinga - Sat Dec 31 10:22:05 EST 2011 + * SDL_mixer is now under the zlib license +Manuel Montezelo - 2011-12-28 11:42:44 PST + * Fixed drums playing on MIDI channel 16 with timidity +Ryan C. Gordon - Wed Jun 15 03:41:31 2011 -0400 + * The music-finished hook can start a track immediately +James Le Cuirot - Mon Mar 21 16:54:11 PDT 2011 + * Added support for FluidSynth +Egor Suvorov - Tue Jan 18 11:06:47 PST 2011 + * Added support for native MIDI on Haiku +Sam Lantinga - Tue Jan 11 01:29:19 2011 -0800 + * Added Android.mk to build on the Android platform +Jon Atkins - Sat Nov 14 13:00:18 PST 2009 + * Added support for libmodplug (disabled by default) + +1.2.11: +Sam Lantinga - Sat Nov 14 12:38:01 PST 2009 + * Fixed initialization error and crashes if MikMod library isn't available +Sam Lantinga - Sat Nov 14 11:22:14 PST 2009 + * Fixed bug loading multiple music files + +1.2.10: +Sam Lantinga - Sun Nov 8 08:34:48 PST 2009 + * Added Mix_Init()/Mix_Quit() to prevent constantly loading and unloading DLLs +Mike Frysinger - 2009-11-05 09:11:43 PST + * Check for fork/vfork on any platform, don't just assume it on UNIX +Jon Atkins - Thu Nov 5 00:02:50 2009 UTC + * Fixed export of Mix_GetNumChunkDecoders() and Mix_GetNumMusicDecoders() +C.W. Betts - 2009-11-02 00:16:21 PST + * Use newer MIDI API on Mac OS X 10.5+ + +1.2.9: +Ryan Gordon - Sun Oct 18 11:42:31 PDT 2009 + * Updated native MIDI support on Mac OS X for 10.6 +Ryan Gordon - Sun Oct 11 05:29:55 2009 UTC + * Reset channel volumes after a fade out interrupts a fade in. +Ryan Gordon - Sun Oct 11 02:59:12 2009 UTC + * Fixed crash race condition with position audio functions +Ryan Gordon - Sat Oct 10 17:05:45 2009 UTC + * Fixed stereo panning in 8-bit mode +Sam Lantinga - Sat Oct 10 11:07:15 2009 UTC + * Added /usr/share/timidity to the default timidity.cfg locations +Sam Lantinga - Sat Oct 3 13:33:36 PDT 2009 + * MOD support uses libmikmod and is dynamically loaded by default + * A patched version of libmikmod is included in libmikmod-3.1.12.zip + * The libmikmod patches fix security issues CVE-2007-6720 and CVE-2009-0179. +Sam Lantinga - Sat Oct 3 02:49:41 PDT 2009 + * Added TIMIDITY_CFG environment variable to fully locate timidity.cfg +Sam Lantinga - Fri Oct 2 07:15:35 PDT 2009 + * Implemented seamless looping for music playback +Forrest Voight - 2009-06-13 20:31:38 PDT + * ID3 files are now recognized as MP3 format +Steven Noonan - 2008-05-13 13:31:36 PDT + * Fixed native MIDI crash on 64-bit Windows +Ryan Gordon - Fri Jun 5 16:07:08 2009 UTC + * Added decoder enumeration API: + Mix_GetNumChunkDecoders(), Mix_GetChunkDecoder(), + Mix_GetNumMusicDecoders(), Mix_GetMusicDecoder() +Austen Dicken - Tue Feb 26 23:28:27 PST 2008 + * Added support for FLAC audio both as chunks and streaming +Tilman Sauerbeck - Tue Feb 26 03:44:47 PST 2008 + * Added support for streaming WAV files with Mix_LoadMUS_RW() +Ryan Gordon - Mon Feb 4 17:10:08 UTC 2008 + * Fixed crash caused by not resetting position_channels + +1.2.8: +Sam Lantinga - Wed Jul 18 09:45:54 PDT 2007 + * Improved detection of Ogg Vorbis and Tremor libraries +Ryan Gordon - Sun Jul 15 12:03:54 EDT 2007 + * Fixed memory leaks in Effects API. +David Rose - Sat Jul 14 22:16:09 PDT 2007 + * Added support for MP3 playback with libmad (for GPL projects only!) +Sam Lantinga - Sat Jul 14 21:39:30 PDT 2007 + * Fixed the final loop of audio samples of a certain size +Sam Lantinga - Sat Jul 14 21:05:09 PDT 2007 + * Fixed opening Ogg Vorbis files using different C runtimes on Windows +Philippe Simons - Sat Jul 14 20:33:17 PDT 2007 + * Added support for Ogg Vorbis playback with Tremor (an integer decoder) +Sam Lantinga - Sat Jul 14 07:02:09 PDT 2007 + * Fixed memory corruption in timidity resampling code +Ryan Gordon - Tue Jul 3 10:44:29 2007 UTC + * Fixed building SDL_mixer with SDL 1.3 pre-release +Ryan Gordon - Tue Feb 13 08:11:54 2007 UTC + * Fixed compiling both timidity and native midi in the same build +Hans de Goede - Sun Aug 20 23:25:46 2006 UTC + * Added volume control to playmus +Jonathan Atkins - Thu Aug 10 15:06:40 2006 UTC + * Fixed linking with system libmikmod +David Ergo - Fri Jun 23 09:07:19 2006 UTC + * Corrected no-op conditions in SetDistance(), SetPanning() and SetPosition() + * Fixed copy/paste errors in channel amplitudes + +1.2.7: +Sam Lantinga - Fri May 12 00:04:32 PDT 2006 + * Added support for dynamically loading SMPEG library +Sam Lantinga - Thu May 11 22:22:43 PDT 2006 + * Added support for dynamically loading Ogg Vorbis library +Sam Lantinga - Sun Apr 30 09:01:44 PDT 2006 + * Removed automake dependency, to allow Universal binaries on Mac OS X + * Added gcc-fat.sh for generating Universal binaries on Mac OS X +Sam Lantinga - Sun Apr 30 01:48:40 PDT 2006 + * Updated libtool support to version 1.5.22 +Patrice Mandin - Sat Jul 16 16:43:24 UTC 2005 + * Use SDL_RWops also for native midi mac and win32 +Patrice Mandin - Sat Jul 9 14:40:09 UTC 2005 + * Use SDL_RWops also for native midi gpl (todo: mac and win32) +Ryan C. Gordon - Sat Jul 9 01:54:03 EDT 2005 + * Tweaked Mix_Chunk's definition to make predeclaration easier. +Patrice Mandin - Mon Jul 4 19:45:40 UTC 2005 + * Search timidity.cfg also in /etc + * Fix memory leaks in timidity player + * Use also SDL_RWops to read midifiles for timidity +Ryan C. Gordon - Mon Jun 13 18:18:12 EDT 2005 + * Patch from Eric Wing to fix native midi compiling on MacOS/x86. +Sam Lantinga - Wed Dec 22 17:14:32 PST 2004 + * Disabled support for the system version of libmikmod by default +Sam Lantinga - Tue Dec 21 09:51:29 PST 2004 + * Fixed building mikmod support on UNIX + * Always build SDL_RWops music support + * Added SDL_RWops support for reading MP3 files + +1.2.6: +Jonathan Atkins - Wed, 15 Sep 2004 23:26:42 -0500 + * Added support for using the system version of libmikmod +Martin_Storsjö - Sun, 22 Aug 2004 02:21:14 +0300 (EEST) + * Added SDL_RWops support for reading Ogg Vorbis files +Greg Lee - Wed, 14 Jul 2004 05:13:14 -1000 + * Added 4 and 6 channel surround sound output support + * Added support for RMID format MIDI files + * Improved timidity support (reverb, chorus, Roland & Yamaha sysex dumps, etc.) +Sam Lantinga - Wed Nov 19 00:23:44 PST 2003 + * Updated libtool support for new mingw32 DLL build process +Ryan C. Gordon - Sun Nov 9 23:34:47 EST 2003 + * Patch from Steven Fuller to fix positioning effect on bigendian systems. +Laurent Ganter - Mon, 6 Oct 2003 11:51:33 +0200 + * Fixed bug with MIDI volume in native Windows playback +Andre Leiradella - Fri, 30 May 2003 16:12:03 -0300 + * Added SDL_RWops support for reading MOD files +Kyle Davenport - Sat, 19 Apr 2003 17:13:31 -0500 + * Added .la files to the development RPM, fixing RPM build on RedHat 8 + +1.2.5: +Darrell Walisser - Tue Mar 4 09:24:01 PST 2003 + * Worked around MacOS X deadlock between CoreAudio and QuickTime +Darrell Walisser - Fri, 14 Feb 2003 20:56:08 -0500 + * Fixed crash in native midi code with files with more than 32 tracks +Marc Le Douarain - Sat, 15 Feb 2003 14:46:41 +0100 + * Added 8SVX format support to the AIFF loader +Sam Lantinga Wed Feb 12 21:03:57 PST 2003 + * Fixed volume control on WAVE music chunks +Ben Nason - Mon, 10 Feb 2003 11:50:27 -0800 + * Fixed volume control on MOD music chunks +Patrice Mandin - Fri, 31 Jan 2003 15:17:30 +0100 + * Added support for the Atari platform +Ryan C. Gordon - Fri Dec 27 10:14:07 EST 2002 + * Patch from Steven Fuller to fix panning effect with 8-bit sounds. +Ryan C. Gordon - Thu Jan 2 12:31:48 EST 2003 + * Patch from guy on 3DRealms forums to fix native win32 midi volume. +Ryan C. Gordon - Wed Oct 30 07:12:06 EST 2002 + * Small, looping music samples should now be able to fade out correctly. +Sam Lantinga - Sun Oct 20 20:52:24 PDT 2002 + * Added shared library support for MacOS X +Pete Shinners - Wed Oct 16 17:10:08 EDT 2002 + * Correctly report an error when using an unknown filetype +Vaclav Slavik - Sun Sep 8 18:57:38 PDT 2002 + * Added support for loading Ogg Vorbis samples as an audio chunk +Martin Storsjö - Tue Jul 16 10:38:12 PDT 2002 + * Fixed to start playing another sample immediately when one finishes +Martin Storsjö - Tue May 28 13:08:29 PDT 2002 + * Fixed a volume bug when calling Mix_HaltChannel() on unused channel +Xavier Wielemans - Wed Jun 12 14:28:14 EDT 2002 + * Fixed volume reset bug at end of channel fade. +Ryan C. Gordon - Wed Jun 26 16:30:59 EDT 2002 + * Mix_LoadMUS() will now accept an MP3 by file extension, instead of relying + entirely on the magic number. + +1.2.4: +Sam Lantinga - Mon May 20 09:11:22 PDT 2002 + * Updated the CodeWarrior project files +Sam Lantinga - Sun May 19 13:46:29 PDT 2002 + * Added a function to query the music format: Mix_GetMusicType() +Sam Lantinga - Sat May 18 12:45:16 PDT 2002 + * Added a function to load audio data from memory: Mix_QuickLoad_RAW() +Sam Lantinga - Thu May 16 11:26:46 PDT 2002 + * Cleaned up threading issues in the music playback code +Ryan Gordon - Thu May 2 21:08:48 PDT 2002 + * Fixed deadlock introduced in the last release + +1.2.3: +Sam Lantinga - Sat Apr 13 07:49:47 PDT 2002 + * Updated autogen.sh for new versions of automake + * Specify the SDL API calling convention (C by default) +Ryan Gordon - Sat Apr 13 07:33:37 PDT 2002 + * Fixed recursive audio lock in the mixing function +jean-julien Filatriau - Sat Mar 23 18:05:37 PST 2002 + * Fixed setting invalid volume when querying mixer and music volumes +Guillaume Cottenceau - Wed Feb 13 15:43:20 PST 2002 + * Implemented Ogg Vorbis stream rewinding +Peter Kutak - Wed Feb 13 10:26:57 PST 2002 + * Added native midi support on Linux, using GPL code + --enable-music-native-midi-gpl +Pete Shinners - Mon Jan 14 11:31:26 PST 2002 + * Added seek support for MP3 files +Ryan Gordon - Mon Jan 14 11:30:44 PST 2002 + * Sample "finished" callbacks are now always called when a sample is stopped. + +1.2.2: +Guillaume Cottenceau - Wed Dec 19 08:59:05 PST 2001 + * Added an API for seeking in music files (implemented for MOD and Ogg music) + Mix_FadeInMusicPos(), Mix_SetMusicPosition() + * Exposed the mikmod synchro value for music synchronization + Mix_SetSynchroValue(), Mix_GetSynchroValue() + +1.2.1: +Yi-Huang Han - Wed Oct 24 21:55:47 PDT 2001 + * Fixed MOD music volume when looping +David Hedbor - Thu Oct 18 10:01:41 PDT 2001 + * Stop implicit looping, set fade out and other flags on MOD files +Sam Lantinga - Tue Oct 16 11:17:12 PDT 2001 + * The music file type is now determined by extension as well as magic +Ryan C. Gordon - Tue Sep 11 12:05:54 PDT 2001 + * Reworked playwave.c to make it more useful as a mixer testbed + * Added a realtime sound effect API to SDL_mixer.h + * Added the following standard sound effects: + panning, distance attenuation, basic positional audio, stereo reversal + * Added API for mixer versioning: Mix_Linked_Version() and MIX_VERSION() +Sam Lantinga - Tue Sep 11 11:48:53 PDT 2001 + * Updated MikMod code to version 3.1.9a +Torbjörn Andersson - Tue Sep 11 11:22:29 PDT 2001 + * Added support for loading AIFF audio chunks +Max Horn - Tue Sep 4 20:38:11 PDT 2001 + * Added native MIDI music support on MacOS and MacOS X +Florian Schulze - Sun Aug 19 14:55:37 PDT 2001 + * Added native MIDI music support on Windows +Sam Lantinga - Sun Aug 19 02:20:55 PDT 2001 + * Added Project Builder projects for building MacOS X framework +Darrell Walisser - Sun Aug 19 00:47:22 PDT 2001 + * Fixed compilation problems with mikmod under MacOS X +Torbjörn Andersson - Sun, 19 Aug 2001 16:03:30 + * Fixed AIFF music playing support +Sam Lantinga - Sat Aug 18 04:14:13 PDT 2001 + * Fixed building Ogg Vorbis support on Windows +Ryan C. Gordon - Thu, 7 Jun 2001 13:15:51 + * Added Mix_ChannelFinished() and Mix_GetChunk() +Ryan C. Gordon - Tue, 5 Jun 2001 11:01:51 + * Added VOC sound file support +Guillaume Cottenceau - Thu May 10 11:17:55 PDT 2001 + * Fixed crashes when API used with audio not initialized +Paul Jenner - Sat, 14 Apr 2001 09:20:38 -0700 (PDT) + * Added support for building RPM directly from tar archive + +1.2.0: +Sam Lantinga - Wed Apr 4 12:42:20 PDT 2001 + * Synchronized release version with SDL 1.2.0 + +1.1.1: +John Hall - Tue Jan 2 13:46:54 PST 2001 + * Added support to playmus for track switching with Ctrl-C + * Added support to playmus for multiple command line files + +1.1.0: +Sam Lantinga - Wed Nov 29 20:47:13 PST 2000 + * Package specifically for SDL 1.1 (no real reason API-wise, but for clarity) + +1.0.7: +Sam Lantinga - Tue Nov 7 10:22:09 PST 2000 + * Fixed hang in mikmod re-initialization +Stephane Peter - Oct 17 13:07:32 PST 2000 + * Fixed music fading +Ray Kelm - Fri, 04 Aug 2000 20:58:00 -0400 + * Added support for cross-compiling Windows DLL from Linux + +1.0.6: +Sam Lantinga - Sun Jul 2 14:16:44 PDT 2000 + * Added support for the Ogg Vorbis music format: http://www.vorbis.org/ +Darrell Walisser - Wed Jun 28 11:59:40 PDT 2000 + * Added Codewarrior projects for MacOS +Sam Lantinga - Mon Jun 26 12:01:11 PDT 2000 + * Fixed symbol aliasing problem with "channel" +Matt - Wed, 12 Apr 2000 15:36:13 -0700 + * Added SDL_RWops support for mikmod loading (not hooked into music.c yet) + +1.0.5: +Paul Furber - Fri Mar 3 14:58:50 PST 2000 + * Fixed MP3 detection with compilers that use signed char datatypes + +1.0.4: +Sam Lantinga - Thu Feb 10 19:42:03 PST 2000 + * Ported the base mixer and mikmod libraries to MacOS +Markus Oberhumer - Wed Feb 2 13:16:17 PST 2000 + * Fixed problem with short looping sounds +Sam Lantinga - Tue Feb 1 13:25:44 PST 2000 + * Added Visual C++ project file +Markus Oberhumer - Tue Feb 1 13:23:11 PST 2000 + * Cleaned up code for compiling with Visual C++ + * Don't hang in Mix_HaltMusic() if the music is paused +Sam Lantinga - Fri Jan 28 08:54:56 PST 2000 + * Fixed looping WAVE chunks that are not aligned on sample boundaries + +1.0.3: +Sam Lantinga - Mon Jan 17 19:48:09 PST 2000 + * Changed the name of the library from "mixer" to "SDL_mixer" + * Instead of including "mixer.h", include "SDL_mixer.h", + * Instead of linking with libmixer.a, link with libSDL_mixer.a + +1.0.2: +Sam Lantinga - Fri Jan 14 11:06:56 PST 2000 + * Made the CHANGELOG entries Y2K compliant. :) +MFX - Updated the mikmod support to MikMod 3.1.8 +MFX - Added Mix_HookMusicFinished() API function + +1.0.1: +SOL - Added a post-mixing callback +SP - A few music-related bugfixes + +1.0.0: +SOL - Added autoconf support +SP - Added MP3 support using SMPEG +SP - Added fading in/out of music and samples +SP - Added dynamic allocation of channels +SP - Added channel grouping functions +SP - Added expiration delay for samples + +Initial Key: +SOL - Sam Lantinga (hercules@lokigames.com) +SP - Stephane Peter (megastep@lokigames.com) +MFX - Markus Oberhumer (markus.oberhumer@jk.uni-linz.ac.at) diff --git a/apps/plugins/sdl/SDL_mixer/COPYING b/apps/plugins/sdl/SDL_mixer/COPYING new file mode 100644 index 0000000..dce4d17 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/COPYING @@ -0,0 +1,20 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ diff --git a/apps/plugins/sdl/SDL_mixer/Makefile.in b/apps/plugins/sdl/SDL_mixer/Makefile.in new file mode 100644 index 0000000..3d10565 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/Makefile.in @@ -0,0 +1,133 @@ +# Makefile to build and install the SDL_mixer library + +top_builddir = . +srcdir = @srcdir@ +objects = build +prefix = @prefix@ +exec_prefix = @exec_prefix@ +bindir = $(DESTDIR)@bindir@ +libdir = $(DESTDIR)@libdir@ +includedir = $(DESTDIR)@includedir@ +datarootdir = $(DESTDIR)@datarootdir@ +datadir = @datadir@ +mandir = @mandir@ +auxdir = @ac_aux_dir@ +distpath = $(srcdir)/.. +distdir = SDL_mixer-@VERSION@ +distfile = $(distdir).tar.gz + +@SET_MAKE@ +EXE = @EXE@ +SHELL = @SHELL@ +CC = @CC@ +CXX = g++ +CFLAGS = @BUILD_CFLAGS@ +EXTRA_CFLAGS = @EXTRA_CFLAGS@ +LDFLAGS = @BUILD_LDFLAGS@ +EXTRA_LDFLAGS = @EXTRA_LDFLAGS@ +LIBTOOL = @LIBTOOL@ +INSTALL = @INSTALL@ +AR = @AR@ +RANLIB = @RANLIB@ +WINDRES = @WINDRES@ +SDL_CFLAGS = @SDL_CFLAGS@ +SDL_LIBS = @SDL_LIBS@ + +TARGET = libSDL_mixer.la +OBJECTS = @OBJECTS@ +VERSION_OBJECTS = @VERSION_OBJECTS@ +PLAYWAVE_OBJECTS = @PLAYWAVE_OBJECTS@ +PLAYMUS_OBJECTS = @PLAYMUS_OBJECTS@ + +DIST = Android.mk CHANGES COPYING CWProjects.sea.bin MPWmake.sea.bin Makefile.in SDL_mixer.pc.in README SDL_mixer.h SDL_mixer.qpg.in SDL_mixer.spec SDL_mixer.spec.in VisualC Watcom-OS2.zip Xcode Xcode-iOS acinclude autogen.sh build-scripts configure configure.in dynamic_flac.c dynamic_flac.h dynamic_fluidsynth.c dynamic_fluidsynth.h dynamic_mod.c dynamic_mod.h dynamic_mp3.c dynamic_mp3.h dynamic_ogg.c dynamic_ogg.h effect_position.c effect_stereoreverse.c effects_internal.c effects_internal.h fluidsynth.c fluidsynth.h gcc-fat.sh libmikmod-3.1.12.zip load_aiff.c load_aiff.h load_flac.c load_flac.h load_ogg.c load_ogg.h load_voc.c load_voc.h mixer.c music.c music_cmd.c music_cmd.h music_flac.c music_flac.h music_mad.c music_mad.h music_mod.c music_mod.h music_modplug.c music_modplug.h music_ogg.c music_ogg.h native_midi playmus.c playwave.c timidity wavestream.c wavestream.h version.rc + +LT_AGE = @LT_AGE@ +LT_CURRENT = @LT_CURRENT@ +LT_RELEASE = @LT_RELEASE@ +LT_REVISION = @LT_REVISION@ +LT_LDFLAGS = -no-undefined -rpath $(libdir) -release $(LT_RELEASE) -version-info $(LT_CURRENT):$(LT_REVISION):$(LT_AGE) + +all: $(srcdir)/configure Makefile $(objects) $(objects)/$(TARGET) $(objects)/playwave$(EXE) $(objects)/playmus$(EXE) + +$(srcdir)/configure: $(srcdir)/configure.in + @echo "Warning, configure.in is out of date" + #(cd $(srcdir) && sh autogen.sh && sh configure) + @sleep 3 + +Makefile: $(srcdir)/Makefile.in + $(SHELL) config.status $@ + +$(objects): + $(SHELL) $(auxdir)/mkinstalldirs $@ + +.PHONY: all install install-hdrs install-lib install-bin uninstall uninstall-hdrs uninstall-lib uninstall-bin clean distclean dist + +$(objects)/$(TARGET): $(OBJECTS) $(VERSION_OBJECTS) + $(LIBTOOL) --mode=link $(CC) -o $@ $(OBJECTS) $(VERSION_OBJECTS) $(LDFLAGS) $(EXTRA_LDFLAGS) $(LT_LDFLAGS) + +$(objects)/playwave$(EXE): $(objects)/playwave.lo $(objects)/$(TARGET) + $(LIBTOOL) --mode=link $(CC) -o $@ $(objects)/playwave.lo $(SDL_CFLAGS) $(SDL_LIBS) $(objects)/$(TARGET) + +$(objects)/playmus$(EXE): $(objects)/playmus.lo $(objects)/$(TARGET) + $(LIBTOOL) --mode=link $(CC) -o $@ $(objects)/playmus.lo $(SDL_CFLAGS) $(SDL_LIBS) $(objects)/$(TARGET) + +install: all install-hdrs install-lib #install-bin +install-hdrs: + $(SHELL) $(auxdir)/mkinstalldirs $(includedir)/SDL + for src in $(srcdir)/SDL_mixer.h; do \ + file=`echo $$src | sed -e 's|^.*/||'`; \ + $(INSTALL) -m 644 $$src $(includedir)/SDL/$$file; \ + done + $(SHELL) $(auxdir)/mkinstalldirs $(libdir)/pkgconfig + $(INSTALL) -m 644 SDL_mixer.pc $(libdir)/pkgconfig/ +install-lib: $(objects) $(objects)/$(TARGET) + $(SHELL) $(auxdir)/mkinstalldirs $(libdir) + $(LIBTOOL) --mode=install $(INSTALL) $(objects)/$(TARGET) $(libdir)/$(TARGET) +install-bin: + $(SHELL) $(auxdir)/mkinstalldirs $(bindir) + $(LIBTOOL) --mode=install $(INSTALL) -m 755 $(objects)/playwave$(EXE) $(bindir)/playwave$(EXE) + $(LIBTOOL) --mode=install $(INSTALL) -m 755 $(objects)/playmus$(EXE) $(bindir)/playmus$(EXE) + +uninstall: uninstall-hdrs uninstall-lib uninstall-bin +uninstall-hdrs: + for src in $(srcdir)/SDL_mixer.h; do \ + file=`echo $$src | sed -e 's|^.*/||'`; \ + rm -f $(includedir)/SDL/$$file; \ + done + -rmdir $(includedir)/SDL + rm -f $(libdir)/pkgconfig/SDL_mixer.pc + -rmdir $(libdir)/pkgconfig +uninstall-lib: + $(LIBTOOL) --mode=uninstall rm -f $(libdir)/$(TARGET) +uninstall-bin: + rm -f $(bindir)/playwave$(EXE) + rm -f $(bindir)/playmus$(EXE) + +clean: + rm -rf $(objects) + +distclean: clean + rm -f Makefile + rm -f SDL_mixer.qpg + rm -f config.status config.cache config.log libtool + rm -f SDL_mixer.pc + rm -rf $(srcdir)/autom4te* + find $(srcdir) \( \ + -name '*~' -o \ + -name '*.bak' -o \ + -name '*.old' -o \ + -name '*.rej' -o \ + -name '*.orig' -o \ + -name '.#*' \) \ + -exec rm -f {} \; + +dist $(distfile): + $(SHELL) $(auxdir)/mkinstalldirs $(distdir) + tar cf - $(DIST) | (cd $(distdir); tar xf -) + rm -rf `find $(distdir) -name .svn` + rm -f `find $(distdir) -name '.#*'` + tar cvf - $(distdir) | gzip --best >$(distfile) + rm -rf $(distdir) + +rpm: $(distfile) + rpmbuild -ta $? diff --git a/apps/plugins/sdl/SDL_mixer/README b/apps/plugins/sdl/SDL_mixer/README new file mode 100644 index 0000000..b17cfe6 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/README @@ -0,0 +1,43 @@ + +SDL_mixer 1.2 + +The latest version of this library is available from: +http://www.libsdl.org/projects/SDL_mixer/ + +Due to popular demand, here is a simple multi-channel audio mixer. +It supports 8 channels of 16 bit stereo audio, plus a single channel +of music, mixed by the popular MikMod MOD, Timidity MIDI and SMPEG MP3 +libraries. + +See the header file SDL_mixer.h and the examples playwave.c and playmus.c +for documentation on this mixer library. + +The mixer can currently load Microsoft WAVE files and Creative Labs VOC +files as audio samples, and can load MIDI files via Timidity and the +following music formats via MikMod: .MOD .S3M .IT .XM. It can load +Ogg Vorbis streams as music if built with Ogg Vorbis or Tremor libraries, +and finally it can load MP3 music using the SMPEG or libmad libraries. + +Tremor decoding is disabled by default; you can enable it by passing + --enable-music-ogg-tremor +to configure, or by defining OGG_MUSIC and OGG_USE_TREMOR. + +libmad decoding is disabled by default; you can enable it by passing + --enable-music-mp3-mad +to configure, or by defining MP3_MAD_MUSIC +vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvv +WARNING: The license for libmad is GPL, which means that in order to + use it your application must also be GPL! +^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ + +The process of mixing MIDI files to wave output is very CPU intensive, +so if playing regular WAVE files sound great, but playing MIDI files +sound choppy, try using 8-bit audio, mono audio, or lower frequencies. + +To play MIDI files, you'll need to get a complete set of GUS patches +from: +http://www.libsdl.org/projects/mixer/timidity/timidity.tar.gz +and unpack them in /usr/local/lib under UNIX, and C:\ under Win32. + +This library is under the zlib license, see the file "COPYING" for details. + diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_flac.c b/apps/plugins/sdl/SDL_mixer/dynamic_flac.c new file mode 100644 index 0000000..59421fd --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_flac.c @@ -0,0 +1,177 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + Implementation of the dynamic loading functionality for libFLAC. + ~ Austen Dicken (admin@cvpcs.org) +*/ + +#ifdef FLAC_MUSIC + +#include "SDL_loadso.h" + +#include "dynamic_flac.h" + +flac_loader flac = { + 0, NULL +}; + +#ifdef FLAC_DYNAMIC +int Mix_InitFLAC() +{ + if ( flac.loaded == 0 ) { + flac.handle = SDL_LoadObject(FLAC_DYNAMIC); + if ( flac.handle == NULL ) { + return -1; + } + flac.FLAC__stream_decoder_new = + (FLAC__StreamDecoder *(*)()) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_new"); + if ( flac.FLAC__stream_decoder_new == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_delete = + (void (*)(FLAC__StreamDecoder *)) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_delete"); + if ( flac.FLAC__stream_decoder_delete == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_init_stream = + (FLAC__StreamDecoderInitStatus (*)( + FLAC__StreamDecoder *, + FLAC__StreamDecoderReadCallback, + FLAC__StreamDecoderSeekCallback, + FLAC__StreamDecoderTellCallback, + FLAC__StreamDecoderLengthCallback, + FLAC__StreamDecoderEofCallback, + FLAC__StreamDecoderWriteCallback, + FLAC__StreamDecoderMetadataCallback, + FLAC__StreamDecoderErrorCallback, + void *)) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_init_stream"); + if ( flac.FLAC__stream_decoder_init_stream == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_finish = + (FLAC__bool (*)(FLAC__StreamDecoder *)) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_finish"); + if ( flac.FLAC__stream_decoder_finish == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_flush = + (FLAC__bool (*)(FLAC__StreamDecoder *)) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_flush"); + if ( flac.FLAC__stream_decoder_flush == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_process_single = + (FLAC__bool (*)(FLAC__StreamDecoder *)) + SDL_LoadFunction(flac.handle, + "FLAC__stream_decoder_process_single"); + if ( flac.FLAC__stream_decoder_process_single == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_process_until_end_of_metadata = + (FLAC__bool (*)(FLAC__StreamDecoder *)) + SDL_LoadFunction(flac.handle, + "FLAC__stream_decoder_process_until_end_of_metadata"); + if ( flac.FLAC__stream_decoder_process_until_end_of_metadata == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_process_until_end_of_stream = + (FLAC__bool (*)(FLAC__StreamDecoder *)) + SDL_LoadFunction(flac.handle, + "FLAC__stream_decoder_process_until_end_of_stream"); + if ( flac.FLAC__stream_decoder_process_until_end_of_stream == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_seek_absolute = + (FLAC__bool (*)(FLAC__StreamDecoder *, FLAC__uint64)) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_seek_absolute"); + if ( flac.FLAC__stream_decoder_seek_absolute == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + flac.FLAC__stream_decoder_get_state = + (FLAC__StreamDecoderState (*)(const FLAC__StreamDecoder *decoder)) + SDL_LoadFunction(flac.handle, "FLAC__stream_decoder_get_state"); + if ( flac.FLAC__stream_decoder_get_state == NULL ) { + SDL_UnloadObject(flac.handle); + return -1; + } + } + ++flac.loaded; + + return 0; +} +void Mix_QuitFLAC() +{ + if ( flac.loaded == 0 ) { + return; + } + if ( flac.loaded == 1 ) { + SDL_UnloadObject(flac.handle); + } + --flac.loaded; +} +#else +int Mix_InitFLAC() +{ + if ( flac.loaded == 0 ) { + flac.FLAC__stream_decoder_new = FLAC__stream_decoder_new; + flac.FLAC__stream_decoder_delete = FLAC__stream_decoder_delete; + flac.FLAC__stream_decoder_init_stream = + FLAC__stream_decoder_init_stream; + flac.FLAC__stream_decoder_finish = FLAC__stream_decoder_finish; + flac.FLAC__stream_decoder_flush = FLAC__stream_decoder_flush; + flac.FLAC__stream_decoder_process_single = + FLAC__stream_decoder_process_single; + flac.FLAC__stream_decoder_process_until_end_of_metadata = + FLAC__stream_decoder_process_until_end_of_metadata; + flac.FLAC__stream_decoder_process_until_end_of_stream = + FLAC__stream_decoder_process_until_end_of_stream; + flac.FLAC__stream_decoder_seek_absolute = + FLAC__stream_decoder_seek_absolute; + flac.FLAC__stream_decoder_get_state = + FLAC__stream_decoder_get_state; + } + ++flac.loaded; + + return 0; +} +void Mix_QuitFLAC() +{ + if ( flac.loaded == 0 ) { + return; + } + if ( flac.loaded == 1 ) { + } + --flac.loaded; +} +#endif /* FLAC_DYNAMIC */ + +#endif /* FLAC_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_flac.h b/apps/plugins/sdl/SDL_mixer/dynamic_flac.h new file mode 100644 index 0000000..e2dd3f7 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_flac.h @@ -0,0 +1,66 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + The following file defines all of the functions/objects used to dynamically + link to the libFLAC library. + ~ Austen Dicken (admin@cvpcs.org) +*/ + +#ifdef FLAC_MUSIC + +#include + +typedef struct { + int loaded; + void *handle; + FLAC__StreamDecoder *(*FLAC__stream_decoder_new)(); + void (*FLAC__stream_decoder_delete)(FLAC__StreamDecoder *decoder); + FLAC__StreamDecoderInitStatus (*FLAC__stream_decoder_init_stream)( + FLAC__StreamDecoder *decoder, + FLAC__StreamDecoderReadCallback read_callback, + FLAC__StreamDecoderSeekCallback seek_callback, + FLAC__StreamDecoderTellCallback tell_callback, + FLAC__StreamDecoderLengthCallback length_callback, + FLAC__StreamDecoderEofCallback eof_callback, + FLAC__StreamDecoderWriteCallback write_callback, + FLAC__StreamDecoderMetadataCallback metadata_callback, + FLAC__StreamDecoderErrorCallback error_callback, + void *client_data); + FLAC__bool (*FLAC__stream_decoder_finish)(FLAC__StreamDecoder *decoder); + FLAC__bool (*FLAC__stream_decoder_flush)(FLAC__StreamDecoder *decoder); + FLAC__bool (*FLAC__stream_decoder_process_single)( + FLAC__StreamDecoder *decoder); + FLAC__bool (*FLAC__stream_decoder_process_until_end_of_metadata)( + FLAC__StreamDecoder *decoder); + FLAC__bool (*FLAC__stream_decoder_process_until_end_of_stream)( + FLAC__StreamDecoder *decoder); + FLAC__bool (*FLAC__stream_decoder_seek_absolute)( + FLAC__StreamDecoder *decoder, + FLAC__uint64 sample); + FLAC__StreamDecoderState (*FLAC__stream_decoder_get_state)( + const FLAC__StreamDecoder *decoder); +} flac_loader; + +extern flac_loader flac; + +#endif /* FLAC_MUSIC */ + +extern int Mix_InitFLAC(); +extern void Mix_QuitFLAC(); diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.c b/apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.c new file mode 100644 index 0000000..73c687f --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.c @@ -0,0 +1,87 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + James Le Cuirot + chewi@aura-online.co.uk +*/ + +#ifdef USE_FLUIDSYNTH_MIDI + +#include "SDL_loadso.h" +#include "dynamic_fluidsynth.h" + +fluidsynth_loader fluidsynth = { + 0, NULL +}; + +#ifdef FLUIDSYNTH_DYNAMIC +#define FLUIDSYNTH_LOADER(FUNC, SIG) \ + fluidsynth.FUNC = (SIG) SDL_LoadFunction(fluidsynth.handle, #FUNC); \ + if (fluidsynth.FUNC == NULL) { SDL_UnloadObject(fluidsynth.handle); return -1; } +#else +#define FLUIDSYNTH_LOADER(FUNC, SIG) \ + fluidsynth.FUNC = FUNC; +#endif + +int Mix_InitFluidSynth() +{ + if ( fluidsynth.loaded == 0 ) { +#ifdef FLUIDSYNTH_DYNAMIC + fluidsynth.handle = SDL_LoadObject(FLUIDSYNTH_DYNAMIC); + if ( fluidsynth.handle == NULL ) return -1; +#endif + + FLUIDSYNTH_LOADER(delete_fluid_player, int (*)(fluid_player_t*)); + FLUIDSYNTH_LOADER(delete_fluid_settings, void (*)(fluid_settings_t*)); + FLUIDSYNTH_LOADER(delete_fluid_synth, int (*)(fluid_synth_t*)); + FLUIDSYNTH_LOADER(fluid_player_add, int (*)(fluid_player_t*, const char*)); + FLUIDSYNTH_LOADER(fluid_player_add_mem, int (*)(fluid_player_t*, const void*, size_t)); + FLUIDSYNTH_LOADER(fluid_player_get_status, int (*)(fluid_player_t*)); + FLUIDSYNTH_LOADER(fluid_player_play, int (*)(fluid_player_t*)); + FLUIDSYNTH_LOADER(fluid_player_set_loop, int (*)(fluid_player_t*, int)); + FLUIDSYNTH_LOADER(fluid_player_stop, int (*)(fluid_player_t*)); + FLUIDSYNTH_LOADER(fluid_settings_setnum, int (*)(fluid_settings_t*, const char*, double)); + FLUIDSYNTH_LOADER(fluid_synth_get_settings, fluid_settings_t* (*)(fluid_synth_t*)); + FLUIDSYNTH_LOADER(fluid_synth_set_gain, void (*)(fluid_synth_t*, float)); + FLUIDSYNTH_LOADER(fluid_synth_sfload, int(*)(fluid_synth_t*, const char*, int)); + FLUIDSYNTH_LOADER(fluid_synth_write_s16, int(*)(fluid_synth_t*, int, void*, int, int, void*, int, int)); + FLUIDSYNTH_LOADER(new_fluid_player, fluid_player_t* (*)(fluid_synth_t*)); + FLUIDSYNTH_LOADER(new_fluid_settings, fluid_settings_t* (*)(void)); + FLUIDSYNTH_LOADER(new_fluid_synth, fluid_synth_t* (*)(fluid_settings_t*)); + } + ++fluidsynth.loaded; + + return 0; +} + +void Mix_QuitFluidSynth() +{ + if ( fluidsynth.loaded == 0 ) { + return; + } + if ( fluidsynth.loaded == 1 ) { +#ifdef FLUIDSYNTH_DYNAMIC + SDL_UnloadObject(fluidsynth.handle); +#endif + } + --fluidsynth.loaded; +} + +#endif /* USE_FLUIDSYNTH_MIDI */ diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.h b/apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.h new file mode 100644 index 0000000..5d25232 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_fluidsynth.h @@ -0,0 +1,57 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + James Le Cuirot + chewi@aura-online.co.uk +*/ + +#ifdef USE_FLUIDSYNTH_MIDI + +#include + +typedef struct { + int loaded; + void *handle; + + int (*delete_fluid_player)(fluid_player_t*); + void (*delete_fluid_settings)(fluid_settings_t*); + int (*delete_fluid_synth)(fluid_synth_t*); + int (*fluid_player_add)(fluid_player_t*, const char*); + int (*fluid_player_add_mem)(fluid_player_t*, const void*, size_t); + int (*fluid_player_get_status)(fluid_player_t*); + int (*fluid_player_play)(fluid_player_t*); + int (*fluid_player_set_loop)(fluid_player_t*, int); + int (*fluid_player_stop)(fluid_player_t*); + int (*fluid_settings_setnum)(fluid_settings_t*, const char*, double); + fluid_settings_t* (*fluid_synth_get_settings)(fluid_synth_t*); + void (*fluid_synth_set_gain)(fluid_synth_t*, float); + int (*fluid_synth_sfload)(fluid_synth_t*, const char*, int); + int (*fluid_synth_write_s16)(fluid_synth_t*, int, void*, int, int, void*, int, int); + fluid_player_t* (*new_fluid_player)(fluid_synth_t*); + fluid_settings_t* (*new_fluid_settings)(void); + fluid_synth_t* (*new_fluid_synth)(fluid_settings_t*); +} fluidsynth_loader; + +extern fluidsynth_loader fluidsynth; + +#endif /* USE_FLUIDSYNTH_MIDI */ + +extern int Mix_InitFluidSynth(); +extern void Mix_QuitFluidSynth(); diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_mod.c b/apps/plugins/sdl/SDL_mixer/dynamic_mod.c new file mode 100644 index 0000000..7e3cd0a --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_mod.c @@ -0,0 +1,275 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef MOD_MUSIC + +#include "SDL_loadso.h" + +#include "dynamic_mod.h" + +mikmod_loader mikmod = { + 0, NULL +}; + +#ifdef MOD_DYNAMIC +int Mix_InitMOD() +{ + if ( mikmod.loaded == 0 ) { + mikmod.handle = SDL_LoadObject(MOD_DYNAMIC); + if ( mikmod.handle == NULL ) { + return -1; + } + mikmod.MikMod_Exit = + (void (*)(void)) + SDL_LoadFunction(mikmod.handle, "MikMod_Exit"); + if ( mikmod.MikMod_Exit == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_InfoDriver = + (CHAR* (*)(void)) + SDL_LoadFunction(mikmod.handle, "MikMod_InfoDriver"); + if ( mikmod.MikMod_InfoDriver == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_InfoLoader = + (CHAR* (*)(void)) + SDL_LoadFunction(mikmod.handle, "MikMod_InfoLoader"); + if ( mikmod.MikMod_InfoLoader == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_Init = + (BOOL (*)(CHAR*)) + SDL_LoadFunction(mikmod.handle, "MikMod_Init"); + if ( mikmod.MikMod_Init == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_RegisterAllLoaders = + (void (*)(void)) + SDL_LoadFunction(mikmod.handle, "MikMod_RegisterAllLoaders"); + if ( mikmod.MikMod_RegisterAllLoaders == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_RegisterDriver = + (void (*)(struct MDRIVER*)) + SDL_LoadFunction(mikmod.handle, "MikMod_RegisterDriver"); + if ( mikmod.MikMod_RegisterDriver == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_errno = + (int*) + SDL_LoadFunction(mikmod.handle, "MikMod_errno"); + if ( mikmod.MikMod_errno == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.MikMod_strerror = + (char* (*)(int)) + SDL_LoadFunction(mikmod.handle, "MikMod_strerror"); + if ( mikmod.MikMod_strerror == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_Active = + (BOOL (*)(void)) + SDL_LoadFunction(mikmod.handle, "Player_Active"); + if ( mikmod.Player_Active == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_Free = + (void (*)(MODULE*)) + SDL_LoadFunction(mikmod.handle, "Player_Free"); + if ( mikmod.Player_Free == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_LoadGeneric = + (MODULE* (*)(MREADER*,int,BOOL)) + SDL_LoadFunction(mikmod.handle, "Player_LoadGeneric"); + if ( mikmod.Player_LoadGeneric == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_SetPosition = + (void (*)(UWORD)) + SDL_LoadFunction(mikmod.handle, "Player_SetPosition"); + if ( mikmod.Player_SetPosition == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_SetVolume = + (void (*)(SWORD)) + SDL_LoadFunction(mikmod.handle, "Player_SetVolume"); + if ( mikmod.Player_SetVolume == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_Start = + (void (*)(MODULE*)) + SDL_LoadFunction(mikmod.handle, "Player_Start"); + if ( mikmod.Player_Start == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.Player_Stop = + (void (*)(void)) + SDL_LoadFunction(mikmod.handle, "Player_Stop"); + if ( mikmod.Player_Stop == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.VC_WriteBytes = + (ULONG (*)(SBYTE*,ULONG)) + SDL_LoadFunction(mikmod.handle, "VC_WriteBytes"); + if ( mikmod.VC_WriteBytes == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.drv_nos = + (MDRIVER*) + SDL_LoadFunction(mikmod.handle, "drv_nos"); + if ( mikmod.drv_nos == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_device = + (UWORD*) + SDL_LoadFunction(mikmod.handle, "md_device"); + if ( mikmod.md_device == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_mixfreq = + (UWORD*) + SDL_LoadFunction(mikmod.handle, "md_mixfreq"); + if ( mikmod.md_mixfreq == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_mode = + (UWORD*) + SDL_LoadFunction(mikmod.handle, "md_mode"); + if ( mikmod.md_mode == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_musicvolume = + (UBYTE*) + SDL_LoadFunction(mikmod.handle, "md_musicvolume"); + if ( mikmod.md_musicvolume == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_pansep = + (UBYTE*) + SDL_LoadFunction(mikmod.handle, "md_pansep"); + if ( mikmod.md_pansep == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_reverb = + (UBYTE*) + SDL_LoadFunction(mikmod.handle, "md_reverb"); + if ( mikmod.md_reverb == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_sndfxvolume = + (UBYTE*) + SDL_LoadFunction(mikmod.handle, "md_sndfxvolume"); + if ( mikmod.md_sndfxvolume == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + mikmod.md_volume = + (UBYTE*) + SDL_LoadFunction(mikmod.handle, "md_volume"); + if ( mikmod.md_volume == NULL ) { + SDL_UnloadObject(mikmod.handle); + return -1; + } + } + ++mikmod.loaded; + + return 0; +} +void Mix_QuitMOD() +{ + if ( mikmod.loaded == 0 ) { + return; + } + if ( mikmod.loaded == 1 ) { + SDL_UnloadObject(mikmod.handle); + } + --mikmod.loaded; +} +#else +int Mix_InitMOD() +{ + if ( mikmod.loaded == 0 ) { + mikmod.MikMod_Exit = MikMod_Exit; + mikmod.MikMod_InfoDriver = MikMod_InfoDriver; + mikmod.MikMod_InfoLoader = MikMod_InfoLoader; + mikmod.MikMod_Init = MikMod_Init; + mikmod.MikMod_RegisterAllLoaders = MikMod_RegisterAllLoaders; + mikmod.MikMod_RegisterDriver = MikMod_RegisterDriver; + mikmod.MikMod_errno = &MikMod_errno; + mikmod.MikMod_strerror = MikMod_strerror; + mikmod.Player_Active = Player_Active; + mikmod.Player_Free = Player_Free; + mikmod.Player_LoadGeneric = Player_LoadGeneric; + mikmod.Player_SetPosition = Player_SetPosition; + mikmod.Player_SetVolume = Player_SetVolume; + mikmod.Player_Start = Player_Start; + mikmod.Player_Stop = Player_Stop; + mikmod.VC_WriteBytes = VC_WriteBytes; + mikmod.drv_nos = &drv_nos; + mikmod.md_device = &md_device; + mikmod.md_mixfreq = &md_mixfreq; + mikmod.md_mode = &md_mode; + mikmod.md_musicvolume = &md_musicvolume; + mikmod.md_pansep = &md_pansep; + mikmod.md_reverb = &md_reverb; + mikmod.md_sndfxvolume = &md_sndfxvolume; + mikmod.md_volume = &md_volume; + } + ++mikmod.loaded; + + return 0; +} +void Mix_QuitMOD() +{ + if ( mikmod.loaded == 0 ) { + return; + } + if ( mikmod.loaded == 1 ) { + } + --mikmod.loaded; +} +#endif /* MOD_DYNAMIC */ + +#endif /* MOD_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_mod.h b/apps/plugins/sdl/SDL_mixer/dynamic_mod.h new file mode 100644 index 0000000..3561b15 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_mod.h @@ -0,0 +1,62 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef MOD_MUSIC + +#include "mikmod.h" + +typedef struct { + int loaded; + void *handle; + + void (*MikMod_Exit)(void); + CHAR* (*MikMod_InfoDriver)(void); + CHAR* (*MikMod_InfoLoader)(void); + BOOL (*MikMod_Init)(CHAR*); + void (*MikMod_RegisterAllLoaders)(void); + void (*MikMod_RegisterDriver)(struct MDRIVER*); + int* MikMod_errno; + char* (*MikMod_strerror)(int); + BOOL (*Player_Active)(void); + void (*Player_Free)(MODULE*); + MODULE* (*Player_LoadGeneric)(MREADER*,int,BOOL); + void (*Player_SetPosition)(UWORD); + void (*Player_SetVolume)(SWORD); + void (*Player_Start)(MODULE*); + void (*Player_Stop)(void); + ULONG (*VC_WriteBytes)(SBYTE*,ULONG); + struct MDRIVER* drv_nos; + UWORD* md_device; + UWORD* md_mixfreq; + UWORD* md_mode; + UBYTE* md_musicvolume; + UBYTE* md_pansep; + UBYTE* md_reverb; + UBYTE* md_sndfxvolume; + UBYTE* md_volume; +} mikmod_loader; + +extern mikmod_loader mikmod; + +#endif /* MOD_MUSIC */ + +extern int Mix_InitMOD(); +extern void Mix_QuitMOD(); diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_mp3.c b/apps/plugins/sdl/SDL_mixer/dynamic_mp3.c new file mode 100644 index 0000000..83a3e30 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_mp3.c @@ -0,0 +1,171 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef MP3_MUSIC + +#include "SDL_loadso.h" + +#include "dynamic_mp3.h" + +smpeg_loader smpeg = { + 0, NULL +}; + +#ifdef MP3_DYNAMIC +int Mix_InitMP3() +{ + if ( smpeg.loaded == 0 ) { + smpeg.handle = SDL_LoadObject(MP3_DYNAMIC); + if ( smpeg.handle == NULL ) { + return -1; + } + smpeg.SMPEG_actualSpec = + (void (*)( SMPEG *, SDL_AudioSpec * )) + SDL_LoadFunction(smpeg.handle, "SMPEG_actualSpec"); + if ( smpeg.SMPEG_actualSpec == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_delete = + (void (*)( SMPEG* )) + SDL_LoadFunction(smpeg.handle, "SMPEG_delete"); + if ( smpeg.SMPEG_delete == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_enableaudio = + (void (*)( SMPEG*, int )) + SDL_LoadFunction(smpeg.handle, "SMPEG_enableaudio"); + if ( smpeg.SMPEG_enableaudio == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_enablevideo = + (void (*)( SMPEG*, int )) + SDL_LoadFunction(smpeg.handle, "SMPEG_enablevideo"); + if ( smpeg.SMPEG_enablevideo == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_new_rwops = + (SMPEG* (*)(SDL_RWops *, SMPEG_Info*, int)) + SDL_LoadFunction(smpeg.handle, "SMPEG_new_rwops"); + if ( smpeg.SMPEG_new_rwops == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_play = + (void (*)( SMPEG* )) + SDL_LoadFunction(smpeg.handle, "SMPEG_play"); + if ( smpeg.SMPEG_play == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_playAudio = + (int (*)( SMPEG *, Uint8 *, int )) + SDL_LoadFunction(smpeg.handle, "SMPEG_playAudio"); + if ( smpeg.SMPEG_playAudio == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_rewind = + (void (*)( SMPEG* )) + SDL_LoadFunction(smpeg.handle, "SMPEG_rewind"); + if ( smpeg.SMPEG_rewind == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_setvolume = + (void (*)( SMPEG*, int )) + SDL_LoadFunction(smpeg.handle, "SMPEG_setvolume"); + if ( smpeg.SMPEG_setvolume == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_skip = + (void (*)( SMPEG*, float )) + SDL_LoadFunction(smpeg.handle, "SMPEG_skip"); + if ( smpeg.SMPEG_skip == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_status = + (SMPEGstatus (*)( SMPEG* )) + SDL_LoadFunction(smpeg.handle, "SMPEG_status"); + if ( smpeg.SMPEG_status == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + smpeg.SMPEG_stop = + (void (*)( SMPEG* )) + SDL_LoadFunction(smpeg.handle, "SMPEG_stop"); + if ( smpeg.SMPEG_stop == NULL ) { + SDL_UnloadObject(smpeg.handle); + return -1; + } + } + ++smpeg.loaded; + + return 0; +} +void Mix_QuitMP3() +{ + if ( smpeg.loaded == 0 ) { + return; + } + if ( smpeg.loaded == 1 ) { + SDL_UnloadObject(smpeg.handle); + } + --smpeg.loaded; +} +#else +int Mix_InitMP3() +{ + if ( smpeg.loaded == 0 ) { + smpeg.SMPEG_actualSpec = SMPEG_actualSpec; + smpeg.SMPEG_delete = SMPEG_delete; + smpeg.SMPEG_enableaudio = SMPEG_enableaudio; + smpeg.SMPEG_enablevideo = SMPEG_enablevideo; + smpeg.SMPEG_new_rwops = SMPEG_new_rwops; + smpeg.SMPEG_play = SMPEG_play; + smpeg.SMPEG_playAudio = SMPEG_playAudio; + smpeg.SMPEG_rewind = SMPEG_rewind; + smpeg.SMPEG_setvolume = SMPEG_setvolume; + smpeg.SMPEG_skip = SMPEG_skip; + smpeg.SMPEG_status = SMPEG_status; + smpeg.SMPEG_stop = SMPEG_stop; + } + ++smpeg.loaded; + + return 0; +} +void Mix_QuitMP3() +{ + if ( smpeg.loaded == 0 ) { + return; + } + if ( smpeg.loaded == 1 ) { + } + --smpeg.loaded; +} +#endif /* MP3_DYNAMIC */ + +#endif /* MP3_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_mp3.h b/apps/plugins/sdl/SDL_mixer/dynamic_mp3.h new file mode 100644 index 0000000..03cbbbf --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_mp3.h @@ -0,0 +1,47 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef MP3_MUSIC +#include "smpeg.h" + +typedef struct { + int loaded; + void *handle; + void (*SMPEG_actualSpec)( SMPEG *mpeg, SDL_AudioSpec *spec ); + void (*SMPEG_delete)( SMPEG* mpeg ); + void (*SMPEG_enableaudio)( SMPEG* mpeg, int enable ); + void (*SMPEG_enablevideo)( SMPEG* mpeg, int enable ); + SMPEG* (*SMPEG_new_rwops)(SDL_RWops *src, SMPEG_Info* info, int sdl_audio); + void (*SMPEG_play)( SMPEG* mpeg ); + int (*SMPEG_playAudio)( SMPEG *mpeg, Uint8 *stream, int len ); + void (*SMPEG_rewind)( SMPEG* mpeg ); + void (*SMPEG_setvolume)( SMPEG* mpeg, int volume ); + void (*SMPEG_skip)( SMPEG* mpeg, float seconds ); + SMPEGstatus (*SMPEG_status)( SMPEG* mpeg ); + void (*SMPEG_stop)( SMPEG* mpeg ); +} smpeg_loader; + +extern smpeg_loader smpeg; + +#endif /* MUSIC_MP3 */ + +extern int Mix_InitMP3(); +extern void Mix_QuitMP3(); diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_ogg.c b/apps/plugins/sdl/SDL_mixer/dynamic_ogg.c new file mode 100644 index 0000000..345a8c8 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_ogg.c @@ -0,0 +1,131 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef OGG_MUSIC + +#include "SDL_loadso.h" + +#include "dynamic_ogg.h" + +vorbis_loader vorbis = { + 0, NULL +}; + +#ifdef OGG_DYNAMIC +int Mix_InitOgg() +{ + if ( vorbis.loaded == 0 ) { + vorbis.handle = SDL_LoadObject(OGG_DYNAMIC); + if ( vorbis.handle == NULL ) { + return -1; + } + vorbis.ov_clear = + (int (*)(OggVorbis_File *)) + SDL_LoadFunction(vorbis.handle, "ov_clear"); + if ( vorbis.ov_clear == NULL ) { + SDL_UnloadObject(vorbis.handle); + return -1; + } + vorbis.ov_info = + (vorbis_info *(*)(OggVorbis_File *,int)) + SDL_LoadFunction(vorbis.handle, "ov_info"); + if ( vorbis.ov_info == NULL ) { + SDL_UnloadObject(vorbis.handle); + return -1; + } + vorbis.ov_open_callbacks = + (int (*)(void *, OggVorbis_File *, char *, long, ov_callbacks)) + SDL_LoadFunction(vorbis.handle, "ov_open_callbacks"); + if ( vorbis.ov_open_callbacks == NULL ) { + SDL_UnloadObject(vorbis.handle); + return -1; + } + vorbis.ov_pcm_total = + (ogg_int64_t (*)(OggVorbis_File *,int)) + SDL_LoadFunction(vorbis.handle, "ov_pcm_total"); + if ( vorbis.ov_pcm_total == NULL ) { + SDL_UnloadObject(vorbis.handle); + return -1; + } + vorbis.ov_read = +#ifdef OGG_USE_TREMOR + (long (*)(OggVorbis_File *,char *,int,int *)) +#else + (long (*)(OggVorbis_File *,char *,int,int,int,int,int *)) +#endif + SDL_LoadFunction(vorbis.handle, "ov_read"); + if ( vorbis.ov_read == NULL ) { + SDL_UnloadObject(vorbis.handle); + return -1; + } + vorbis.ov_time_seek = +#ifdef OGG_USE_TREMOR + (long (*)(OggVorbis_File *,ogg_int64_t)) +#else + (int (*)(OggVorbis_File *,double)) +#endif + SDL_LoadFunction(vorbis.handle, "ov_time_seek"); + if ( vorbis.ov_time_seek == NULL ) { + SDL_UnloadObject(vorbis.handle); + return -1; + } + } + ++vorbis.loaded; + + return 0; +} +void Mix_QuitOgg() +{ + if ( vorbis.loaded == 0 ) { + return; + } + if ( vorbis.loaded == 1 ) { + SDL_UnloadObject(vorbis.handle); + } + --vorbis.loaded; +} +#else +int Mix_InitOgg() +{ + if ( vorbis.loaded == 0 ) { + vorbis.ov_clear = ov_clear; + vorbis.ov_info = ov_info; + vorbis.ov_open_callbacks = ov_open_callbacks; + vorbis.ov_pcm_total = ov_pcm_total; + vorbis.ov_read = ov_read; + vorbis.ov_time_seek = ov_time_seek; + } + ++vorbis.loaded; + + return 0; +} +void Mix_QuitOgg() +{ + if ( vorbis.loaded == 0 ) { + return; + } + if ( vorbis.loaded == 1 ) { + } + --vorbis.loaded; +} +#endif /* OGG_DYNAMIC */ + +#endif /* OGG_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/dynamic_ogg.h b/apps/plugins/sdl/SDL_mixer/dynamic_ogg.h new file mode 100644 index 0000000..822458d --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/dynamic_ogg.h @@ -0,0 +1,53 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef OGG_MUSIC +#ifdef OGG_USE_TREMOR +#include +#else +#include +#endif + +typedef struct { + int loaded; + void *handle; + int (*ov_clear)(OggVorbis_File *vf); + vorbis_info *(*ov_info)(OggVorbis_File *vf,int link); + int (*ov_open_callbacks)(void *datasource, OggVorbis_File *vf, char *initial, long ibytes, ov_callbacks callbacks); + ogg_int64_t (*ov_pcm_total)(OggVorbis_File *vf,int i); +#ifdef OGG_USE_TREMOR + long (*ov_read)(OggVorbis_File *vf,char *buffer,int length, int *bitstream); +#else + long (*ov_read)(OggVorbis_File *vf,char *buffer,int length, int bigendianp,int word,int sgned,int *bitstream); +#endif +#ifdef OGG_USE_TREMOR + int (*ov_time_seek)(OggVorbis_File *vf,ogg_int64_t pos); +#else + int (*ov_time_seek)(OggVorbis_File *vf,double pos); +#endif +} vorbis_loader; + +extern vorbis_loader vorbis; + +#endif /* OGG_MUSIC */ + +extern int Mix_InitOgg(); +extern void Mix_QuitOgg(); diff --git a/apps/plugins/sdl/SDL_mixer/effect_position.c b/apps/plugins/sdl/SDL_mixer/effect_position.c new file mode 100644 index 0000000..e0b467b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/effect_position.c @@ -0,0 +1,1615 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This file by Ryan C. Gordon (icculus@icculus.org) + + These are some internally supported special effects that use SDL_mixer's + effect callback API. They are meant for speed over quality. :) +*/ + +/* $Id$ */ + +#include "SDL.h" +#include "SDL_mixer.h" +#include "SDL_endian.h" + +#define __MIX_INTERNAL_EFFECT__ +#include "effects_internal.h" + +/* profile code: + #include + #include + struct timeval tv1; + struct timeval tv2; + + gettimeofday(&tv1, NULL); + + ... do your thing here ... + + gettimeofday(&tv2, NULL); + printf("%ld\n", tv2.tv_usec - tv1.tv_usec); +*/ + + +/* + * Positional effects...panning, distance attenuation, etc. + */ + +typedef struct _Eff_positionargs +{ + volatile float left_f; + volatile float right_f; + volatile Uint8 left_u8; + volatile Uint8 right_u8; + volatile float left_rear_f; + volatile float right_rear_f; + volatile float center_f; + volatile float lfe_f; + volatile Uint8 left_rear_u8; + volatile Uint8 right_rear_u8; + volatile Uint8 center_u8; + volatile Uint8 lfe_u8; + volatile float distance_f; + volatile Uint8 distance_u8; + volatile Sint16 room_angle; + volatile int in_use; + volatile int channels; +} position_args; + +static position_args **pos_args_array = NULL; +static position_args *pos_args_global = NULL; +static int position_channels = 0; + +void _Eff_PositionDeinit(void) +{ + int i; + for (i = 0; i < position_channels; i++) { + SDL_free(pos_args_array[i]); + } + + position_channels = 0; + + SDL_free(pos_args_global); + pos_args_global = NULL; + SDL_free(pos_args_array); + pos_args_array = NULL; +} + + +/* This just frees up the callback-specific data. */ +static void _Eff_PositionDone(int channel, void *udata) +{ + if (channel < 0) { + if (pos_args_global != NULL) { + SDL_free(pos_args_global); + pos_args_global = NULL; + } + } + + else if (pos_args_array[channel] != NULL) { + SDL_free(pos_args_array[channel]); + pos_args_array[channel] = NULL; + } +} + + +static void _Eff_position_u8(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint8 *ptr = (Uint8 *) stream; + int i; + + /* + * if there's only a mono channnel (the only way we wouldn't have + * a len divisible by 2 here), then left_f and right_f are always + * 1.0, and are therefore throwaways. + */ + if (len % sizeof (Uint16) != 0) { + *ptr = (Uint8) (((float) *ptr) * args->distance_f); + ptr++; + len--; + } + + if (args->room_angle == 180) + for (i = 0; i < len; i += sizeof (Uint8) * 2) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + } + else for (i = 0; i < len; i += sizeof (Uint8) * 2) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + } +} +static void _Eff_position_u8_c4(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint8 *ptr = (Uint8 *) stream; + int i; + + /* + * if there's only a mono channnel (the only way we wouldn't have + * a len divisible by 2 here), then left_f and right_f are always + * 1.0, and are therefore throwaways. + */ + if (len % sizeof (Uint16) != 0) { + *ptr = (Uint8) (((float) *ptr) * args->distance_f); + ptr++; + len--; + } + + if (args->room_angle == 0) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + } + else if (args->room_angle == 90) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + } + else if (args->room_angle == 180) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + } + else if (args->room_angle == 270) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + } +} + + +static void _Eff_position_u8_c6(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint8 *ptr = (Uint8 *) stream; + int i; + + /* + * if there's only a mono channnel (the only way we wouldn't have + * a len divisible by 2 here), then left_f and right_f are always + * 1.0, and are therefore throwaways. + */ + if (len % sizeof (Uint16) != 0) { + *ptr = (Uint8) (((float) *ptr) * args->distance_f); + ptr++; + len--; + } + + if (args->room_angle == 0) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->center_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->lfe_f) * args->distance_f) + 128); + ptr++; + } + else if (args->room_angle == 90) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f/2) + 128) + + (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f/2) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->lfe_f) * args->distance_f) + 128); + ptr++; + } + else if (args->room_angle == 180) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f/2) + 128) + + (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f/2) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->lfe_f) * args->distance_f) + 128); + ptr++; + } + else if (args->room_angle == 270) + for (i = 0; i < len; i += sizeof (Uint8) * 6) { + /* must adjust the sample so that 0 is the center */ + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_rear_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->right_f) * args->distance_f) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_f) * args->distance_f/2) + 128) + + (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->left_rear_f) * args->distance_f/2) + 128); + ptr++; + *ptr = (Uint8) ((Sint8) ((((float) (Sint8) (*ptr - 128)) + * args->lfe_f) * args->distance_f) + 128); + ptr++; + } +} + + +/* + * This one runs about 10.1 times faster than the non-table version, with + * no loss in quality. It does, however, require 64k of memory for the + * lookup table. Also, this will only update position information once per + * call; the non-table version always checks the arguments for each sample, + * in case the user has called Mix_SetPanning() or whatnot again while this + * callback is running. + */ +static void _Eff_position_table_u8(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint8 *ptr = (Uint8 *) stream; + Uint32 *p; + int i; + Uint8 *l = ((Uint8 *) _Eff_volume_table) + (256 * args->left_u8); + Uint8 *r = ((Uint8 *) _Eff_volume_table) + (256 * args->right_u8); + Uint8 *d = ((Uint8 *) _Eff_volume_table) + (256 * args->distance_u8); + + if (args->room_angle == 180) { + Uint8 *temp = l; + l = r; + r = temp; + } + /* + * if there's only a mono channnel, then l[] and r[] are always + * volume 255, and are therefore throwaways. Still, we have to + * be sure not to overrun the audio buffer... + */ + while (len % sizeof (Uint32) != 0) { + *ptr = d[l[*ptr]]; + ptr++; + if (args->channels > 1) { + *ptr = d[r[*ptr]]; + ptr++; + } + len -= args->channels; + } + + p = (Uint32 *) ptr; + + for (i = 0; i < len; i += sizeof (Uint32)) { +#if (SDL_BYTEORDER == SDL_BIG_ENDIAN) + *p = (d[l[(*p & 0xFF000000) >> 24]] << 24) | + (d[r[(*p & 0x00FF0000) >> 16]] << 16) | + (d[l[(*p & 0x0000FF00) >> 8]] << 8) | + (d[r[(*p & 0x000000FF) ]] ) ; +#else + *p = (d[r[(*p & 0xFF000000) >> 24]] << 24) | + (d[l[(*p & 0x00FF0000) >> 16]] << 16) | + (d[r[(*p & 0x0000FF00) >> 8]] << 8) | + (d[l[(*p & 0x000000FF) ]] ) ; +#endif + ++p; + } +} + + +static void _Eff_position_s8(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Sint8 *ptr = (Sint8 *) stream; + int i; + + /* + * if there's only a mono channnel (the only way we wouldn't have + * a len divisible by 2 here), then left_f and right_f are always + * 1.0, and are therefore throwaways. + */ + if (len % sizeof (Sint16) != 0) { + *ptr = (Sint8) (((float) *ptr) * args->distance_f); + ptr++; + len--; + } + + if (args->room_angle == 180) + for (i = 0; i < len; i += sizeof (Sint8) * 2) { + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); + ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); + ptr++; + } + else + for (i = 0; i < len; i += sizeof (Sint8) * 2) { + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); + ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); + ptr++; + } +} +static void _Eff_position_s8_c4(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Sint8 *ptr = (Sint8 *) stream; + int i; + + /* + * if there's only a mono channnel (the only way we wouldn't have + * a len divisible by 2 here), then left_f and right_f are always + * 1.0, and are therefore throwaways. + */ + if (len % sizeof (Sint16) != 0) { + *ptr = (Sint8) (((float) *ptr) * args->distance_f); + ptr++; + len--; + } + + for (i = 0; i < len; i += sizeof (Sint8) * 4) { + switch (args->room_angle) { + case 0: + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + break; + case 90: + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + break; + case 180: + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + break; + case 270: + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + break; + } + } +} +static void _Eff_position_s8_c6(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Sint8 *ptr = (Sint8 *) stream; + int i; + + /* + * if there's only a mono channnel (the only way we wouldn't have + * a len divisible by 2 here), then left_f and right_f are always + * 1.0, and are therefore throwaways. + */ + if (len % sizeof (Sint16) != 0) { + *ptr = (Sint8) (((float) *ptr) * args->distance_f); + ptr++; + len--; + } + + for (i = 0; i < len; i += sizeof (Sint8) * 6) { + switch (args->room_angle) { + case 0: + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->center_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->lfe_f) * args->distance_f); ptr++; + break; + case 90: + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f / 2) + + (Sint8)((((float) *ptr) * args->right_f) * args->distance_f / 2); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->lfe_f) * args->distance_f); ptr++; + break; + case 180: + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f / 2) + + (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f / 2); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->lfe_f) * args->distance_f); ptr++; + break; + case 270: + *ptr = (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_rear_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->right_f) * args->distance_f); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->left_f) * args->distance_f / 2) + + (Sint8)((((float) *ptr) * args->left_rear_f) * args->distance_f / 2); ptr++; + *ptr = (Sint8)((((float) *ptr) * args->lfe_f) * args->distance_f); ptr++; + break; + } + } +} + + +/* + * This one runs about 10.1 times faster than the non-table version, with + * no loss in quality. It does, however, require 64k of memory for the + * lookup table. Also, this will only update position information once per + * call; the non-table version always checks the arguments for each sample, + * in case the user has called Mix_SetPanning() or whatnot again while this + * callback is running. + */ +static void _Eff_position_table_s8(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Sint8 *ptr = (Sint8 *) stream; + Uint32 *p; + int i; + Sint8 *l = ((Sint8 *) _Eff_volume_table) + (256 * args->left_u8); + Sint8 *r = ((Sint8 *) _Eff_volume_table) + (256 * args->right_u8); + Sint8 *d = ((Sint8 *) _Eff_volume_table) + (256 * args->distance_u8); + + if (args->room_angle == 180) { + Sint8 *temp = l; + l = r; + r = temp; + } + + + while (len % sizeof (Uint32) != 0) { + *ptr = d[l[*ptr]]; + ptr++; + if (args->channels > 1) { + *ptr = d[r[*ptr]]; + ptr++; + } + len -= args->channels; + } + + p = (Uint32 *) ptr; + + for (i = 0; i < len; i += sizeof (Uint32)) { +#if (SDL_BYTEORDER == SDL_BIG_ENDIAN) + *p = (d[l[((Sint16)(Sint8)((*p & 0xFF000000) >> 24))+128]] << 24) | + (d[r[((Sint16)(Sint8)((*p & 0x00FF0000) >> 16))+128]] << 16) | + (d[l[((Sint16)(Sint8)((*p & 0x0000FF00) >> 8))+128]] << 8) | + (d[r[((Sint16)(Sint8)((*p & 0x000000FF) ))+128]] ) ; +#else + *p = (d[r[((Sint16)(Sint8)((*p & 0xFF000000) >> 24))+128]] << 24) | + (d[l[((Sint16)(Sint8)((*p & 0x00FF0000) >> 16))+128]] << 16) | + (d[r[((Sint16)(Sint8)((*p & 0x0000FF00) >> 8))+128]] << 8) | + (d[l[((Sint16)(Sint8)((*p & 0x000000FF) ))+128]] ) ; +#endif + ++p; + } + + +} + + +/* !!! FIXME : Optimize the code for 16-bit samples? */ + +static void _Eff_position_u16lsb(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint16 *ptr = (Uint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Uint16) * 2) { + Sint16 sampl = (Sint16) (SDL_SwapLE16(*(ptr+0)) - 32768); + Sint16 sampr = (Sint16) (SDL_SwapLE16(*(ptr+1)) - 32768); + + Uint16 swapl = (Uint16) ((Sint16) (((float) sampl * args->left_f) + * args->distance_f) + 32768); + Uint16 swapr = (Uint16) ((Sint16) (((float) sampr * args->right_f) + * args->distance_f) + 32768); + + if (args->room_angle == 180) { + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + } + else { + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + } + } +} +static void _Eff_position_u16lsb_c4(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint16 *ptr = (Uint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Uint16) * 4) { + Sint16 sampl = (Sint16) (SDL_SwapLE16(*(ptr+0)) - 32768); + Sint16 sampr = (Sint16) (SDL_SwapLE16(*(ptr+1)) - 32768); + Sint16 samplr = (Sint16) (SDL_SwapLE16(*(ptr+2)) - 32768); + Sint16 samprr = (Sint16) (SDL_SwapLE16(*(ptr+3)) - 32768); + + Uint16 swapl = (Uint16) ((Sint16) (((float) sampl * args->left_f) + * args->distance_f) + 32768); + Uint16 swapr = (Uint16) ((Sint16) (((float) sampr * args->right_f) + * args->distance_f) + 32768); + Uint16 swaplr = (Uint16) ((Sint16) (((float) samplr * args->left_rear_f) + * args->distance_f) + 32768); + Uint16 swaprr = (Uint16) ((Sint16) (((float) samprr * args->right_rear_f) + * args->distance_f) + 32768); + + switch (args->room_angle) { + case 0: + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + break; + case 90: + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + break; + case 180: + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + break; + case 270: + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + break; + } + } +} +static void _Eff_position_u16lsb_c6(int chan, void *stream, int len, void *udata) +{ + volatile position_args *args = (volatile position_args *) udata; + Uint16 *ptr = (Uint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Uint16) * 6) { + Sint16 sampl = (Sint16) (SDL_SwapLE16(*(ptr+0)) - 32768); + Sint16 sampr = (Sint16) (SDL_SwapLE16(*(ptr+1)) - 32768); + Sint16 samplr = (Sint16) (SDL_SwapLE16(*(ptr+2)) - 32768); + Sint16 samprr = (Sint16) (SDL_SwapLE16(*(ptr+3)) - 32768); + Sint16 sampce = (Sint16) (SDL_SwapLE16(*(ptr+4)) - 32768); + Sint16 sampwf = (Sint16) (SDL_SwapLE16(*(ptr+5)) - 32768); + + Uint16 swapl = (Uint16) ((Sint16) (((float) sampl * args->left_f) + * args->distance_f) + 32768); + Uint16 swapr = (Uint16) ((Sint16) (((float) sampr * args->right_f) + * args->distance_f) + 32768); + Uint16 swaplr = (Uint16) ((Sint16) (((float) samplr * args->left_rear_f) + * args->distance_f) + 32768); + Uint16 swaprr = (Uint16) ((Sint16) (((float) samprr * args->right_rear_f) + * args->distance_f) + 32768); + Uint16 swapce = (Uint16) ((Sint16) (((float) sampce * args->center_f) + * args->distance_f) + 32768); + Uint16 swapwf = (Uint16) ((Sint16) (((float) sampwf * args->lfe_f) + * args->distance_f) + 32768); + + switch (args->room_angle) { + case 0: + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapce); + *(ptr++) = (Uint16) SDL_SwapLE16(swapwf); + break; + case 90: + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr)/2 + (Uint16) SDL_SwapLE16(swaprr)/2; + *(ptr++) = (Uint16) SDL_SwapLE16(swapwf); + break; + case 180: + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr)/2 + (Uint16) SDL_SwapLE16(swaplr)/2; + *(ptr++) = (Uint16) SDL_SwapLE16(swapwf); + break; + case 270: + *(ptr++) = (Uint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl); + *(ptr++) = (Uint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapr); + *(ptr++) = (Uint16) SDL_SwapLE16(swapl)/2 + (Uint16) SDL_SwapLE16(swaplr)/2; + *(ptr++) = (Uint16) SDL_SwapLE16(swapwf); + break; + } + } +} + +static void _Eff_position_s16lsb(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 2 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Sint16 *ptr = (Sint16 *) stream; + int i; + +#if 0 + if (len % (sizeof(Sint16) * 2)) { + fprintf(stderr,"Not an even number of frames! len=%d\n", len); + return; + } +#endif + + for (i = 0; i < len; i += sizeof (Sint16) * 2) { + Sint16 swapl = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+0))) * + args->left_f) * args->distance_f); + Sint16 swapr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+1))) * + args->right_f) * args->distance_f); + if (args->room_angle == 180) { + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + } + else { + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + } + } +} +static void _Eff_position_s16lsb_c4(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 4 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Sint16 *ptr = (Sint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 4) { + Sint16 swapl = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+0))) * + args->left_f) * args->distance_f); + Sint16 swapr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+1))) * + args->right_f) * args->distance_f); + Sint16 swaplr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+1))) * + args->left_rear_f) * args->distance_f); + Sint16 swaprr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+2))) * + args->right_rear_f) * args->distance_f); + switch (args->room_angle) { + case 0: + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + break; + case 90: + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + break; + case 180: + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + break; + case 270: + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + break; + } + } +} + +static void _Eff_position_s16lsb_c6(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 6 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Sint16 *ptr = (Sint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 6) { + Sint16 swapl = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+0))) * + args->left_f) * args->distance_f); + Sint16 swapr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+1))) * + args->right_f) * args->distance_f); + Sint16 swaplr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+2))) * + args->left_rear_f) * args->distance_f); + Sint16 swaprr = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+3))) * + args->right_rear_f) * args->distance_f); + Sint16 swapce = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+4))) * + args->center_f) * args->distance_f); + Sint16 swapwf = (Sint16) ((((float) (Sint16) SDL_SwapLE16(*(ptr+5))) * + args->lfe_f) * args->distance_f); + switch (args->room_angle) { + case 0: + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapce); + *(ptr++) = (Sint16) SDL_SwapLE16(swapwf); + break; + case 90: + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr)/2 + (Sint16) SDL_SwapLE16(swaprr)/2; + *(ptr++) = (Sint16) SDL_SwapLE16(swapwf); + break; + case 180: + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr)/2 + (Sint16) SDL_SwapLE16(swaplr)/2; + *(ptr++) = (Sint16) SDL_SwapLE16(swapwf); + break; + case 270: + *(ptr++) = (Sint16) SDL_SwapLE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl); + *(ptr++) = (Sint16) SDL_SwapLE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapr); + *(ptr++) = (Sint16) SDL_SwapLE16(swapl)/2 + (Sint16) SDL_SwapLE16(swaplr)/2; + *(ptr++) = (Sint16) SDL_SwapLE16(swapwf); + break; + } + } +} + +static void _Eff_position_u16msb(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 2 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Uint16 *ptr = (Uint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 2) { + Sint16 sampl = (Sint16) (SDL_SwapBE16(*(ptr+0)) - 32768); + Sint16 sampr = (Sint16) (SDL_SwapBE16(*(ptr+1)) - 32768); + + Uint16 swapl = (Uint16) ((Sint16) (((float) sampl * args->left_f) + * args->distance_f) + 32768); + Uint16 swapr = (Uint16) ((Sint16) (((float) sampr * args->right_f) + * args->distance_f) + 32768); + + if (args->room_angle == 180) { + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + } + else { + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + } + } +} +static void _Eff_position_u16msb_c4(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 4 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Uint16 *ptr = (Uint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 4) { + Sint16 sampl = (Sint16) (SDL_SwapBE16(*(ptr+0)) - 32768); + Sint16 sampr = (Sint16) (SDL_SwapBE16(*(ptr+1)) - 32768); + Sint16 samplr = (Sint16) (SDL_SwapBE16(*(ptr+2)) - 32768); + Sint16 samprr = (Sint16) (SDL_SwapBE16(*(ptr+3)) - 32768); + + Uint16 swapl = (Uint16) ((Sint16) (((float) sampl * args->left_f) + * args->distance_f) + 32768); + Uint16 swapr = (Uint16) ((Sint16) (((float) sampr * args->right_f) + * args->distance_f) + 32768); + Uint16 swaplr = (Uint16) ((Sint16) (((float) samplr * args->left_rear_f) + * args->distance_f) + 32768); + Uint16 swaprr = (Uint16) ((Sint16) (((float) samprr * args->right_rear_f) + * args->distance_f) + 32768); + + switch (args->room_angle) { + case 0: + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + break; + case 90: + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + break; + case 180: + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + break; + case 270: + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + break; + } + } +} +static void _Eff_position_u16msb_c6(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 6 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Uint16 *ptr = (Uint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 6) { + Sint16 sampl = (Sint16) (SDL_SwapBE16(*(ptr+0)) - 32768); + Sint16 sampr = (Sint16) (SDL_SwapBE16(*(ptr+1)) - 32768); + Sint16 samplr = (Sint16) (SDL_SwapBE16(*(ptr+2)) - 32768); + Sint16 samprr = (Sint16) (SDL_SwapBE16(*(ptr+3)) - 32768); + Sint16 sampce = (Sint16) (SDL_SwapBE16(*(ptr+4)) - 32768); + Sint16 sampwf = (Sint16) (SDL_SwapBE16(*(ptr+5)) - 32768); + + Uint16 swapl = (Uint16) ((Sint16) (((float) sampl * args->left_f) + * args->distance_f) + 32768); + Uint16 swapr = (Uint16) ((Sint16) (((float) sampr * args->right_f) + * args->distance_f) + 32768); + Uint16 swaplr = (Uint16) ((Sint16) (((float) samplr * args->left_rear_f) + * args->distance_f) + 32768); + Uint16 swaprr = (Uint16) ((Sint16) (((float) samprr * args->right_rear_f) + * args->distance_f) + 32768); + Uint16 swapce = (Uint16) ((Sint16) (((float) sampce * args->center_f) + * args->distance_f) + 32768); + Uint16 swapwf = (Uint16) ((Sint16) (((float) sampwf * args->lfe_f) + * args->distance_f) + 32768); + + switch (args->room_angle) { + case 0: + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapce); + *(ptr++) = (Uint16) SDL_SwapBE16(swapwf); + break; + case 90: + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr)/2 + (Uint16) SDL_SwapBE16(swaprr)/2; + *(ptr++) = (Uint16) SDL_SwapBE16(swapwf); + break; + case 180: + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr)/2 + (Uint16) SDL_SwapBE16(swaplr)/2; + *(ptr++) = (Uint16) SDL_SwapBE16(swapwf); + break; + case 270: + *(ptr++) = (Uint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl); + *(ptr++) = (Uint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapr); + *(ptr++) = (Uint16) SDL_SwapBE16(swapl)/2 + (Uint16) SDL_SwapBE16(swaplr)/2; + *(ptr++) = (Uint16) SDL_SwapBE16(swapwf); + break; + } + } +} + +static void _Eff_position_s16msb(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 2 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Sint16 *ptr = (Sint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 2) { + Sint16 swapl = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+0))) * + args->left_f) * args->distance_f); + Sint16 swapr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+1))) * + args->right_f) * args->distance_f); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + } +} +static void _Eff_position_s16msb_c4(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 4 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Sint16 *ptr = (Sint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 4) { + Sint16 swapl = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+0))) * + args->left_f) * args->distance_f); + Sint16 swapr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+1))) * + args->right_f) * args->distance_f); + Sint16 swaplr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+2))) * + args->left_rear_f) * args->distance_f); + Sint16 swaprr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+3))) * + args->right_rear_f) * args->distance_f); + switch (args->room_angle) { + case 0: + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + break; + case 90: + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + break; + case 180: + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + break; + case 270: + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + break; + } + } +} +static void _Eff_position_s16msb_c6(int chan, void *stream, int len, void *udata) +{ + /* 16 signed bits (lsb) * 6 channels. */ + volatile position_args *args = (volatile position_args *) udata; + Sint16 *ptr = (Sint16 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Sint16) * 6) { + Sint16 swapl = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+0))) * + args->left_f) * args->distance_f); + Sint16 swapr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+1))) * + args->right_f) * args->distance_f); + Sint16 swaplr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+2))) * + args->left_rear_f) * args->distance_f); + Sint16 swaprr = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+3))) * + args->right_rear_f) * args->distance_f); + Sint16 swapce = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+4))) * + args->center_f) * args->distance_f); + Sint16 swapwf = (Sint16) ((((float) (Sint16) SDL_SwapBE16(*(ptr+5))) * + args->lfe_f) * args->distance_f); + + switch (args->room_angle) { + case 0: + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapce); + *(ptr++) = (Sint16) SDL_SwapBE16(swapwf); + break; + case 90: + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr)/2 + (Sint16) SDL_SwapBE16(swaprr)/2; + *(ptr++) = (Sint16) SDL_SwapBE16(swapwf); + break; + case 180: + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr)/2 + (Sint16) SDL_SwapBE16(swaplr)/2; + *(ptr++) = (Sint16) SDL_SwapBE16(swapwf); + break; + case 270: + *(ptr++) = (Sint16) SDL_SwapBE16(swaplr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl); + *(ptr++) = (Sint16) SDL_SwapBE16(swaprr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapr); + *(ptr++) = (Sint16) SDL_SwapBE16(swapl)/2 + (Sint16) SDL_SwapBE16(swaplr)/2; + *(ptr++) = (Sint16) SDL_SwapBE16(swapwf); + break; + } + } +} + +static void init_position_args(position_args *args) +{ + memset(args, '\0', sizeof (position_args)); + args->in_use = 0; + args->room_angle = 0; + args->left_u8 = args->right_u8 = args->distance_u8 = 255; + args->left_f = args->right_f = args->distance_f = 1.0f; + args->left_rear_u8 = args->right_rear_u8 = args->center_u8 = args->lfe_u8 = 255; + args->left_rear_f = args->right_rear_f = args->center_f = args->lfe_f = 1.0f; + Mix_QuerySpec(NULL, NULL, (int *) &args->channels); +} + + +static position_args *get_position_arg(int channel) +{ + void *rc; + int i; + + if (channel < 0) { + if (pos_args_global == NULL) { + pos_args_global = SDL_malloc(sizeof (position_args)); + if (pos_args_global == NULL) { + Mix_SetError("Out of memory"); + return(NULL); + } + init_position_args(pos_args_global); + } + + return(pos_args_global); + } + + if (channel >= position_channels) { + rc = SDL_realloc(pos_args_array, (channel + 1) * sizeof (position_args *)); + if (rc == NULL) { + Mix_SetError("Out of memory"); + return(NULL); + } + pos_args_array = (position_args **) rc; + for (i = position_channels; i <= channel; i++) { + pos_args_array[i] = NULL; + } + position_channels = channel + 1; + } + + if (pos_args_array[channel] == NULL) { + pos_args_array[channel] = (position_args *)SDL_malloc(sizeof(position_args)); + if (pos_args_array[channel] == NULL) { + Mix_SetError("Out of memory"); + return(NULL); + } + init_position_args(pos_args_array[channel]); + } + + return(pos_args_array[channel]); +} + + +static Mix_EffectFunc_t get_position_effect_func(Uint16 format, int channels) +{ + Mix_EffectFunc_t f = NULL; + + switch (format) { + case AUDIO_U8: + switch (channels) { + case 1: + case 2: + f = (_Eff_build_volume_table_u8()) ? _Eff_position_table_u8 : + _Eff_position_u8; + break; + case 4: + f = _Eff_position_u8_c4; + break; + case 6: + f = _Eff_position_u8_c6; + break; + } + break; + + case AUDIO_S8: + switch (channels) { + case 1: + case 2: + f = (_Eff_build_volume_table_s8()) ? _Eff_position_table_s8 : + _Eff_position_s8; + break; + case 4: + f = _Eff_position_s8_c4; + break; + case 6: + f = _Eff_position_s8_c6; + break; + } + break; + + case AUDIO_U16LSB: + switch (channels) { + case 1: + case 2: + f = _Eff_position_u16lsb; + break; + case 4: + f = _Eff_position_u16lsb_c4; + break; + case 6: + f = _Eff_position_u16lsb_c6; + break; + } + break; + + case AUDIO_S16LSB: + switch (channels) { + case 1: + case 2: + f = _Eff_position_s16lsb; + break; + case 4: + f = _Eff_position_s16lsb_c4; + break; + case 6: + f = _Eff_position_s16lsb_c6; + break; + } + break; + + case AUDIO_U16MSB: + switch (channels) { + case 1: + case 2: + f = _Eff_position_u16msb; + break; + case 4: + f = _Eff_position_u16msb_c4; + break; + case 6: + f = _Eff_position_u16msb_c6; + break; + } + break; + + case AUDIO_S16MSB: + switch (channels) { + case 1: + case 2: + f = _Eff_position_s16msb; + break; + case 4: + f = _Eff_position_s16msb_c4; + break; + case 6: + f = _Eff_position_s16msb_c6; + break; + } + break; + + default: + Mix_SetError("Unsupported audio format"); + } + + return(f); +} + +static Uint8 speaker_amplitude[6]; + +static void set_amplitudes(int channels, int angle, int room_angle) +{ + int left = 255, right = 255; + int left_rear = 255, right_rear = 255, center = 255; + + angle = SDL_abs(angle) % 360; /* make angle between 0 and 359. */ + + if (channels == 2) + { + /* + * We only attenuate by position if the angle falls on the far side + * of center; That is, an angle that's due north would not attenuate + * either channel. Due west attenuates the right channel to 0.0, and + * due east attenuates the left channel to 0.0. Slightly east of + * center attenuates the left channel a little, and the right channel + * not at all. I think of this as occlusion by one's own head. :) + * + * ...so, we split our angle circle into four quadrants... + */ + if (angle < 90) { + left = 255 - ((int) (255.0f * (((float) angle) / 89.0f))); + } else if (angle < 180) { + left = (int) (255.0f * (((float) (angle - 90)) / 89.0f)); + } else if (angle < 270) { + right = 255 - ((int) (255.0f * (((float) (angle - 180)) / 89.0f))); + } else { + right = (int) (255.0f * (((float) (angle - 270)) / 89.0f)); + } + } + + if (channels == 4 || channels == 6) + { + /* + * An angle that's due north does not attenuate the center channel. + * An angle in the first quadrant, 0-90, does not attenuate the RF. + * + * ...so, we split our angle circle into 8 ... + * + * CE + * 0 + * LF | RF + * | + * 270<-------|----------->90 + * | + * LR | RR + * 180 + * + */ + if (angle < 45) { + left = ((int) (255.0f * (((float) (180 - angle)) / 179.0f))); + left_rear = 255 - ((int) (255.0f * (((float) (angle + 45)) / 89.0f))); + right_rear = 255 - ((int) (255.0f * (((float) (90 - angle)) / 179.0f))); + } else if (angle < 90) { + center = ((int) (255.0f * (((float) (225 - angle)) / 179.0f))); + left = ((int) (255.0f * (((float) (180 - angle)) / 179.0f))); + left_rear = 255 - ((int) (255.0f * (((float) (135 - angle)) / 89.0f))); + right_rear = ((int) (255.0f * (((float) (90 + angle)) / 179.0f))); + } else if (angle < 135) { + center = ((int) (255.0f * (((float) (225 - angle)) / 179.0f))); + left = 255 - ((int) (255.0f * (((float) (angle - 45)) / 89.0f))); + right = ((int) (255.0f * (((float) (270 - angle)) / 179.0f))); + left_rear = ((int) (255.0f * (((float) (angle)) / 179.0f))); + } else if (angle < 180) { + center = 255 - ((int) (255.0f * (((float) (angle - 90)) / 89.0f))); + left = 255 - ((int) (255.0f * (((float) (225 - angle)) / 89.0f))); + right = ((int) (255.0f * (((float) (270 - angle)) / 179.0f))); + left_rear = ((int) (255.0f * (((float) (angle)) / 179.0f))); + } else if (angle < 225) { + center = 255 - ((int) (255.0f * (((float) (270 - angle)) / 89.0f))); + left = ((int) (255.0f * (((float) (angle - 90)) / 179.0f))); + right = 255 - ((int) (255.0f * (((float) (angle - 135)) / 89.0f))); + right_rear = ((int) (255.0f * (((float) (360 - angle)) / 179.0f))); + } else if (angle < 270) { + center = ((int) (255.0f * (((float) (angle - 135)) / 179.0f))); + left = ((int) (255.0f * (((float) (angle - 90)) / 179.0f))); + right = 255 - ((int) (255.0f * (((float) (315 - angle)) / 89.0f))); + right_rear = ((int) (255.0f * (((float) (360 - angle)) / 179.0f))); + } else if (angle < 315) { + center = ((int) (255.0f * (((float) (angle - 135)) / 179.0f))); + right = ((int) (255.0f * (((float) (angle - 180)) / 179.0f))); + left_rear = ((int) (255.0f * (((float) (450 - angle)) / 179.0f))); + right_rear = 255 - ((int) (255.0f * (((float) (angle - 225)) / 89.0f))); + } else { + right = ((int) (255.0f * (((float) (angle - 180)) / 179.0f))); + left_rear = ((int) (255.0f * (((float) (450 - angle)) / 179.0f))); + right_rear = 255 - ((int) (255.0f * (((float) (405 - angle)) / 89.0f))); + } + } + + if (left < 0) left = 0; if (left > 255) left = 255; + if (right < 0) right = 0; if (right > 255) right = 255; + if (left_rear < 0) left_rear = 0; if (left_rear > 255) left_rear = 255; + if (right_rear < 0) right_rear = 0; if (right_rear > 255) right_rear = 255; + if (center < 0) center = 0; if (center > 255) center = 255; + + if (room_angle == 90) { + speaker_amplitude[0] = (Uint8)left_rear; + speaker_amplitude[1] = (Uint8)left; + speaker_amplitude[2] = (Uint8)right_rear; + speaker_amplitude[3] = (Uint8)right; + } + else if (room_angle == 180) { + if (channels == 2) { + speaker_amplitude[0] = (Uint8)right; + speaker_amplitude[1] = (Uint8)left; + } + else { + speaker_amplitude[0] = (Uint8)right_rear; + speaker_amplitude[1] = (Uint8)left_rear; + speaker_amplitude[2] = (Uint8)right; + speaker_amplitude[3] = (Uint8)left; + } + } + else if (room_angle == 270) { + speaker_amplitude[0] = (Uint8)right; + speaker_amplitude[1] = (Uint8)right_rear; + speaker_amplitude[2] = (Uint8)left; + speaker_amplitude[3] = (Uint8)left_rear; + } + else { + speaker_amplitude[0] = (Uint8)left; + speaker_amplitude[1] = (Uint8)right; + speaker_amplitude[2] = (Uint8)left_rear; + speaker_amplitude[3] = (Uint8)right_rear; + } + speaker_amplitude[4] = (Uint8)center; + speaker_amplitude[5] = 255; +} + +int Mix_SetPosition(int channel, Sint16 angle, Uint8 distance); + +int Mix_SetPanning(int channel, Uint8 left, Uint8 right) +{ + Mix_EffectFunc_t f = NULL; + int channels; + Uint16 format; + position_args *args = NULL; + int retval = 1; + + Mix_QuerySpec(NULL, &format, &channels); + + if (channels != 2 && channels != 4 && channels != 6) /* it's a no-op; we call that successful. */ + return(1); + + if (channels > 2) { + /* left = right = 255 => angle = 0, to unregister effect as when channels = 2 */ + /* left = 255 => angle = -90; left = 0 => angle = +89 */ + int angle = 0; + if ((left != 255) || (right != 255)) { + angle = (int)left; + angle = 127 - angle; + angle = -angle; + angle = angle * 90 / 128; /* Make it larger for more effect? */ + } + return( Mix_SetPosition(channel, angle, 0) ); + } + + f = get_position_effect_func(format, channels); + if (f == NULL) + return(0); + + SDL_LockAudio(); + args = get_position_arg(channel); + if (!args) { + SDL_UnlockAudio(); + return(0); + } + + /* it's a no-op; unregister the effect, if it's registered. */ + if ((args->distance_u8 == 255) && (left == 255) && (right == 255)) { + if (args->in_use) { + retval = _Mix_UnregisterEffect_locked(channel, f); + SDL_UnlockAudio(); + return(retval); + } else { + SDL_UnlockAudio(); + return(1); + } + } + + args->left_u8 = left; + args->left_f = ((float) left) / 255.0f; + args->right_u8 = right; + args->right_f = ((float) right) / 255.0f; + args->room_angle = 0; + + if (!args->in_use) { + args->in_use = 1; + retval=_Mix_RegisterEffect_locked(channel, f, _Eff_PositionDone, (void*)args); + } + + SDL_UnlockAudio(); + return(retval); +} + + +int Mix_SetDistance(int channel, Uint8 distance) +{ + Mix_EffectFunc_t f = NULL; + Uint16 format; + position_args *args = NULL; + int channels; + int retval = 1; + + Mix_QuerySpec(NULL, &format, &channels); + f = get_position_effect_func(format, channels); + if (f == NULL) + return(0); + + SDL_LockAudio(); + args = get_position_arg(channel); + if (!args) { + SDL_UnlockAudio(); + return(0); + } + + distance = 255 - distance; /* flip it to our scale. */ + + /* it's a no-op; unregister the effect, if it's registered. */ + if ((distance == 255) && (args->left_u8 == 255) && (args->right_u8 == 255)) { + if (args->in_use) { + retval = _Mix_UnregisterEffect_locked(channel, f); + SDL_UnlockAudio(); + return(retval); + } else { + SDL_UnlockAudio(); + return(1); + } + } + + args->distance_u8 = distance; + args->distance_f = ((float) distance) / 255.0f; + if (!args->in_use) { + args->in_use = 1; + retval = _Mix_RegisterEffect_locked(channel, f, _Eff_PositionDone, (void *) args); + } + + SDL_UnlockAudio(); + return(retval); +} + + +int Mix_SetPosition(int channel, Sint16 angle, Uint8 distance) +{ + Mix_EffectFunc_t f = NULL; + Uint16 format; + int channels; + position_args *args = NULL; + Sint16 room_angle = 0; + int retval = 1; + + Mix_QuerySpec(NULL, &format, &channels); + f = get_position_effect_func(format, channels); + if (f == NULL) + return(0); + + angle = SDL_abs(angle) % 360; /* make angle between 0 and 359. */ + + SDL_LockAudio(); + args = get_position_arg(channel); + if (!args) { + SDL_UnlockAudio(); + return(0); + } + + /* it's a no-op; unregister the effect, if it's registered. */ + if ((!distance) && (!angle)) { + if (args->in_use) { + retval = _Mix_UnregisterEffect_locked(channel, f); + SDL_UnlockAudio(); + return(retval); + } else { + SDL_UnlockAudio(); + return(1); + } + } + + if (channels == 2) + { + if (angle > 180) + room_angle = 180; /* exchange left and right channels */ + else room_angle = 0; + } + + if (channels == 4 || channels == 6) + { + if (angle > 315) room_angle = 0; + else if (angle > 225) room_angle = 270; + else if (angle > 135) room_angle = 180; + else if (angle > 45) room_angle = 90; + else room_angle = 0; + } + + + distance = 255 - distance; /* flip it to scale Mix_SetDistance() uses. */ + + set_amplitudes(channels, angle, room_angle); + + args->left_u8 = speaker_amplitude[0]; + args->left_f = ((float) speaker_amplitude[0]) / 255.0f; + args->right_u8 = speaker_amplitude[1]; + args->right_f = ((float) speaker_amplitude[1]) / 255.0f; + args->left_rear_u8 = speaker_amplitude[2]; + args->left_rear_f = ((float) speaker_amplitude[2]) / 255.0f; + args->right_rear_u8 = speaker_amplitude[3]; + args->right_rear_f = ((float) speaker_amplitude[3]) / 255.0f; + args->center_u8 = speaker_amplitude[4]; + args->center_f = ((float) speaker_amplitude[4]) / 255.0f; + args->lfe_u8 = speaker_amplitude[5]; + args->lfe_f = ((float) speaker_amplitude[5]) / 255.0f; + args->distance_u8 = distance; + args->distance_f = ((float) distance) / 255.0f; + args->room_angle = room_angle; + if (!args->in_use) { + args->in_use = 1; + retval = _Mix_RegisterEffect_locked(channel, f, _Eff_PositionDone, (void *) args); + } + + SDL_UnlockAudio(); + return(retval); +} + + +/* end of effects_position.c ... */ + diff --git a/apps/plugins/sdl/SDL_mixer/effect_stereoreverse.c b/apps/plugins/sdl/SDL_mixer/effect_stereoreverse.c new file mode 100644 index 0000000..47a8bf6 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/effect_stereoreverse.c @@ -0,0 +1,117 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This file by Ryan C. Gordon (icculus@icculus.org) + + These are some internally supported special effects that use SDL_mixer's + effect callback API. They are meant for speed over quality. :) +*/ + +/* $Id$ */ + +#include "SDL.h" +#include "SDL_mixer.h" + +#define __MIX_INTERNAL_EFFECT__ +#include "effects_internal.h" + +/* profile code: + #include + #include + struct timeval tv1; + struct timeval tv2; + + gettimeofday(&tv1, NULL); + + ... do your thing here ... + + gettimeofday(&tv2, NULL); + printf("%ld\n", tv2.tv_usec - tv1.tv_usec); +*/ + + + +/* + * Stereo reversal effect...this one's pretty straightforward... + */ + +static void _Eff_reversestereo16(int chan, void *stream, int len, void *udata) +{ + /* 16 bits * 2 channels. */ + Uint32 *ptr = (Uint32 *) stream; + int i; + + for (i = 0; i < len; i += sizeof (Uint32), ptr++) { + *ptr = (((*ptr) & 0xFFFF0000) >> 16) | (((*ptr) & 0x0000FFFF) << 16); + } +} + + +static void _Eff_reversestereo8(int chan, void *stream, int len, void *udata) +{ + /* 8 bits * 2 channels. */ + Uint32 *ptr = (Uint32 *) stream; + int i; + + /* get the last two bytes if len is not divisible by four... */ + if (len % sizeof (Uint32) != 0) { + Uint16 *p = (Uint16 *) (((Uint8 *) stream) + (len - 2)); + *p = (Uint16)((((*p) & 0xFF00) >> 8) | (((*ptr) & 0x00FF) << 8)); + len -= 2; + } + + for (i = 0; i < len; i += sizeof (Uint32), ptr++) { + *ptr = (((*ptr) & 0x0000FF00) >> 8) | (((*ptr) & 0x000000FF) << 8) | + (((*ptr) & 0xFF000000) >> 8) | (((*ptr) & 0x00FF0000) << 8); + } +} + + +int Mix_SetReverseStereo(int channel, int flip) +{ + Mix_EffectFunc_t f = NULL; + int channels; + Uint16 format; + + Mix_QuerySpec(NULL, &format, &channels); + + if (channels == 2) { + if ((format & 0xFF) == 16) + f = _Eff_reversestereo16; + else if ((format & 0xFF) == 8) + f = _Eff_reversestereo8; + else { + Mix_SetError("Unsupported audio format"); + return(0); + } + + if (!flip) { + return(Mix_UnregisterEffect(channel, f)); + } else { + return(Mix_RegisterEffect(channel, f, NULL, NULL)); + } + } + + return(1); +} + + +/* end of effect_stereoreverse.c ... */ + diff --git a/apps/plugins/sdl/SDL_mixer/effects_internal.c b/apps/plugins/sdl/SDL_mixer/effects_internal.c new file mode 100644 index 0000000..353a15b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/effects_internal.c @@ -0,0 +1,121 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This file by Ryan C. Gordon (icculus@icculus.org) + + These are some helper functions for the internal mixer special effects. +*/ + +/* $Id$ */ + + + /* ------ These are used internally only. Don't touch. ------ */ + + +#include "SDL_mixer.h" + +#define __MIX_INTERNAL_EFFECT__ +#include "effects_internal.h" + +/* Should we favor speed over memory usage and/or quality of output? */ +int _Mix_effects_max_speed = 0; + + +void _Mix_InitEffects(void) +{ + _Mix_effects_max_speed = (SDL_getenv(MIX_EFFECTSMAXSPEED) != NULL); +} + +void _Mix_DeinitEffects(void) +{ + _Eff_PositionDeinit(); +} + + +void *_Eff_volume_table = NULL; + + +/* Build the volume table for Uint8-format samples. + * + * Each column of the table is a possible sample, while each row of the + * table is a volume. Volume is a Uint8, where 0 is silence and 255 is full + * volume. So _Eff_volume_table[128][mysample] would be the value of + * mysample, at half volume. + */ +void *_Eff_build_volume_table_u8(void) +{ + int volume; + int sample; + Uint8 *rc; + + if (!_Mix_effects_max_speed) { + return(NULL); + } + + if (!_Eff_volume_table) { + rc = SDL_malloc(256 * 256); + if (rc) { + _Eff_volume_table = (void *) rc; + for (volume = 0; volume < 256; volume++) { + for (sample = -128; sample < 128; sample ++) { + *rc = (Uint8)(((float) sample) * ((float) volume / 255.0)) + + 128; + rc++; + } + } + } + } + + return(_Eff_volume_table); +} + + +/* Build the volume table for Sint8-format samples. + * + * Each column of the table is a possible sample, while each row of the + * table is a volume. Volume is a Uint8, where 0 is silence and 255 is full + * volume. So _Eff_volume_table[128][mysample+128] would be the value of + * mysample, at half volume. + */ +void *_Eff_build_volume_table_s8(void) +{ + int volume; + int sample; + Sint8 *rc; + + if (!_Eff_volume_table) { + rc = SDL_malloc(256 * 256); + if (rc) { + _Eff_volume_table = (void *) rc; + for (volume = 0; volume < 256; volume++) { + for (sample = -128; sample < 128; sample ++) { + *rc = (Sint8)(((float) sample) * ((float) volume / 255.0)); + rc++; + } + } + } + } + + return(_Eff_volume_table); +} + + +/* end of effects.c ... */ + diff --git a/apps/plugins/sdl/SDL_mixer/effects_internal.h b/apps/plugins/sdl/SDL_mixer/effects_internal.h new file mode 100644 index 0000000..12b4b3b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/effects_internal.h @@ -0,0 +1,60 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#ifndef _INCLUDE_EFFECTS_INTERNAL_H_ +#define _INCLUDE_EFFECTS_INTERNAL_H_ + +#ifndef __MIX_INTERNAL_EFFECT__ +#error You should not include this file or use these functions. +#endif + +#include "SDL_mixer.h" + +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +extern int _Mix_effects_max_speed; +extern void *_Eff_volume_table; +void *_Eff_build_volume_table_u8(void); +void *_Eff_build_volume_table_s8(void); + +void _Mix_InitEffects(void); +void _Mix_DeinitEffects(void); +void _Eff_PositionDeinit(void); + +int _Mix_RegisterEffect_locked(int channel, Mix_EffectFunc_t f, + Mix_EffectDone_t d, void *arg); +int _Mix_UnregisterEffect_locked(int channel, Mix_EffectFunc_t f); +int _Mix_UnregisterAllEffects_locked(int channel); + + +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +} +#endif + + +#endif + diff --git a/apps/plugins/sdl/SDL_mixer/fluidsynth.c b/apps/plugins/sdl/SDL_mixer/fluidsynth.c new file mode 100644 index 0000000..d680576 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/fluidsynth.c @@ -0,0 +1,219 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + James Le Cuirot + chewi@aura-online.co.uk +*/ + +#ifdef USE_FLUIDSYNTH_MIDI + +#include "SDL_mixer.h" +#include "fluidsynth.h" + +static Uint16 format; +static Uint8 channels; +static int freq; + +int fluidsynth_check_soundfont(const char *path, void *data) +{ + FILE *file = fopen(path, "r"); + + if (file) { + fclose(file); + return 1; + } else { + Mix_SetError("Failed to access the SoundFont %s", path); + return 0; + } +} + +int fluidsynth_load_soundfont(const char *path, void *data) +{ + /* If this fails, it's too late to try Timidity so pray that at least one works. */ + fluidsynth.fluid_synth_sfload((fluid_synth_t*) data, path, 1); + return 1; +} + +int fluidsynth_init(SDL_AudioSpec *mixer) +{ + if (!Mix_EachSoundFont(fluidsynth_check_soundfont, NULL)) + return -1; + + format = mixer->format; + channels = mixer->channels; + freq = mixer->freq; + + return 0; +} + +static FluidSynthMidiSong *fluidsynth_loadsong_common(int (*function)(FluidSynthMidiSong*, void*), void *data) +{ + FluidSynthMidiSong *song; + fluid_settings_t *settings = NULL; + + if (!Mix_Init(MIX_INIT_FLUIDSYNTH)) { + return NULL; + } + + if ((song = SDL_malloc(sizeof(FluidSynthMidiSong)))) { + memset(song, 0, sizeof(FluidSynthMidiSong)); + + if (SDL_BuildAudioCVT(&song->convert, AUDIO_S16, 2, freq, format, channels, freq) >= 0) { + if ((settings = fluidsynth.new_fluid_settings())) { + fluidsynth.fluid_settings_setnum(settings, "synth.sample-rate", (double) freq); + + if ((song->synth = fluidsynth.new_fluid_synth(settings))) { + if (Mix_EachSoundFont(fluidsynth_load_soundfont, (void*) song->synth)) { + if ((song->player = fluidsynth.new_fluid_player(song->synth))) { + if (function(song, data)) return song; + fluidsynth.delete_fluid_player(song->player); + } else { + Mix_SetError("Failed to create FluidSynth player"); + } + } + fluidsynth.delete_fluid_synth(song->synth); + } else { + Mix_SetError("Failed to create FluidSynth synthesizer"); + } + fluidsynth.delete_fluid_settings(settings); + } else { + Mix_SetError("Failed to create FluidSynth settings"); + } + } else { + Mix_SetError("Failed to set up audio conversion"); + } + SDL_free(song); + } else { + Mix_SetError("Insufficient memory for song"); + } + return NULL; +} + +static int fluidsynth_loadsong_RW_internal(FluidSynthMidiSong *song, void *data) +{ + off_t offset; + size_t size; + char *buffer; + SDL_RWops *rw = (SDL_RWops*) data; + + offset = SDL_RWtell(rw); + SDL_RWseek(rw, 0, RW_SEEK_END); + size = SDL_RWtell(rw) - offset; + SDL_RWseek(rw, offset, RW_SEEK_SET); + + if ((buffer = (char*) SDL_malloc(size))) { + if(SDL_RWread(rw, buffer, size, 1) == 1) { + if (fluidsynth.fluid_player_add_mem(song->player, buffer, size) == FLUID_OK) { + return 1; + } else { + Mix_SetError("FluidSynth failed to load in-memory song"); + } + } else { + Mix_SetError("Failed to read in-memory song"); + } + SDL_free(buffer); + } else { + Mix_SetError("Insufficient memory for song"); + } + return 0; +} + +FluidSynthMidiSong *fluidsynth_loadsong_RW(SDL_RWops *rw, int freerw) +{ + FluidSynthMidiSong *song; + + song = fluidsynth_loadsong_common(fluidsynth_loadsong_RW_internal, (void*) rw); + if (freerw) { + SDL_RWclose(rw); + } + return song; +} + +void fluidsynth_freesong(FluidSynthMidiSong *song) +{ + if (!song) return; + fluidsynth.delete_fluid_player(song->player); + fluidsynth.delete_fluid_settings(fluidsynth.fluid_synth_get_settings(song->synth)); + fluidsynth.delete_fluid_synth(song->synth); + SDL_free(song); +} + +void fluidsynth_start(FluidSynthMidiSong *song) +{ + fluidsynth.fluid_player_set_loop(song->player, 1); + fluidsynth.fluid_player_play(song->player); +} + +void fluidsynth_stop(FluidSynthMidiSong *song) +{ + fluidsynth.fluid_player_stop(song->player); +} + +int fluidsynth_active(FluidSynthMidiSong *song) +{ + return fluidsynth.fluid_player_get_status(song->player) == FLUID_PLAYER_PLAYING ? 1 : 0; +} + +void fluidsynth_setvolume(FluidSynthMidiSong *song, int volume) +{ + /* FluidSynth's default is 0.2. Make 0.8 the maximum. */ + fluidsynth.fluid_synth_set_gain(song->synth, (float) (volume * 0.00625)); +} + +int fluidsynth_playsome(FluidSynthMidiSong *song, void *dest, int dest_len) +{ + int result = -1; + int frames = dest_len / channels / ((format & 0xFF) / 8); + int src_len = frames * 4; /* 16-bit stereo */ + void *src = dest; + + if (dest_len < src_len) { + if (!(src = SDL_malloc(src_len))) { + Mix_SetError("Insufficient memory for audio conversion"); + return result; + } + } + + if (fluidsynth.fluid_synth_write_s16(song->synth, frames, src, 0, 2, src, 1, 2) != FLUID_OK) { + Mix_SetError("Error generating FluidSynth audio"); + goto finish; + } + + song->convert.buf = src; + song->convert.len = src_len; + + if (SDL_ConvertAudio(&song->convert) < 0) { + Mix_SetError("Error during audio conversion"); + goto finish; + } + + if (src != dest) + memcpy(dest, src, dest_len); + + result = 0; + +finish: + if (src != dest) + SDL_free(src); + + return result; +} + +#endif /* USE_FLUIDSYNTH_MIDI */ diff --git a/apps/plugins/sdl/SDL_mixer/fluidsynth.h b/apps/plugins/sdl/SDL_mixer/fluidsynth.h new file mode 100644 index 0000000..47538bb --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/fluidsynth.h @@ -0,0 +1,51 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + James Le Cuirot + chewi@aura-online.co.uk +*/ + +#ifndef _FLUIDSYNTH_H_ +#define _FLUIDSYNTH_H_ + +#ifdef USE_FLUIDSYNTH_MIDI + +#include "dynamic_fluidsynth.h" +#include +#include + +typedef struct { + SDL_AudioCVT convert; + fluid_synth_t *synth; + fluid_player_t* player; +} FluidSynthMidiSong; + +int fluidsynth_init(SDL_AudioSpec *mixer); +FluidSynthMidiSong *fluidsynth_loadsong_RW(SDL_RWops *rw, int freerw); +void fluidsynth_freesong(FluidSynthMidiSong *song); +void fluidsynth_start(FluidSynthMidiSong *song); +void fluidsynth_stop(FluidSynthMidiSong *song); +int fluidsynth_active(FluidSynthMidiSong *song); +void fluidsynth_setvolume(FluidSynthMidiSong *song, int volume); +int fluidsynth_playsome(FluidSynthMidiSong *song, void *stream, int len); + +#endif /* USE_FLUIDSYNTH_MIDI */ + +#endif /* _FLUIDSYNTH_H_ */ diff --git a/apps/plugins/sdl/SDL_mixer/load_aiff.c b/apps/plugins/sdl/SDL_mixer/load_aiff.c new file mode 100644 index 0000000..ac71e42 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_aiff.c @@ -0,0 +1,247 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode an AIFF file into a waveform. + It's pretty straightforward once you get going. The only + externally-callable function is Mix_LoadAIFF_RW(), which is meant to + act as identically to SDL_LoadWAV_RW() as possible. + + This file by Torbjörn Andersson (torbjorn.andersson@eurotime.se) + 8SVX file support added by Marc Le Douarain (mavati@club-internet.fr) + in december 2002. +*/ + +/* $Id$ */ + +#include "SDL_endian.h" +#include "SDL_mixer.h" +#include "load_aiff.h" + +/*********************************************/ +/* Define values for AIFF (IFF audio) format */ +/*********************************************/ +#define FORM 0x4d524f46 /* "FORM" */ + +#define AIFF 0x46464941 /* "AIFF" */ +#define SSND 0x444e5353 /* "SSND" */ +#define COMM 0x4d4d4f43 /* "COMM" */ + +#define _8SVX 0x58565338 /* "8SVX" */ +#define VHDR 0x52444856 /* "VHDR" */ +#define BODY 0x59444F42 /* "BODY" */ + +/* This function was taken from libsndfile. I don't pretend to fully + * understand it. + */ + +static Uint32 SANE_to_Uint32 (Uint8 *sanebuf) +{ + /* Is the frequency outside of what we can represent with Uint32? */ + if ( (sanebuf[0] & 0x80) || (sanebuf[0] <= 0x3F) || (sanebuf[0] > 0x40) + || (sanebuf[0] == 0x40 && sanebuf[1] > 0x1C) ) + return 0; + + return ((sanebuf[2] << 23) | (sanebuf[3] << 15) | (sanebuf[4] << 7) + | (sanebuf[5] >> 1)) >> (29 - sanebuf[1]); +} + +/* This function is based on SDL_LoadWAV_RW(). */ + +SDL_AudioSpec *Mix_LoadAIFF_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len) +{ + int was_error; + int found_SSND; + int found_COMM; + int found_VHDR; + int found_BODY; + long start = 0; + + Uint32 chunk_type; + Uint32 chunk_length; + long next_chunk; + + /* AIFF magic header */ + Uint32 FORMchunk; + Uint32 AIFFmagic; + + /* SSND chunk */ + Uint32 offset; + Uint32 blocksize; + + /* COMM format chunk */ + Uint16 channels = 0; + Uint32 numsamples = 0; + Uint16 samplesize = 0; + Uint8 sane_freq[10]; + Uint32 frequency = 0; + + /* Make sure we are passed a valid data source */ + was_error = 0; + if ( src == NULL ) { + was_error = 1; + goto done; + } + + FORMchunk = SDL_ReadLE32(src); + chunk_length = SDL_ReadBE32(src); + if ( chunk_length == AIFF ) { /* The FORMchunk has already been read */ + AIFFmagic = chunk_length; + chunk_length = FORMchunk; + FORMchunk = FORM; + } else { + AIFFmagic = SDL_ReadLE32(src); + } + if ( (FORMchunk != FORM) || ( (AIFFmagic != AIFF) && (AIFFmagic != _8SVX) ) ) { + SDL_SetError("Unrecognized file type (not AIFF nor 8SVX)"); + was_error = 1; + goto done; + } + + /* TODO: Better santity-checking. */ + + found_SSND = 0; + found_COMM = 0; + found_VHDR = 0; + found_BODY = 0; + + do { + chunk_type = SDL_ReadLE32(src); + chunk_length = SDL_ReadBE32(src); + next_chunk = SDL_RWtell(src) + chunk_length; + /* Paranoia to avoid infinite loops */ + if (chunk_length == 0) + break; + + switch (chunk_type) { + case SSND: + found_SSND = 1; + offset = SDL_ReadBE32(src); + blocksize = SDL_ReadBE32(src); + start = SDL_RWtell(src) + offset; + break; + + case COMM: + found_COMM = 1; + channels = SDL_ReadBE16(src); + numsamples = SDL_ReadBE32(src); + samplesize = SDL_ReadBE16(src); + SDL_RWread(src, sane_freq, sizeof(sane_freq), 1); + frequency = SANE_to_Uint32(sane_freq); + if (frequency == 0) { + SDL_SetError("Bad AIFF sample frequency"); + was_error = 1; + goto done; + } + break; + + case VHDR: + found_VHDR = 1; + SDL_ReadBE32(src); + SDL_ReadBE32(src); + SDL_ReadBE32(src); + frequency = SDL_ReadBE16(src); + channels = 1; + samplesize = 8; + break; + + case BODY: + found_BODY = 1; + numsamples = chunk_length; + start = SDL_RWtell(src); + break; + + default: + break; + } + /* a 0 pad byte can be stored for any odd-length chunk */ + if (chunk_length&1) + next_chunk++; + } while ( ( ( (AIFFmagic == AIFF) && ( !found_SSND || !found_COMM ) ) + || ( (AIFFmagic == _8SVX ) && ( !found_VHDR || !found_BODY ) ) ) + && SDL_RWseek(src, next_chunk, RW_SEEK_SET) != 1 ); + + if ( (AIFFmagic == AIFF) && !found_SSND ) { + SDL_SetError("Bad AIFF (no SSND chunk)"); + was_error = 1; + goto done; + } + + if ( (AIFFmagic == AIFF) && !found_COMM ) { + SDL_SetError("Bad AIFF (no COMM chunk)"); + was_error = 1; + goto done; + } + + if ( (AIFFmagic == _8SVX) && !found_VHDR ) { + SDL_SetError("Bad 8SVX (no VHDR chunk)"); + was_error = 1; + goto done; + } + + if ( (AIFFmagic == _8SVX) && !found_BODY ) { + SDL_SetError("Bad 8SVX (no BODY chunk)"); + was_error = 1; + goto done; + } + + /* Decode the audio data format */ + memset(spec, 0, sizeof(*spec)); + spec->freq = frequency; + switch (samplesize) { + case 8: + spec->format = AUDIO_S8; + break; + case 16: + spec->format = AUDIO_S16MSB; + break; + default: + SDL_SetError("Unsupported AIFF samplesize"); + was_error = 1; + goto done; + } + spec->channels = (Uint8) channels; + spec->samples = 4096; /* Good default buffer size */ + + *audio_len = channels * numsamples * (samplesize / 8); + *audio_buf = (Uint8 *)SDL_malloc(*audio_len); + if ( *audio_buf == NULL ) { + SDL_SetError("Out of memory"); + return(NULL); + } + SDL_RWseek(src, start, RW_SEEK_SET); + if ( SDL_RWread(src, *audio_buf, *audio_len, 1) != 1 ) { + SDL_SetError("Unable to read audio data"); + return(NULL); + } + + /* Don't return a buffer that isn't a multiple of samplesize */ + *audio_len &= ~((samplesize / 8) - 1); + +done: + if ( freesrc && src ) { + SDL_RWclose(src); + } + if ( was_error ) { + spec = NULL; + } + return(spec); +} + diff --git a/apps/plugins/sdl/SDL_mixer/load_aiff.h b/apps/plugins/sdl/SDL_mixer/load_aiff.h new file mode 100644 index 0000000..ed55d36 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_aiff.h @@ -0,0 +1,31 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2009 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Library General Public + License as published by the Free Software Foundation; either + version 2 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Library General Public License for more details. + + You should have received a copy of the GNU Library General Public + License along with this library; if not, write to the Free + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA + + This is the source needed to decode an AIFF file into a waveform. + It's pretty straightforward once you get going. The only + externally-callable function is Mix_LoadAIFF_RW(), which is meant to + act as identically to SDL_LoadWAV_RW() as possible. + + This file by Torbjörn Andersson (torbjorn.andersson@eurotime.se) +*/ + +/* $Id$ */ + +/* Don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadAIFF_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); diff --git a/apps/plugins/sdl/SDL_mixer/load_flac.c b/apps/plugins/sdl/SDL_mixer/load_flac.c new file mode 100644 index 0000000..151de63 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_flac.c @@ -0,0 +1,338 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode a FLAC into a waveform. + ~ Austen Dicken (admin@cvpcs.org). +*/ + +#ifdef FLAC_MUSIC + +#include "SDL_mutex.h" +#include "SDL_endian.h" +#include "SDL_timer.h" + +#include "SDL_mixer.h" +#include "dynamic_flac.h" +#include "load_flac.h" + +#include + +typedef struct { + SDL_RWops* sdl_src; + SDL_AudioSpec* sdl_spec; + Uint8** sdl_audio_buf; + Uint32* sdl_audio_len; + int sdl_audio_read; + FLAC__uint64 flac_total_samples; + unsigned flac_bps; +} FLAC_SDL_Data; + +static FLAC__StreamDecoderReadStatus flac_read_load_cb( + const FLAC__StreamDecoder *decoder, + FLAC__byte buffer[], + size_t *bytes, + void *client_data) +{ + // make sure there is something to be reading + if (*bytes > 0) { + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + + *bytes = SDL_RWread (data->sdl_src, buffer, sizeof (FLAC__byte), + *bytes); + + if(*bytes < 0) { // error in read + return FLAC__STREAM_DECODER_READ_STATUS_ABORT; + } + else if(*bytes == 0) { // no data was read (EOF) + return FLAC__STREAM_DECODER_READ_STATUS_END_OF_STREAM; + } + else { // data was read, continue + return FLAC__STREAM_DECODER_READ_STATUS_CONTINUE; + } + } + else { + return FLAC__STREAM_DECODER_READ_STATUS_ABORT; + } +} + +static FLAC__StreamDecoderSeekStatus flac_seek_load_cb( + const FLAC__StreamDecoder *decoder, + FLAC__uint64 absolute_byte_offset, + void *client_data) +{ + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + + if (SDL_RWseek (data->sdl_src, absolute_byte_offset, RW_SEEK_SET) < 0) { + return FLAC__STREAM_DECODER_SEEK_STATUS_ERROR; + } + else { + return FLAC__STREAM_DECODER_SEEK_STATUS_OK; + } +} + +static FLAC__StreamDecoderTellStatus flac_tell_load_cb( + const FLAC__StreamDecoder *decoder, + FLAC__uint64 *absolute_byte_offset, + void *client_data) +{ + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + + int pos = SDL_RWtell (data->sdl_src); + + if (pos < 0) { + return FLAC__STREAM_DECODER_TELL_STATUS_ERROR; + } + else { + *absolute_byte_offset = (FLAC__uint64)pos; + return FLAC__STREAM_DECODER_TELL_STATUS_OK; + } +} + +static FLAC__StreamDecoderLengthStatus flac_length_load_cb( + const FLAC__StreamDecoder *decoder, + FLAC__uint64 *stream_length, + void *client_data) +{ + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + + int pos = SDL_RWtell (data->sdl_src); + int length = SDL_RWseek (data->sdl_src, 0, RW_SEEK_END); + + if (SDL_RWseek (data->sdl_src, pos, RW_SEEK_SET) != pos || length < 0) { + /* there was an error attempting to return the stream to the original + * position, or the length was invalid. */ + return FLAC__STREAM_DECODER_LENGTH_STATUS_ERROR; + } + else { + *stream_length = (FLAC__uint64)length; + return FLAC__STREAM_DECODER_LENGTH_STATUS_OK; + } +} + +static FLAC__bool flac_eof_load_cb(const FLAC__StreamDecoder *decoder, + void *client_data) +{ + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + + int pos = SDL_RWtell (data->sdl_src); + int end = SDL_RWseek (data->sdl_src, 0, RW_SEEK_END); + + // was the original position equal to the end (a.k.a. the seek didn't move)? + if (pos == end) { + // must be EOF + return true; + } + else { + // not EOF, return to the original position + SDL_RWseek (data->sdl_src, pos, RW_SEEK_SET); + + return false; + } +} + +static FLAC__StreamDecoderWriteStatus flac_write_load_cb( + const FLAC__StreamDecoder *decoder, + const FLAC__Frame *frame, + const FLAC__int32 *const buffer[], + void *client_data) +{ + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + size_t i; + Uint8 *buf; + + if (data->flac_total_samples == 0) { + SDL_SetError ("Given FLAC file does not specify its sample count."); + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + + if (data->sdl_spec->channels != 2 || data->flac_bps != 16) { + SDL_SetError ("Current FLAC support is only for 16 bit Stereo files."); + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + + // check if it is the first audio frame so we can initialize the output + // buffer + if (frame->header.number.sample_number == 0) { + *(data->sdl_audio_len) = data->sdl_spec->size; + data->sdl_audio_read = 0; + *(data->sdl_audio_buf) = SDL_malloc (*(data->sdl_audio_len)); + + if (*(data->sdl_audio_buf) == NULL) { + SDL_SetError + ("Unable to allocate memory to store the FLAC stream."); + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + } + + buf = *(data->sdl_audio_buf); + + for (i = 0; i < frame->header.blocksize; i++) { + FLAC__int16 i16; + FLAC__uint16 ui16; + + i16 = (FLAC__int16)buffer[0][i]; + ui16 = (FLAC__uint16)i16; + + *(buf + (data->sdl_audio_read++)) = (char)(ui16); + *(buf + (data->sdl_audio_read++)) = (char)(ui16 >> 8); + + i16 = (FLAC__int16)buffer[1][i]; + ui16 = (FLAC__uint16)i16; + + *(buf + (data->sdl_audio_read++)) = (char)(ui16); + *(buf + (data->sdl_audio_read++)) = (char)(ui16 >> 8); + } + + return FLAC__STREAM_DECODER_WRITE_STATUS_CONTINUE; +} + +static void flac_metadata_load_cb( + const FLAC__StreamDecoder *decoder, + const FLAC__StreamMetadata *metadata, + void *client_data) +{ + FLAC_SDL_Data *data = (FLAC_SDL_Data *)client_data; + FLAC__uint64 total_samples; + unsigned bps; + + if (metadata->type == FLAC__METADATA_TYPE_STREAMINFO) { + // save the metadata right now for use later on + *(data->sdl_audio_buf) = NULL; + *(data->sdl_audio_len) = 0; + memset (data->sdl_spec, '\0', sizeof (SDL_AudioSpec)); + + data->sdl_spec->format = AUDIO_S16; + data->sdl_spec->freq = (int)(metadata->data.stream_info.sample_rate); + data->sdl_spec->channels = (Uint8)(metadata->data.stream_info.channels); + data->sdl_spec->samples = 8192; /* buffer size */ + + total_samples = metadata->data.stream_info.total_samples; + bps = metadata->data.stream_info.bits_per_sample; + + data->sdl_spec->size = total_samples * data->sdl_spec->channels * + (bps / 8); + data->flac_total_samples = total_samples; + data->flac_bps = bps; + } +} + +static void flac_error_load_cb( + const FLAC__StreamDecoder *decoder, + FLAC__StreamDecoderErrorStatus status, + void *client_data) +{ + // print an SDL error based on the error status + switch (status) { + case FLAC__STREAM_DECODER_ERROR_STATUS_LOST_SYNC: + SDL_SetError ("Error processing the FLAC file [LOST_SYNC]."); + break; + case FLAC__STREAM_DECODER_ERROR_STATUS_BAD_HEADER: + SDL_SetError ("Error processing the FLAC file [BAD_HEADER]."); + break; + case FLAC__STREAM_DECODER_ERROR_STATUS_FRAME_CRC_MISMATCH: + SDL_SetError ("Error processing the FLAC file [CRC_MISMATCH]."); + break; + case FLAC__STREAM_DECODER_ERROR_STATUS_UNPARSEABLE_STREAM: + SDL_SetError ("Error processing the FLAC file [UNPARSEABLE]."); + break; + default: + SDL_SetError ("Error processing the FLAC file [UNKNOWN]."); + break; + } +} + +/* don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadFLAC_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len) +{ + FLAC__StreamDecoder *decoder = 0; + FLAC__StreamDecoderInitStatus init_status; + int was_error = 1; + int was_init = 0; + Uint32 samplesize; + + // create the client data passing information + FLAC_SDL_Data* client_data; + client_data = (FLAC_SDL_Data *)SDL_malloc (sizeof (FLAC_SDL_Data)); + + if ((!src) || (!audio_buf) || (!audio_len)) /* sanity checks. */ + goto done; + + if (!Mix_Init(MIX_INIT_FLAC)) + goto done; + + if ((decoder = flac.FLAC__stream_decoder_new ()) == NULL) { + SDL_SetError ("Unable to allocate FLAC decoder."); + goto done; + } + + init_status = flac.FLAC__stream_decoder_init_stream (decoder, + flac_read_load_cb, flac_seek_load_cb, + flac_tell_load_cb, flac_length_load_cb, + flac_eof_load_cb, flac_write_load_cb, + flac_metadata_load_cb, flac_error_load_cb, + client_data); + + if (init_status != FLAC__STREAM_DECODER_INIT_STATUS_OK) { + SDL_SetError ("Unable to initialize FLAC stream decoder."); + goto done; + } + + was_init = 1; + + client_data->sdl_src = src; + client_data->sdl_spec = spec; + client_data->sdl_audio_buf = audio_buf; + client_data->sdl_audio_len = audio_len; + + if (!flac.FLAC__stream_decoder_process_until_end_of_stream (decoder)) { + SDL_SetError ("Unable to process FLAC file."); + goto done; + } + + was_error = 0; + + /* Don't return a buffer that isn't a multiple of samplesize */ + samplesize = ((spec->format & 0xFF) / 8) * spec->channels; + *audio_len &= ~(samplesize - 1); + +done: + if (was_init && decoder) { + flac.FLAC__stream_decoder_finish (decoder); + } + + if (decoder) { + flac.FLAC__stream_decoder_delete (decoder); + } + + if (src) { + if (freesrc) + SDL_RWclose (src); + else + SDL_RWseek (src, 0, RW_SEEK_SET); + } + + if (was_error) + spec = NULL; + + return spec; +} + +#endif // FLAC_MUSIC diff --git a/apps/plugins/sdl/SDL_mixer/load_flac.h b/apps/plugins/sdl/SDL_mixer/load_flac.h new file mode 100644 index 0000000..63fcd4b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_flac.h @@ -0,0 +1,31 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode a FLAC into a waveform. + ~ Austen Dicken (admin@cvpcs.org). +*/ + +/* $Id: $ */ + +#ifdef FLAC_MUSIC +/* Don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadFLAC_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); +#endif diff --git a/apps/plugins/sdl/SDL_mixer/load_ogg.c b/apps/plugins/sdl/SDL_mixer/load_ogg.c new file mode 100644 index 0000000..829bbdb --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_ogg.c @@ -0,0 +1,159 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode an Ogg Vorbis into a waveform. + This file by Vaclav Slavik (vaclav.slavik@matfyz.cz). +*/ + +/* $Id$ */ + +#ifdef OGG_MUSIC + +#include "SDL_mutex.h" +#include "SDL_endian.h" +#include "SDL_timer.h" + +#include "SDL_mixer.h" +#include "dynamic_ogg.h" +#include "load_ogg.h" + +static size_t sdl_read_func(void *ptr, size_t size, size_t nmemb, void *datasource) +{ + return SDL_RWread((SDL_RWops*)datasource, ptr, size, nmemb); +} + +static int sdl_seek_func(void *datasource, ogg_int64_t offset, int whence) +{ + return SDL_RWseek((SDL_RWops*)datasource, (int)offset, whence); +} + +static int sdl_close_func_freesrc(void *datasource) +{ + return SDL_RWclose((SDL_RWops*)datasource); +} + +static int sdl_close_func_nofreesrc(void *datasource) +{ + return SDL_RWseek((SDL_RWops*)datasource, 0, RW_SEEK_SET); +} + +static long sdl_tell_func(void *datasource) +{ + return SDL_RWtell((SDL_RWops*)datasource); +} + + +/* don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadOGG_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len) +{ + OggVorbis_File vf; + ov_callbacks callbacks; + vorbis_info *info; + Uint8 *buf; + int bitstream = -1; + long samplesize; + long samples; + int read, to_read; + int must_close = 1; + int was_error = 1; + + if ( (!src) || (!audio_buf) || (!audio_len) ) /* sanity checks. */ + goto done; + + if ( !Mix_Init(MIX_INIT_OGG) ) + goto done; + + callbacks.read_func = sdl_read_func; + callbacks.seek_func = sdl_seek_func; + callbacks.tell_func = sdl_tell_func; + callbacks.close_func = freesrc ? + sdl_close_func_freesrc : sdl_close_func_nofreesrc; + + if (vorbis.ov_open_callbacks(src, &vf, NULL, 0, callbacks) != 0) + { + SDL_SetError("OGG bitstream is not valid Vorbis stream!"); + goto done; + } + + must_close = 0; + + info = vorbis.ov_info(&vf, -1); + + *audio_buf = NULL; + *audio_len = 0; + memset(spec, '\0', sizeof (SDL_AudioSpec)); + + spec->format = AUDIO_S16; + spec->channels = info->channels; + spec->freq = info->rate; + spec->samples = 4096; /* buffer size */ + + samples = (long)vorbis.ov_pcm_total(&vf, -1); + + *audio_len = spec->size = samples * spec->channels * 2; + *audio_buf = SDL_malloc(*audio_len); + if (*audio_buf == NULL) + goto done; + + buf = *audio_buf; + to_read = *audio_len; +#ifdef OGG_USE_TREMOR + for (read = vorbis.ov_read(&vf, (char *)buf, to_read, &bitstream); + read > 0; + read = vorbis.ov_read(&vf, (char *)buf, to_read, &bitstream)) +#else + for (read = vorbis.ov_read(&vf, (char *)buf, to_read, 0/*LE*/, 2/*16bit*/, 1/*signed*/, &bitstream); + read > 0; + read = vorbis.ov_read(&vf, (char *)buf, to_read, 0, 2, 1, &bitstream)) +#endif + { + if (read == OV_HOLE || read == OV_EBADLINK) + break; /* error */ + + to_read -= read; + buf += read; + } + + vorbis.ov_clear(&vf); + was_error = 0; + + /* Don't return a buffer that isn't a multiple of samplesize */ + samplesize = ((spec->format & 0xFF)/8)*spec->channels; + *audio_len &= ~(samplesize-1); + +done: + if (src && must_close) + { + if (freesrc) + SDL_RWclose(src); + else + SDL_RWseek(src, 0, RW_SEEK_SET); + } + + if ( was_error ) + spec = NULL; + + return(spec); +} /* Mix_LoadOGG_RW */ + +/* end of load_ogg.c ... */ + +#endif diff --git a/apps/plugins/sdl/SDL_mixer/load_ogg.h b/apps/plugins/sdl/SDL_mixer/load_ogg.h new file mode 100644 index 0000000..e63b04f --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_ogg.h @@ -0,0 +1,31 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode an Ogg Vorbis into a waveform. + This file by Vaclav Slavik (vaclav.slavik@matfyz.cz). +*/ + +/* $Id$ */ + +#ifdef OGG_MUSIC +/* Don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadOGG_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); +#endif diff --git a/apps/plugins/sdl/SDL_mixer/load_voc.c b/apps/plugins/sdl/SDL_mixer/load_voc.c new file mode 100644 index 0000000..2e7798e --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_voc.c @@ -0,0 +1,458 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode a Creative Labs VOC file into a + waveform. It's pretty straightforward once you get going. The only + externally-callable function is Mix_LoadVOC_RW(), which is meant to + act as identically to SDL_LoadWAV_RW() as possible. + + This file by Ryan C. Gordon (icculus@icculus.org). + + Heavily borrowed from sox v12.17.1's voc.c. + (http://www.freshmeat.net/projects/sox/) +*/ + +/* $Id$ */ + +#include "SDL_mutex.h" +#include "SDL_endian.h" +#include "SDL_timer.h" + +#include "SDL_mixer.h" +#include "load_voc.h" + +/* Private data for VOC file */ +typedef struct vocstuff { + Uint32 rest; /* bytes remaining in current block */ + Uint32 rate; /* rate code (byte) of this chunk */ + int silent; /* sound or silence? */ + Uint32 srate; /* rate code (byte) of silence */ + Uint32 blockseek; /* start of current output block */ + Uint32 samples; /* number of samples output */ + Uint32 size; /* word length of data */ + Uint8 channels; /* number of sound channels */ + int has_extended; /* Has an extended block been read? */ +} vs_t; + +/* Size field */ +/* SJB: note that the 1st 3 are sometimes used as sizeof(type) */ +#define ST_SIZE_BYTE 1 +#define ST_SIZE_8BIT 1 +#define ST_SIZE_WORD 2 +#define ST_SIZE_16BIT 2 +#define ST_SIZE_DWORD 4 +#define ST_SIZE_32BIT 4 +#define ST_SIZE_FLOAT 5 +#define ST_SIZE_DOUBLE 6 +#define ST_SIZE_IEEE 7 /* IEEE 80-bit floats. */ + +/* Style field */ +#define ST_ENCODING_UNSIGNED 1 /* unsigned linear: Sound Blaster */ +#define ST_ENCODING_SIGN2 2 /* signed linear 2's comp: Mac */ +#define ST_ENCODING_ULAW 3 /* U-law signed logs: US telephony, SPARC */ +#define ST_ENCODING_ALAW 4 /* A-law signed logs: non-US telephony */ +#define ST_ENCODING_ADPCM 5 /* Compressed PCM */ +#define ST_ENCODING_IMA_ADPCM 6 /* Compressed PCM */ +#define ST_ENCODING_GSM 7 /* GSM 6.10 33-byte frame lossy compression */ + +#define VOC_TERM 0 +#define VOC_DATA 1 +#define VOC_CONT 2 +#define VOC_SILENCE 3 +#define VOC_MARKER 4 +#define VOC_TEXT 5 +#define VOC_LOOP 6 +#define VOC_LOOPEND 7 +#define VOC_EXTENDED 8 +#define VOC_DATA_16 9 + + +static int voc_check_header(SDL_RWops *src) +{ + /* VOC magic header */ + Uint8 signature[20]; /* "Creative Voice File\032" */ + Uint16 datablockofs; + + SDL_RWseek(src, 0, RW_SEEK_SET); + + if (SDL_RWread(src, signature, sizeof (signature), 1) != 1) + return(0); + + if (memcmp(signature, "Creative Voice File\032", sizeof (signature)) != 0) { + SDL_SetError("Unrecognized file type (not VOC)"); + return(0); + } + + /* get the offset where the first datablock is located */ + if (SDL_RWread(src, &datablockofs, sizeof (Uint16), 1) != 1) + return(0); + + datablockofs = SDL_SwapLE16(datablockofs); + + if (SDL_RWseek(src, datablockofs, RW_SEEK_SET) != datablockofs) + return(0); + + return(1); /* success! */ +} /* voc_check_header */ + + +/* Read next block header, save info, leave position at start of data */ +static int voc_get_block(SDL_RWops *src, vs_t *v, SDL_AudioSpec *spec) +{ + Uint8 bits24[3]; + Uint8 uc, block; + Uint32 sblen; + Uint16 new_rate_short; + Uint32 new_rate_long; + Uint8 trash[6]; + Uint16 period; + unsigned int i; + + v->silent = 0; + while (v->rest == 0) + { + if (SDL_RWread(src, &block, sizeof (block), 1) != 1) + return 1; /* assume that's the end of the file. */ + + if (block == VOC_TERM) + return 1; + + if (SDL_RWread(src, bits24, sizeof (bits24), 1) != 1) + return 1; /* assume that's the end of the file. */ + + /* Size is an 24-bit value. Ugh. */ + sblen = ( (bits24[0]) | (bits24[1] << 8) | (bits24[2] << 16) ); + + switch(block) + { + case VOC_DATA: + if (SDL_RWread(src, &uc, sizeof (uc), 1) != 1) + return 0; + + /* When DATA block preceeded by an EXTENDED */ + /* block, the DATA blocks rate value is invalid */ + if (!v->has_extended) + { + if (uc == 0) + { + SDL_SetError("VOC Sample rate is zero?"); + return 0; + } + + if ((v->rate != -1) && (uc != v->rate)) + { + SDL_SetError("VOC sample rate codes differ"); + return 0; + } + + v->rate = uc; + spec->freq = (Uint16)(1000000.0/(256 - v->rate)); + v->channels = 1; + } + + if (SDL_RWread(src, &uc, sizeof (uc), 1) != 1) + return 0; + + if (uc != 0) + { + SDL_SetError("VOC decoder only interprets 8-bit data"); + return 0; + } + + v->has_extended = 0; + v->rest = sblen - 2; + v->size = ST_SIZE_BYTE; + return 1; + + case VOC_DATA_16: + if (SDL_RWread(src, &new_rate_long, sizeof (new_rate_long), 1) != 1) + return 0; + new_rate_long = SDL_SwapLE32(new_rate_long); + if (new_rate_long == 0) + { + SDL_SetError("VOC Sample rate is zero?"); + return 0; + } + if ((v->rate != -1) && (new_rate_long != v->rate)) + { + SDL_SetError("VOC sample rate codes differ"); + return 0; + } + v->rate = new_rate_long; + spec->freq = new_rate_long; + + if (SDL_RWread(src, &uc, sizeof (uc), 1) != 1) + return 0; + + switch (uc) + { + case 8: v->size = ST_SIZE_BYTE; break; + case 16: v->size = ST_SIZE_WORD; break; + default: + SDL_SetError("VOC with unknown data size"); + return 0; + } + + if (SDL_RWread(src, &v->channels, sizeof (Uint8), 1) != 1) + return 0; + + if (SDL_RWread(src, trash, sizeof (Uint8), 6) != 6) + return 0; + + v->rest = sblen - 12; + return 1; + + case VOC_CONT: + v->rest = sblen; + return 1; + + case VOC_SILENCE: + if (SDL_RWread(src, &period, sizeof (period), 1) != 1) + return 0; + period = SDL_SwapLE16(period); + + if (SDL_RWread(src, &uc, sizeof (uc), 1) != 1) + return 0; + if (uc == 0) + { + SDL_SetError("VOC silence sample rate is zero"); + return 0; + } + + /* + * Some silence-packed files have gratuitously + * different sample rate codes in silence. + * Adjust period. + */ + if ((v->rate != -1) && (uc != v->rate)) + period = (Uint16)((period * (256 - uc))/(256 - v->rate)); + else + v->rate = uc; + v->rest = period; + v->silent = 1; + return 1; + + case VOC_LOOP: + case VOC_LOOPEND: + for(i = 0; i < sblen; i++) /* skip repeat loops. */ + { + if (SDL_RWread(src, trash, sizeof (Uint8), 1) != 1) + return 0; + } + break; + + case VOC_EXTENDED: + /* An Extended block is followed by a data block */ + /* Set this byte so we know to use the rate */ + /* value from the extended block and not the */ + /* data block. */ + v->has_extended = 1; + if (SDL_RWread(src, &new_rate_short, sizeof (new_rate_short), 1) != 1) + return 0; + new_rate_short = SDL_SwapLE16(new_rate_short); + if (new_rate_short == 0) + { + SDL_SetError("VOC sample rate is zero"); + return 0; + } + if ((v->rate != -1) && (new_rate_short != v->rate)) + { + SDL_SetError("VOC sample rate codes differ"); + return 0; + } + v->rate = new_rate_short; + + if (SDL_RWread(src, &uc, sizeof (uc), 1) != 1) + return 0; + + if (uc != 0) + { + SDL_SetError("VOC decoder only interprets 8-bit data"); + return 0; + } + + if (SDL_RWread(src, &uc, sizeof (uc), 1) != 1) + return 0; + + if (uc) + spec->channels = 2; /* Stereo */ + /* Needed number of channels before finishing + compute for rate */ + spec->freq = (256000000L/(65536L - v->rate))/spec->channels; + /* An extended block must be followed by a data */ + /* block to be valid so loop back to top so it */ + /* can be grabed. */ + continue; + + case VOC_MARKER: + if (SDL_RWread(src, trash, sizeof (Uint8), 2) != 2) + return 0; + + /* Falling! Falling! */ + + default: /* text block or other krapola. */ + for(i = 0; i < sblen; i++) + { + if (SDL_RWread(src, &trash, sizeof (Uint8), 1) != 1) + return 0; + } + + if (block == VOC_TEXT) + continue; /* get next block */ + } + } + + return 1; +} + + +static int voc_read(SDL_RWops *src, vs_t *v, Uint8 *buf, SDL_AudioSpec *spec) +{ + int done = 0; + Uint8 silence = 0x80; + + if (v->rest == 0) + { + if (!voc_get_block(src, v, spec)) + return 0; + } + + if (v->rest == 0) + return 0; + + if (v->silent) + { + if (v->size == ST_SIZE_WORD) + silence = 0x00; + + /* Fill in silence */ + memset(buf, silence, v->rest); + done = v->rest; + v->rest = 0; + } + + else + { + done = SDL_RWread(src, buf, 1, v->rest); + v->rest -= done; + if (v->size == ST_SIZE_WORD) + { + #if (SDL_BYTEORDER == SDL_BIG_ENDIAN) + Uint16 *samples = (Uint16 *)buf; + for (; v->rest > 0; v->rest -= 2) + { + *samples = SDL_SwapLE16(*samples); + samples++; + } + #endif + done >>= 1; + } + } + + return done; +} /* voc_read */ + + +/* don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadVOC_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len) +{ + vs_t v; + int was_error = 1; + int samplesize; + Uint8 *fillptr; + void *ptr; + + if ( (!src) || (!audio_buf) || (!audio_len) ) /* sanity checks. */ + goto done; + + if ( !voc_check_header(src) ) + goto done; + + v.rate = -1; + v.rest = 0; + v.has_extended = 0; + *audio_buf = NULL; + *audio_len = 0; + memset(spec, '\0', sizeof (SDL_AudioSpec)); + + if (!voc_get_block(src, &v, spec)) + goto done; + + if (v.rate == -1) + { + SDL_SetError("VOC data had no sound!"); + goto done; + } + + spec->format = ((v.size == ST_SIZE_WORD) ? AUDIO_S16 : AUDIO_U8); + if (spec->channels == 0) + spec->channels = v.channels; + + *audio_len = v.rest; + *audio_buf = SDL_malloc(v.rest); + if (*audio_buf == NULL) + goto done; + + fillptr = *audio_buf; + + while (voc_read(src, &v, fillptr, spec) > 0) + { + if (!voc_get_block(src, &v, spec)) + goto done; + + *audio_len += v.rest; + ptr = SDL_realloc(*audio_buf, *audio_len); + if (ptr == NULL) + { + SDL_free(*audio_buf); + *audio_buf = NULL; + *audio_len = 0; + goto done; + } + + *audio_buf = ptr; + fillptr = ((Uint8 *) ptr) + (*audio_len - v.rest); + } + + spec->samples = (Uint16)(*audio_len / v.size); + + was_error = 0; /* success, baby! */ + + /* Don't return a buffer that isn't a multiple of samplesize */ + samplesize = ((spec->format & 0xFF)/8)*spec->channels; + *audio_len &= ~(samplesize-1); + +done: + if (src) + { + if (freesrc) + SDL_RWclose(src); + else + SDL_RWseek(src, 0, RW_SEEK_SET); + } + + if ( was_error ) + spec = NULL; + + return(spec); +} /* Mix_LoadVOC_RW */ + +/* end of load_voc.c ... */ diff --git a/apps/plugins/sdl/SDL_mixer/load_voc.h b/apps/plugins/sdl/SDL_mixer/load_voc.h new file mode 100644 index 0000000..20ae23c --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/load_voc.h @@ -0,0 +1,36 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This is the source needed to decode a Creative Labs VOC file into a + waveform. It's pretty straightforward once you get going. The only + externally-callable function is Mix_LoadVOC_RW(), which is meant to + act as identically to SDL_LoadWAV_RW() as possible. + + This file by Ryan C. Gordon (icculus@icculus.org). + + Heavily borrowed from sox v12.17.1's voc.c. + (http://www.freshmeat.net/projects/sox/) +*/ + +/* $Id$ */ + +/* Don't call this directly; use Mix_LoadWAV_RW() for now. */ +SDL_AudioSpec *Mix_LoadVOC_RW (SDL_RWops *src, int freesrc, + SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); diff --git a/apps/plugins/sdl/SDL_mixer/mixer.c b/apps/plugins/sdl/SDL_mixer/mixer.c new file mode 100644 index 0000000..a24a0e7 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/mixer.c @@ -0,0 +1,1484 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#include "SDL_mutex.h" +#include "SDL_endian.h" +#include "SDL_timer.h" + +#include "SDL_mixer.h" +#include "load_aiff.h" +#include "load_voc.h" +#include "load_ogg.h" +#include "load_flac.h" +#include "dynamic_flac.h" +#include "dynamic_mod.h" +#include "dynamic_mp3.h" +#include "dynamic_ogg.h" + +#define __MIX_INTERNAL_EFFECT__ +#include "effects_internal.h" + +/* Magic numbers for various audio file formats */ +#define RIFF 0x46464952 /* "RIFF" */ +#define WAVE 0x45564157 /* "WAVE" */ +#define FORM 0x4d524f46 /* "FORM" */ +#define OGGS 0x5367674f /* "OggS" */ +#define CREA 0x61657243 /* "Crea" */ +#define FLAC 0x43614C66 /* "fLaC" */ + +static int audio_opened = 0; +static SDL_AudioSpec mixer; + +typedef struct _Mix_effectinfo +{ + Mix_EffectFunc_t callback; + Mix_EffectDone_t done_callback; + void *udata; + struct _Mix_effectinfo *next; +} effect_info; + +static struct _Mix_Channel { + Mix_Chunk *chunk; + int playing; + int paused; + Uint8 *samples; + int volume; + int looping; + int tag; + Uint32 expire; + Uint32 start_time; + Mix_Fading fading; + int fade_volume; + int fade_volume_reset; + Uint32 fade_length; + Uint32 ticks_fade; + effect_info *effects; +} *mix_channel = NULL; + +static effect_info *posteffects = NULL; + +static int num_channels; +static int reserved_channels = 0; + + +/* Support for hooking into the mixer callback system */ +static void (*mix_postmix)(void *udata, Uint8 *stream, int len) = NULL; +static void *mix_postmix_data = NULL; + +/* rcg07062001 callback to alert when channels are done playing. */ +static void (*channel_done_callback)(int channel) = NULL; + +/* Music function declarations */ +extern int open_music(SDL_AudioSpec *mixer); +extern void close_music(void); + +/* Support for user defined music functions, plus the default one */ +extern int volatile music_active; +extern void music_mixer(void *udata, Uint8 *stream, int len); +static void (*mix_music)(void *udata, Uint8 *stream, int len) = music_mixer; +static void *music_data = NULL; + +/* rcg06042009 report available decoders at runtime. */ +static const char **chunk_decoders = NULL; +static int num_decoders = 0; + +/* Semicolon-separated SoundFont paths */ +#ifdef MID_MUSIC +extern char* soundfont_paths; +#endif + +int Mix_GetNumChunkDecoders(void) +{ + return(num_decoders); +} + +const char *Mix_GetChunkDecoder(int index) +{ + if ((index < 0) || (index >= num_decoders)) { + return NULL; + } + return(chunk_decoders[index]); +} + +static void add_chunk_decoder(const char *decoder) +{ + void *ptr = SDL_realloc(chunk_decoders, (num_decoders + 1) * sizeof (const char **)); + if (ptr == NULL) { + return; /* oh well, go on without it. */ + } + chunk_decoders = (const char **) ptr; + chunk_decoders[num_decoders++] = decoder; +} + +/* rcg06192001 get linked library's version. */ +const SDL_version *Mix_Linked_Version(void) +{ + static SDL_version linked_version; + SDL_MIXER_VERSION(&linked_version); + return(&linked_version); +} + +static int initialized = 0; + +int Mix_Init(int flags) +{ + int result = 0; + + if (flags & MIX_INIT_FLUIDSYNTH) { +#ifdef USE_FLUIDSYNTH_MIDI + if ((initialized & MIX_INIT_FLUIDSYNTH) || Mix_InitFluidSynth() == 0) { + result |= MIX_INIT_FLUIDSYNTH; + } +#else + Mix_SetError("Mixer not built with FluidSynth support"); +#endif + } + if (flags & MIX_INIT_FLAC) { +#ifdef FLAC_MUSIC + if ((initialized & MIX_INIT_FLAC) || Mix_InitFLAC() == 0) { + result |= MIX_INIT_FLAC; + } +#else + Mix_SetError("Mixer not built with FLAC support"); +#endif + } + if (flags & MIX_INIT_MOD) { +#ifdef MOD_MUSIC + if ((initialized & MIX_INIT_MOD) || Mix_InitMOD() == 0) { + result |= MIX_INIT_MOD; + } +#else + Mix_SetError("Mixer not built with MOD support"); +#endif + } + if (flags & MIX_INIT_MP3) { +#ifdef MP3_MUSIC + if ((initialized & MIX_INIT_MP3) || Mix_InitMP3() == 0) { + result |= MIX_INIT_MP3; + } +#else + Mix_SetError("Mixer not built with MP3 support"); +#endif + } + if (flags & MIX_INIT_OGG) { +#ifdef OGG_MUSIC + if ((initialized & MIX_INIT_OGG) || Mix_InitOgg() == 0) { + result |= MIX_INIT_OGG; + } +#else + Mix_SetError("Mixer not built with Ogg Vorbis support"); +#endif + } + initialized |= result; + + return (result); +} + +void Mix_Quit() +{ +#ifdef USE_FLUIDSYNTH_MIDI + if (initialized & MIX_INIT_FLUIDSYNTH) { + Mix_QuitFluidSynth(); + } +#endif +#ifdef FLAC_MUSIC + if (initialized & MIX_INIT_FLAC) { + Mix_QuitFLAC(); + } +#endif +#ifdef MOD_MUSIC + if (initialized & MIX_INIT_MOD) { + Mix_QuitMOD(); + } +#endif +#ifdef MP3_MUSIC + if (initialized & MIX_INIT_MP3) { + Mix_QuitMP3(); + } +#endif +#ifdef OGG_MUSIC + if (initialized & MIX_INIT_OGG) { + Mix_QuitOgg(); + } +#endif +#ifdef MID_MUSIC + if (soundfont_paths) { + SDL_free(soundfont_paths); + } +#endif + initialized = 0; +} + +static int _Mix_remove_all_effects(int channel, effect_info **e); + +/* + * rcg06122001 Cleanup effect callbacks. + * MAKE SURE SDL_LockAudio() is called before this (or you're in the + * audio callback). + */ +static void _Mix_channel_done_playing(int channel) +{ + if (channel_done_callback) { + channel_done_callback(channel); + } + + /* + * Call internal function directly, to avoid locking audio from + * inside audio callback. + */ + _Mix_remove_all_effects(channel, &mix_channel[channel].effects); +} + + +static void *Mix_DoEffects(int chan, void *snd, int len) +{ + int posteffect = (chan == MIX_CHANNEL_POST); + effect_info *e = ((posteffect) ? posteffects : mix_channel[chan].effects); + void *buf = snd; + + if (e != NULL) { /* are there any registered effects? */ + /* if this is the postmix, we can just overwrite the original. */ + if (!posteffect) { + buf = SDL_malloc(len); + if (buf == NULL) { + return(snd); + } + memcpy(buf, snd, len); + } + + for (; e != NULL; e = e->next) { + if (e->callback != NULL) { + e->callback(chan, buf, len, e->udata); + } + } + } + + /* be sure to SDL_free() the return value if != snd ... */ + return(buf); +} + + +/* Mixing function */ +static void mix_channels(void *udata, Uint8 *stream, int len) +{ + Uint8 *mix_input; + int i, mixable, volume = SDL_MIX_MAXVOLUME; + Uint32 sdl_ticks; + +#if SDL_VERSION_ATLEAST(1, 3, 0) + /* Need to initialize the stream in SDL 1.3+ */ + memset(stream, mixer.silence, len); +#endif + + /* Mix the music (must be done before the channels are added) */ + if ( music_active || (mix_music != music_mixer) ) { + mix_music(music_data, stream, len); + } + + /* Mix any playing channels... */ + sdl_ticks = SDL_GetTicks(); + for ( i=0; i 0 && mix_channel[i].expire < sdl_ticks ) { + /* Expiration delay for that channel is reached */ + mix_channel[i].playing = 0; + mix_channel[i].looping = 0; + mix_channel[i].fading = MIX_NO_FADING; + mix_channel[i].expire = 0; + _Mix_channel_done_playing(i); + } else if ( mix_channel[i].fading != MIX_NO_FADING ) { + Uint32 ticks = sdl_ticks - mix_channel[i].ticks_fade; + if( ticks > mix_channel[i].fade_length ) { + Mix_Volume(i, mix_channel[i].fade_volume_reset); /* Restore the volume */ + if( mix_channel[i].fading == MIX_FADING_OUT ) { + mix_channel[i].playing = 0; + mix_channel[i].looping = 0; + mix_channel[i].expire = 0; + _Mix_channel_done_playing(i); + } + mix_channel[i].fading = MIX_NO_FADING; + } else { + if( mix_channel[i].fading == MIX_FADING_OUT ) { + Mix_Volume(i, (mix_channel[i].fade_volume * (mix_channel[i].fade_length-ticks)) + / mix_channel[i].fade_length ); + } else { + Mix_Volume(i, (mix_channel[i].fade_volume * ticks) / mix_channel[i].fade_length ); + } + } + } + if ( mix_channel[i].playing > 0 ) { + int index = 0; + int remaining = len; + while (mix_channel[i].playing > 0 && index < len) { + remaining = len - index; + volume = (mix_channel[i].volume*mix_channel[i].chunk->volume) / MIX_MAX_VOLUME; + mixable = mix_channel[i].playing; + if ( mixable > remaining ) { + mixable = remaining; + } + + mix_input = Mix_DoEffects(i, mix_channel[i].samples, mixable); + SDL_MixAudio(stream+index,mix_input,mixable,volume); + if (mix_input != mix_channel[i].samples) + SDL_free(mix_input); + + mix_channel[i].samples += mixable; + mix_channel[i].playing -= mixable; + index += mixable; + + /* rcg06072001 Alert app if channel is done playing. */ + if (!mix_channel[i].playing && !mix_channel[i].looping) { + _Mix_channel_done_playing(i); + } + } + + /* If looping the sample and we are at its end, make sure + we will still return a full buffer */ + while ( mix_channel[i].looping && index < len ) { + int alen = mix_channel[i].chunk->alen; + remaining = len - index; + if (remaining > alen) { + remaining = alen; + } + + mix_input = Mix_DoEffects(i, mix_channel[i].chunk->abuf, remaining); + SDL_MixAudio(stream+index, mix_input, remaining, volume); + if (mix_input != mix_channel[i].chunk->abuf) + SDL_free(mix_input); + + --mix_channel[i].looping; + mix_channel[i].samples = mix_channel[i].chunk->abuf + remaining; + mix_channel[i].playing = mix_channel[i].chunk->alen - remaining; + index += remaining; + } + if ( ! mix_channel[i].playing && mix_channel[i].looping ) { + --mix_channel[i].looping; + mix_channel[i].samples = mix_channel[i].chunk->abuf; + mix_channel[i].playing = mix_channel[i].chunk->alen; + } + } + } + } + + /* rcg06122001 run posteffects... */ + Mix_DoEffects(MIX_CHANNEL_POST, stream, len); + + if ( mix_postmix ) { + mix_postmix(mix_postmix_data, stream, len); + } +} + +#if 0 +static void PrintFormat(char *title, SDL_AudioSpec *fmt) +{ + printf("%s: %d bit %s audio (%s) at %u Hz\n", title, (fmt->format&0xFF), + (fmt->format&0x8000) ? "signed" : "unsigned", + (fmt->channels > 2) ? "surround" : + (fmt->channels > 1) ? "stereo" : "mono", fmt->freq); +} +#endif + + +/* Open the mixer with a certain desired audio format */ +int Mix_OpenAudio(int frequency, Uint16 format, int nchannels, int chunksize) +{ + int i; + SDL_AudioSpec desired; + + /* If the mixer is already opened, increment open count */ + if ( audio_opened ) { + if ( format == mixer.format && nchannels == mixer.channels ) { + ++audio_opened; + return(0); + } + while ( audio_opened ) { + Mix_CloseAudio(); + } + } + + /* Set the desired format and frequency */ + desired.freq = frequency; + desired.format = format; + desired.channels = nchannels; + desired.samples = chunksize; + desired.callback = mix_channels; + desired.userdata = NULL; + + /* Accept nearly any audio format */ + if ( SDL_OpenAudio(&desired, &mixer) < 0 ) { + return(-1); + } +#if 0 + PrintFormat("Audio device", &mixer); +#endif + + /* Initialize the music players */ + if ( open_music(&mixer) < 0 ) { + SDL_CloseAudio(); + return(-1); + } + + num_channels = MIX_CHANNELS; + mix_channel = (struct _Mix_Channel *) SDL_malloc(num_channels * sizeof(struct _Mix_Channel)); + + /* Clear out the audio channels */ + for ( i=0; i num_channels ) { + /* Initialize the new channels */ + int i; + for(i=num_channels; i < numchans; i++) { + mix_channel[i].chunk = NULL; + mix_channel[i].playing = 0; + mix_channel[i].looping = 0; + mix_channel[i].volume = SDL_MIX_MAXVOLUME; + mix_channel[i].fade_volume = SDL_MIX_MAXVOLUME; + mix_channel[i].fade_volume_reset = SDL_MIX_MAXVOLUME; + mix_channel[i].fading = MIX_NO_FADING; + mix_channel[i].tag = -1; + mix_channel[i].expire = 0; + mix_channel[i].effects = NULL; + mix_channel[i].paused = 0; + } + } + num_channels = numchans; + SDL_UnlockAudio(); + return(num_channels); +} + +/* Return the actual mixer parameters */ +int Mix_QuerySpec(int *frequency, Uint16 *format, int *channels) +{ + if ( audio_opened ) { + if ( frequency ) { + *frequency = mixer.freq; + } + if ( format ) { + *format = mixer.format; + } + if ( channels ) { + *channels = mixer.channels; + } + } + return(audio_opened); +} + + +/* + * !!! FIXME: Ideally, we want a Mix_LoadSample_RW(), which will handle the + * generic setup, then call the correct file format loader. + */ + +/* Load a wave file */ +Mix_Chunk *Mix_LoadWAV_RW(SDL_RWops *src, int freesrc) +{ + Uint32 magic; + Mix_Chunk *chunk; + SDL_AudioSpec wavespec, *loaded; + SDL_AudioCVT wavecvt; + int samplesize; + + /* rcg06012001 Make sure src is valid */ + if ( ! src ) { + SDL_SetError("Mix_LoadWAV_RW with NULL src"); + return(NULL); + } + + /* Make sure audio has been opened */ + if ( ! audio_opened ) { + SDL_SetError("Audio device hasn't been opened"); + if ( freesrc && src ) { + SDL_RWclose(src); + } + return(NULL); + } + + /* Allocate the chunk memory */ + chunk = (Mix_Chunk *)SDL_malloc(sizeof(Mix_Chunk)); + if ( chunk == NULL ) { + SDL_SetError("Out of memory"); + if ( freesrc ) { + SDL_RWclose(src); + } + return(NULL); + } + + /* Find out what kind of audio file this is */ + magic = SDL_ReadLE32(src); + /* Seek backwards for compatibility with older loaders */ + SDL_RWseek(src, -(int)sizeof(Uint32), RW_SEEK_CUR); + + switch (magic) { + case WAVE: + case RIFF: + loaded = SDL_LoadWAV_RW(src, freesrc, &wavespec, + (Uint8 **)&chunk->abuf, &chunk->alen); + break; + case FORM: + loaded = Mix_LoadAIFF_RW(src, freesrc, &wavespec, + (Uint8 **)&chunk->abuf, &chunk->alen); + break; +#ifdef OGG_MUSIC + case OGGS: + loaded = Mix_LoadOGG_RW(src, freesrc, &wavespec, + (Uint8 **)&chunk->abuf, &chunk->alen); + break; +#endif +#ifdef FLAC_MUSIC + case FLAC: + loaded = Mix_LoadFLAC_RW(src, freesrc, &wavespec, + (Uint8 **)&chunk->abuf, &chunk->alen); + break; +#endif + case CREA: + loaded = Mix_LoadVOC_RW(src, freesrc, &wavespec, + (Uint8 **)&chunk->abuf, &chunk->alen); + break; + default: + SDL_SetError("Unrecognized sound file type"); + return(0); + } + if ( !loaded ) { + SDL_free(chunk); + if ( freesrc ) { + SDL_RWclose(src); + } + return(NULL); + } + +#if 0 + PrintFormat("Audio device", &mixer); + PrintFormat("-- Wave file", &wavespec); +#endif + + /* Build the audio converter and create conversion buffers */ + if ( wavespec.format != mixer.format || + wavespec.channels != mixer.channels || + wavespec.freq != mixer.freq ) { + if ( SDL_BuildAudioCVT(&wavecvt, + wavespec.format, wavespec.channels, wavespec.freq, + mixer.format, mixer.channels, mixer.freq) < 0 ) { + SDL_free(chunk->abuf); + SDL_free(chunk); + return(NULL); + } + samplesize = ((wavespec.format & 0xFF)/8)*wavespec.channels; + wavecvt.len = chunk->alen & ~(samplesize-1); + wavecvt.buf = (Uint8 *)SDL_calloc(1, wavecvt.len*wavecvt.len_mult); + if ( wavecvt.buf == NULL ) { + SDL_SetError("Out of memory"); + SDL_free(chunk->abuf); + SDL_free(chunk); + return(NULL); + } + memcpy(wavecvt.buf, chunk->abuf, chunk->alen); + SDL_free(chunk->abuf); + + /* Run the audio converter */ + if ( SDL_ConvertAudio(&wavecvt) < 0 ) { + SDL_free(wavecvt.buf); + SDL_free(chunk); + return(NULL); + } + + chunk->abuf = wavecvt.buf; + chunk->alen = wavecvt.len_cvt; + } + + chunk->allocated = 1; + chunk->volume = MIX_MAX_VOLUME; + + return(chunk); +} + +/* Load a wave file of the mixer format from a memory buffer */ +Mix_Chunk *Mix_QuickLoad_WAV(Uint8 *mem) +{ + Mix_Chunk *chunk; + Uint8 magic[4]; + + /* Make sure audio has been opened */ + if ( ! audio_opened ) { + SDL_SetError("Audio device hasn't been opened"); + return(NULL); + } + + /* Allocate the chunk memory */ + chunk = (Mix_Chunk *)SDL_calloc(1,sizeof(Mix_Chunk)); + if ( chunk == NULL ) { + SDL_SetError("Out of memory"); + return(NULL); + } + + /* Essentially just skip to the audio data (no error checking - fast) */ + chunk->allocated = 0; + mem += 12; /* WAV header */ + do { + memcpy(magic, mem, 4); + mem += 4; + chunk->alen = ((mem[3]<<24)|(mem[2]<<16)|(mem[1]<<8)|(mem[0])); + mem += 4; + chunk->abuf = mem; + mem += chunk->alen; + } while ( memcmp(magic, "data", 4) != 0 ); + chunk->volume = MIX_MAX_VOLUME; + + return(chunk); +} + +/* Load raw audio data of the mixer format from a memory buffer */ +Mix_Chunk *Mix_QuickLoad_RAW(Uint8 *mem, Uint32 len) +{ + Mix_Chunk *chunk; + + /* Make sure audio has been opened */ + if ( ! audio_opened ) { + SDL_SetError("Audio device hasn't been opened"); + return(NULL); + } + + /* Allocate the chunk memory */ + chunk = (Mix_Chunk *)SDL_malloc(sizeof(Mix_Chunk)); + if ( chunk == NULL ) { + SDL_SetError("Out of memory"); + return(NULL); + } + + /* Essentially just point at the audio data (no error checking - fast) */ + chunk->allocated = 0; + chunk->alen = len; + chunk->abuf = mem; + chunk->volume = MIX_MAX_VOLUME; + + return(chunk); +} + +/* Free an audio chunk previously loaded */ +void Mix_FreeChunk(Mix_Chunk *chunk) +{ + int i; + + /* Caution -- if the chunk is playing, the mixer will crash */ + if ( chunk ) { + /* Guarantee that this chunk isn't playing */ + SDL_LockAudio(); + if ( mix_channel ) { + for ( i=0; iallocated ) { + SDL_free(chunk->abuf); + } + SDL_free(chunk); + } +} + +/* Set a function that is called after all mixing is performed. + This can be used to provide real-time visual display of the audio stream + or add a custom mixer filter for the stream data. +*/ +void Mix_SetPostMix(void (*mix_func) + (void *udata, Uint8 *stream, int len), void *arg) +{ + SDL_LockAudio(); + mix_postmix_data = arg; + mix_postmix = mix_func; + SDL_UnlockAudio(); +} + +/* Add your own music player or mixer function. + If 'mix_func' is NULL, the default music player is re-enabled. + */ +void Mix_HookMusic(void (*mix_func)(void *udata, Uint8 *stream, int len), + void *arg) +{ + SDL_LockAudio(); + if ( mix_func != NULL ) { + music_data = arg; + mix_music = mix_func; + } else { + music_data = NULL; + mix_music = music_mixer; + } + SDL_UnlockAudio(); +} + +void *Mix_GetMusicHookData(void) +{ + return(music_data); +} + +void Mix_ChannelFinished(void (*channel_finished)(int channel)) +{ + SDL_LockAudio(); + channel_done_callback = channel_finished; + SDL_UnlockAudio(); +} + + +/* Reserve the first channels (0 -> n-1) for the application, i.e. don't allocate + them dynamically to the next sample if requested with a -1 value below. + Returns the number of reserved channels. + */ +int Mix_ReserveChannels(int num) +{ + if (num > num_channels) + num = num_channels; + reserved_channels = num; + return num; +} + +static int checkchunkintegral(Mix_Chunk *chunk) +{ + int frame_width = 1; + + if ((mixer.format & 0xFF) == 16) frame_width = 2; + frame_width *= mixer.channels; + while (chunk->alen % frame_width) chunk->alen--; + return chunk->alen; +} + +/* Play an audio chunk on a specific channel. + If the specified channel is -1, play on the first free channel. + 'ticks' is the number of milliseconds at most to play the sample, or -1 + if there is no limit. + Returns which channel was used to play the sound. +*/ +int Mix_PlayChannelTimed(int which, Mix_Chunk *chunk, int loops, int ticks) +{ + int i; + + /* Don't play null pointers :-) */ + if ( chunk == NULL ) { + Mix_SetError("Tried to play a NULL chunk"); + return(-1); + } + if ( !checkchunkintegral(chunk)) { + Mix_SetError("Tried to play a chunk with a bad frame"); + return(-1); + } + + /* Lock the mixer while modifying the playing channels */ + SDL_LockAudio(); + { + /* If which is -1, play on the first free channel */ + if ( which == -1 ) { + for ( i=reserved_channels; i= 0 && which < num_channels ) { + Uint32 sdl_ticks = SDL_GetTicks(); + if (Mix_Playing(which)) + _Mix_channel_done_playing(which); + mix_channel[which].samples = chunk->abuf; + mix_channel[which].playing = chunk->alen; + mix_channel[which].looping = loops; + mix_channel[which].chunk = chunk; + mix_channel[which].paused = 0; + mix_channel[which].fading = MIX_NO_FADING; + mix_channel[which].start_time = sdl_ticks; + mix_channel[which].expire = (ticks>0) ? (sdl_ticks + ticks) : 0; + } + } + SDL_UnlockAudio(); + + /* Return the channel on which the sound is being played */ + return(which); +} + +/* Change the expiration delay for a channel */ +int Mix_ExpireChannel(int which, int ticks) +{ + int status = 0; + + if ( which == -1 ) { + int i; + for ( i=0; i < num_channels; ++ i ) { + status += Mix_ExpireChannel(i, ticks); + } + } else if ( which < num_channels ) { + SDL_LockAudio(); + mix_channel[which].expire = (ticks>0) ? (SDL_GetTicks() + ticks) : 0; + SDL_UnlockAudio(); + ++ status; + } + return(status); +} + +/* Fade in a sound on a channel, over ms milliseconds */ +int Mix_FadeInChannelTimed(int which, Mix_Chunk *chunk, int loops, int ms, int ticks) +{ + int i; + + /* Don't play null pointers :-) */ + if ( chunk == NULL ) { + return(-1); + } + if ( !checkchunkintegral(chunk)) { + Mix_SetError("Tried to play a chunk with a bad frame"); + return(-1); + } + + /* Lock the mixer while modifying the playing channels */ + SDL_LockAudio(); + { + /* If which is -1, play on the first free channel */ + if ( which == -1 ) { + for ( i=reserved_channels; i= 0 && which < num_channels ) { + Uint32 sdl_ticks = SDL_GetTicks(); + if (Mix_Playing(which)) + _Mix_channel_done_playing(which); + mix_channel[which].samples = chunk->abuf; + mix_channel[which].playing = chunk->alen; + mix_channel[which].looping = loops; + mix_channel[which].chunk = chunk; + mix_channel[which].paused = 0; + mix_channel[which].fading = MIX_FADING_IN; + mix_channel[which].fade_volume = mix_channel[which].volume; + mix_channel[which].fade_volume_reset = mix_channel[which].volume; + mix_channel[which].volume = 0; + mix_channel[which].fade_length = (Uint32)ms; + mix_channel[which].start_time = mix_channel[which].ticks_fade = sdl_ticks; + mix_channel[which].expire = (ticks > 0) ? (sdl_ticks+ticks) : 0; + } + } + SDL_UnlockAudio(); + + /* Return the channel on which the sound is being played */ + return(which); +} + +/* Set volume of a particular channel */ +int Mix_Volume(int which, int volume) +{ + int i; + int prev_volume = 0; + + if ( which == -1 ) { + for ( i=0; i= 0 ) { + if ( volume > SDL_MIX_MAXVOLUME ) { + volume = SDL_MIX_MAXVOLUME; + } + mix_channel[which].volume = volume; + } + } + return(prev_volume); +} +/* Set volume of a particular chunk */ +int Mix_VolumeChunk(Mix_Chunk *chunk, int volume) +{ + int prev_volume; + + prev_volume = chunk->volume; + if ( volume >= 0 ) { + if ( volume > MIX_MAX_VOLUME ) { + volume = MIX_MAX_VOLUME; + } + chunk->volume = volume; + } + return(prev_volume); +} + +/* Halt playing of a particular channel */ +int Mix_HaltChannel(int which) +{ + int i; + + if ( which == -1 ) { + for ( i=0; i 0) && + (mix_channel[which].fading != MIX_FADING_OUT) ) { + mix_channel[which].fade_volume = mix_channel[which].volume; + mix_channel[which].fading = MIX_FADING_OUT; + mix_channel[which].fade_length = ms; + mix_channel[which].ticks_fade = SDL_GetTicks(); + + /* only change fade_volume_reset if we're not fading. */ + if (mix_channel[which].fading == MIX_NO_FADING) { + mix_channel[which].fade_volume_reset = mix_channel[which].volume; + } + ++status; + } + SDL_UnlockAudio(); + } + } + return(status); +} + +/* Halt playing of a particular group of channels */ +int Mix_FadeOutGroup(int tag, int ms) +{ + int i; + int status = 0; + for ( i=0; i= num_channels ) { + return MIX_NO_FADING; + } + return mix_channel[which].fading; +} + +/* Check the status of a specific channel. + If the specified mix_channel is -1, check all mix channels. +*/ +int Mix_Playing(int which) +{ + int status; + + status = 0; + if ( which == -1 ) { + int i; + + for ( i=0; i 0) || + (mix_channel[i].looping > 0)) + { + ++status; + } + } + } else if ( which < num_channels ) { + if ( (mix_channel[which].playing > 0) || + (mix_channel[which].looping > 0) ) + { + ++status; + } + } + return(status); +} + +/* rcg06072001 Get the chunk associated with a channel. */ +Mix_Chunk *Mix_GetChunk(int channel) +{ + Mix_Chunk *retval = NULL; + + if ((channel >= 0) && (channel < num_channels)) { + retval = mix_channel[channel].chunk; + } + + return(retval); +} + +/* Close the mixer, halting all playing audio */ +void Mix_CloseAudio(void) +{ + int i; + + if ( audio_opened ) { + if ( audio_opened == 1 ) { + for (i = 0; i < num_channels; i++) { + Mix_UnregisterAllEffects(i); + } + Mix_UnregisterAllEffects(MIX_CHANNEL_POST); + close_music(); + Mix_HaltChannel(-1); + _Mix_DeinitEffects(); + SDL_CloseAudio(); + SDL_free(mix_channel); + mix_channel = NULL; + + /* rcg06042009 report available decoders at runtime. */ + SDL_free(chunk_decoders); + chunk_decoders = NULL; + num_decoders = 0; + } + --audio_opened; + } +} + +/* Pause a particular channel (or all) */ +void Mix_Pause(int which) +{ + Uint32 sdl_ticks = SDL_GetTicks(); + if ( which == -1 ) { + int i; + + for ( i=0; i 0 ) { + mix_channel[i].paused = sdl_ticks; + } + } + } else if ( which < num_channels ) { + if ( mix_channel[which].playing > 0 ) { + mix_channel[which].paused = sdl_ticks; + } + } +} + +/* Resume a paused channel */ +void Mix_Resume(int which) +{ + Uint32 sdl_ticks = SDL_GetTicks(); + + SDL_LockAudio(); + if ( which == -1 ) { + int i; + + for ( i=0; i 0 ) { + if(mix_channel[i].expire > 0) + mix_channel[i].expire += sdl_ticks - mix_channel[i].paused; + mix_channel[i].paused = 0; + } + } + } else if ( which < num_channels ) { + if ( mix_channel[which].playing > 0 ) { + if(mix_channel[which].expire > 0) + mix_channel[which].expire += sdl_ticks - mix_channel[which].paused; + mix_channel[which].paused = 0; + } + } + SDL_UnlockAudio(); +} + +int Mix_Paused(int which) +{ + if ( which < 0 ) { + int status = 0; + int i; + for( i=0; i < num_channels; ++i ) { + if ( mix_channel[i].paused ) { + ++ status; + } + } + return(status); + } else if ( which < num_channels ) { + return(mix_channel[which].paused != 0); + } else { + return(0); + } +} + +/* Change the group of a channel */ +int Mix_GroupChannel(int which, int tag) +{ + if ( which < 0 || which > num_channels ) + return(0); + + SDL_LockAudio(); + mix_channel[which].tag = tag; + SDL_UnlockAudio(); + return(1); +} + +/* Assign several consecutive channels to a group */ +int Mix_GroupChannels(int from, int to, int tag) +{ + int status = 0; + for( ; from <= to; ++ from ) { + status += Mix_GroupChannel(from, tag); + } + return(status); +} + +/* Finds the first available channel in a group of channels */ +int Mix_GroupAvailable(int tag) +{ + int i; + for( i=0; i < num_channels; i ++ ) { + if ( ((tag == -1) || (tag == mix_channel[i].tag)) && + (mix_channel[i].playing <= 0) ) + return i; + } + return(-1); +} + +int Mix_GroupCount(int tag) +{ + int count = 0; + int i; + for( i=0; i < num_channels; i ++ ) { + if ( mix_channel[i].tag==tag || tag==-1 ) + ++ count; + } + return(count); +} + +/* Finds the "oldest" sample playing in a group of channels */ +int Mix_GroupOldest(int tag) +{ + int chan = -1; + Uint32 mintime = SDL_GetTicks(); + int i; + for( i=0; i < num_channels; i ++ ) { + if ( (mix_channel[i].tag==tag || tag==-1) && mix_channel[i].playing > 0 + && mix_channel[i].start_time <= mintime ) { + mintime = mix_channel[i].start_time; + chan = i; + } + } + return(chan); +} + +/* Finds the "most recent" (i.e. last) sample playing in a group of channels */ +int Mix_GroupNewer(int tag) +{ + int chan = -1; + Uint32 maxtime = 0; + int i; + for( i=0; i < num_channels; i ++ ) { + if ( (mix_channel[i].tag==tag || tag==-1) && mix_channel[i].playing > 0 + && mix_channel[i].start_time >= maxtime ) { + maxtime = mix_channel[i].start_time; + chan = i; + } + } + return(chan); +} + + + +/* + * rcg06122001 The special effects exportable API. + * Please see effect_*.c for internally-implemented effects, such + * as Mix_SetPanning(). + */ + +/* MAKE SURE you hold the audio lock (SDL_LockAudio()) before calling this! */ +static int _Mix_register_effect(effect_info **e, Mix_EffectFunc_t f, + Mix_EffectDone_t d, void *arg) +{ + effect_info *new_e; + + if (!e) { + Mix_SetError("Internal error"); + return(0); + } + + if (f == NULL) { + Mix_SetError("NULL effect callback"); + return(0); + } + + new_e = SDL_malloc(sizeof (effect_info)); + if (new_e == NULL) { + Mix_SetError("Out of memory"); + return(0); + } + + new_e->callback = f; + new_e->done_callback = d; + new_e->udata = arg; + new_e->next = NULL; + + /* add new effect to end of linked list... */ + if (*e == NULL) { + *e = new_e; + } else { + effect_info *cur = *e; + while (1) { + if (cur->next == NULL) { + cur->next = new_e; + break; + } + cur = cur->next; + } + } + + return(1); +} + + +/* MAKE SURE you hold the audio lock (SDL_LockAudio()) before calling this! */ +static int _Mix_remove_effect(int channel, effect_info **e, Mix_EffectFunc_t f) +{ + effect_info *cur; + effect_info *prev = NULL; + effect_info *next = NULL; + + if (!e) { + Mix_SetError("Internal error"); + return(0); + } + + for (cur = *e; cur != NULL; cur = cur->next) { + if (cur->callback == f) { + next = cur->next; + if (cur->done_callback != NULL) { + cur->done_callback(channel, cur->udata); + } + SDL_free(cur); + + if (prev == NULL) { /* removing first item of list? */ + *e = next; + } else { + prev->next = next; + } + return(1); + } + prev = cur; + } + + Mix_SetError("No such effect registered"); + return(0); +} + + +/* MAKE SURE you hold the audio lock (SDL_LockAudio()) before calling this! */ +static int _Mix_remove_all_effects(int channel, effect_info **e) +{ + effect_info *cur; + effect_info *next; + + if (!e) { + Mix_SetError("Internal error"); + return(0); + } + + for (cur = *e; cur != NULL; cur = next) { + next = cur->next; + if (cur->done_callback != NULL) { + cur->done_callback(channel, cur->udata); + } + SDL_free(cur); + } + *e = NULL; + + return(1); +} + + +/* MAKE SURE you hold the audio lock (SDL_LockAudio()) before calling this! */ +int _Mix_RegisterEffect_locked(int channel, Mix_EffectFunc_t f, + Mix_EffectDone_t d, void *arg) +{ + effect_info **e = NULL; + + if (channel == MIX_CHANNEL_POST) { + e = &posteffects; + } else { + if ((channel < 0) || (channel >= num_channels)) { + Mix_SetError("Invalid channel number"); + return(0); + } + e = &mix_channel[channel].effects; + } + + return _Mix_register_effect(e, f, d, arg); +} + +int Mix_RegisterEffect(int channel, Mix_EffectFunc_t f, + Mix_EffectDone_t d, void *arg) +{ + int retval; + SDL_LockAudio(); + retval = _Mix_RegisterEffect_locked(channel, f, d, arg); + SDL_UnlockAudio(); + return retval; +} + + +/* MAKE SURE you hold the audio lock (SDL_LockAudio()) before calling this! */ +int _Mix_UnregisterEffect_locked(int channel, Mix_EffectFunc_t f) +{ + effect_info **e = NULL; + + if (channel == MIX_CHANNEL_POST) { + e = &posteffects; + } else { + if ((channel < 0) || (channel >= num_channels)) { + Mix_SetError("Invalid channel number"); + return(0); + } + e = &mix_channel[channel].effects; + } + + return _Mix_remove_effect(channel, e, f); +} + +int Mix_UnregisterEffect(int channel, Mix_EffectFunc_t f) +{ + int retval; + SDL_LockAudio(); + retval = _Mix_UnregisterEffect_locked(channel, f); + SDL_UnlockAudio(); + return(retval); +} + +/* MAKE SURE you hold the audio lock (SDL_LockAudio()) before calling this! */ +int _Mix_UnregisterAllEffects_locked(int channel) +{ + effect_info **e = NULL; + + if (channel == MIX_CHANNEL_POST) { + e = &posteffects; + } else { + if ((channel < 0) || (channel >= num_channels)) { + Mix_SetError("Invalid channel number"); + return(0); + } + e = &mix_channel[channel].effects; + } + + return _Mix_remove_all_effects(channel, e); +} + +int Mix_UnregisterAllEffects(int channel) +{ + int retval; + SDL_LockAudio(); + retval = _Mix_UnregisterAllEffects_locked(channel); + SDL_UnlockAudio(); + return(retval); +} + +/* end of mixer.c ... */ + diff --git a/apps/plugins/sdl/SDL_mixer/music.c b/apps/plugins/sdl/SDL_mixer/music.c new file mode 100644 index 0000000..ab41327 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music.c @@ -0,0 +1,1599 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#include +#include "SDL_endian.h" +#include "SDL_audio.h" +#include "SDL_timer.h" + +#include "SDL_mixer.h" + +#ifdef CMD_MUSIC +#include "music_cmd.h" +#endif +#ifdef WAV_MUSIC +#include "wavestream.h" +#endif +#ifdef MODPLUG_MUSIC +#include "music_modplug.h" +#endif +#ifdef MOD_MUSIC +#include "music_mod.h" +#endif +#ifdef MID_MUSIC +# ifdef USE_TIMIDITY_MIDI +# include "timidity/timidity.h" +# endif +# ifdef USE_FLUIDSYNTH_MIDI +# include "fluidsynth.h" +# endif +# ifdef USE_NATIVE_MIDI +# include "native_midi.h" +# endif +#endif +#ifdef OGG_MUSIC +#include "music_ogg.h" +#endif +#ifdef MP3_MUSIC +#include "dynamic_mp3.h" +#endif +#ifdef MP3_MAD_MUSIC +#include "music_mad.h" +#endif +#ifdef FLAC_MUSIC +#include "music_flac.h" +#endif + +#if defined(MP3_MUSIC) || defined(MP3_MAD_MUSIC) +static SDL_AudioSpec used_mixer; +#endif + + +int volatile music_active = 1; +static int volatile music_stopped = 0; +static int music_loops = 0; +static char *music_cmd = NULL; +static Mix_Music * volatile music_playing = NULL; +static int music_volume = MIX_MAX_VOLUME; + +struct _Mix_Music { + Mix_MusicType type; + union { +#ifdef CMD_MUSIC + MusicCMD *cmd; +#endif +#ifdef WAV_MUSIC + WAVStream *wave; +#endif +#ifdef MODPLUG_MUSIC + modplug_data *modplug; +#endif +#ifdef MOD_MUSIC + struct MODULE *module; +#endif +#ifdef MID_MUSIC +#ifdef USE_TIMIDITY_MIDI + MidiSong *midi; +#endif +#ifdef USE_FLUIDSYNTH_MIDI + FluidSynthMidiSong *fluidsynthmidi; +#endif +#ifdef USE_NATIVE_MIDI + NativeMidiSong *nativemidi; +#endif +#endif +#ifdef OGG_MUSIC + OGG_music *ogg; +#endif +#ifdef MP3_MUSIC + SMPEG *mp3; +#endif +#ifdef MP3_MAD_MUSIC + mad_data *mp3_mad; +#endif +#ifdef FLAC_MUSIC + FLAC_music *flac; +#endif + } data; + Mix_Fading fading; + int fade_step; + int fade_steps; + int error; +}; +#ifdef MID_MUSIC +#ifdef USE_TIMIDITY_MIDI +static int timidity_ok; +static int samplesize; +#endif +#ifdef USE_FLUIDSYNTH_MIDI +static int fluidsynth_ok; +#endif +#ifdef USE_NATIVE_MIDI +static int native_midi_ok; +#endif +#endif + +/* Used to calculate fading steps */ +static int ms_per_step; + +/* rcg06042009 report available decoders at runtime. */ +static const char **music_decoders = NULL; +static int num_decoders = 0; + +/* Semicolon-separated SoundFont paths */ +#ifdef MID_MUSIC +char* soundfont_paths = NULL; +#endif + +int Mix_GetNumMusicDecoders(void) +{ + return(num_decoders); +} + +const char *Mix_GetMusicDecoder(int index) +{ + if ((index < 0) || (index >= num_decoders)) { + return NULL; + } + return(music_decoders[index]); +} + +static void add_music_decoder(const char *decoder) +{ + void *ptr = SDL_realloc(music_decoders, (num_decoders + 1) * sizeof (const char **)); + if (ptr == NULL) { + return; /* oh well, go on without it. */ + } + music_decoders = (const char **) ptr; + music_decoders[num_decoders++] = decoder; +} + +/* Local low-level functions prototypes */ +static void music_internal_initialize_volume(void); +static void music_internal_volume(int volume); +static int music_internal_play(Mix_Music *music, double position); +static int music_internal_position(double position); +static int music_internal_playing(); +static void music_internal_halt(void); + + +/* Support for hooking when the music has finished */ +static void (*music_finished_hook)(void) = NULL; + +void Mix_HookMusicFinished(void (*music_finished)(void)) +{ + SDL_LockAudio(); + music_finished_hook = music_finished; + SDL_UnlockAudio(); +} + + +/* If music isn't playing, halt it if no looping is required, restart it */ +/* otherwhise. NOP if the music is playing */ +static int music_halt_or_loop (void) +{ + /* Restart music if it has to loop */ + + if (!music_internal_playing()) + { +#ifdef USE_NATIVE_MIDI + /* Native MIDI handles looping internally */ + if (music_playing->type == MUS_MID && native_midi_ok) { + music_loops = 0; + } +#endif + + /* Restart music if it has to loop at a high level */ + if (music_loops) + { + Mix_Fading current_fade; + --music_loops; + current_fade = music_playing->fading; + music_internal_play(music_playing, 0.0); + music_playing->fading = current_fade; + } + else + { + music_internal_halt(); + if (music_finished_hook) + music_finished_hook(); + + return 0; + } + } + + return 1; +} + + + +/* Mixing function */ +void music_mixer(void *udata, Uint8 *stream, int len) +{ + //printf("music_mixer() called!\n"); + int left = 0; + + if ( music_playing && music_active ) { + /* Handle fading */ + if ( music_playing->fading != MIX_NO_FADING ) { + if ( music_playing->fade_step++ < music_playing->fade_steps ) { + int volume; + int fade_step = music_playing->fade_step; + int fade_steps = music_playing->fade_steps; + + if ( music_playing->fading == MIX_FADING_OUT ) { + volume = (music_volume * (fade_steps-fade_step)) / fade_steps; + } else { /* Fading in */ + volume = (music_volume * fade_step) / fade_steps; + } + music_internal_volume(volume); + } else { + if ( music_playing->fading == MIX_FADING_OUT ) { + music_internal_halt(); + if ( music_finished_hook ) { + music_finished_hook(); + } + return; + } + music_playing->fading = MIX_NO_FADING; + } + } + + music_halt_or_loop(); + if (!music_internal_playing()) + return; + + switch (music_playing->type) { +#ifdef CMD_MUSIC + case MUS_CMD: + /* The playing is done externally */ + break; +#endif +#ifdef WAV_MUSIC + case MUS_WAV: + left = WAVStream_PlaySome(stream, len); + break; +#endif +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + left = modplug_playAudio(music_playing->data.modplug, stream, len); + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + left = MOD_playAudio(music_playing->data.module, stream, len); + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + /* Native midi is handled asynchronously */ + goto skip; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_ok ) { + fluidsynth_playsome(music_playing->data.fluidsynthmidi, stream, len); + goto skip; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + int samples = len / samplesize; + Timidity_PlaySome(stream, samples); + goto skip; + } +#endif + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + + left = OGG_playAudio(music_playing->data.ogg, stream, len); + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + left = FLAC_playAudio(music_playing->data.flac, stream, len); + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + left = (len - smpeg.SMPEG_playAudio(music_playing->data.mp3, stream, len)); + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + left = mad_getSamples(music_playing->data.mp3_mad, stream, len); + break; +#endif + default: + /* Unknown music type?? */ + break; + } + } + + +skip: + /* Handle seamless music looping */ + if (left > 0 && left < len) { + music_halt_or_loop(); + if (music_internal_playing()) + music_mixer(udata, stream+(len-left), left); + } + //printf("sample 0: %d %d", stream[0], stream[1]); +} + +/* Initialize the music players with a certain desired audio format */ +int open_music(SDL_AudioSpec *mixer) +{ +#ifdef WAV_MUSIC + if ( WAVStream_Init(mixer) == 0 ) { + add_music_decoder("WAVE"); + } +#endif +#ifdef MODPLUG_MUSIC + if ( modplug_init(mixer) == 0 ) { + add_music_decoder("MODPLUG"); + } +#endif +#ifdef MOD_MUSIC + if ( MOD_init(mixer) == 0 ) { + add_music_decoder("MIKMOD"); + } +#endif +#ifdef MID_MUSIC +#ifdef USE_TIMIDITY_MIDI + samplesize = mixer->size / mixer->samples; + if ( Timidity_Init(mixer->freq, mixer->format, + mixer->channels, mixer->samples) == 0 ) { + timidity_ok = 1; + add_music_decoder("TIMIDITY"); + } else { + timidity_ok = 0; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_init(mixer) == 0 ) { + fluidsynth_ok = 1; + add_music_decoder("FLUIDSYNTH"); + } else { + fluidsynth_ok = 0; + } +#endif +#ifdef USE_NATIVE_MIDI +#ifdef USE_FLUIDSYNTH_MIDI + native_midi_ok = !fluidsynth_ok; + if ( native_midi_ok ) +#endif +#ifdef USE_TIMIDITY_MIDI + native_midi_ok = !timidity_ok; + if ( !native_midi_ok ) { + native_midi_ok = (getenv("SDL_NATIVE_MUSIC") != NULL); + } + if ( native_midi_ok ) +#endif + native_midi_ok = native_midi_detect(); + if ( native_midi_ok ) + add_music_decoder("NATIVEMIDI"); +#endif +#endif +#ifdef OGG_MUSIC + if ( OGG_init(mixer) == 0 ) { + add_music_decoder("OGG"); + } +#endif +#ifdef FLAC_MUSIC + if ( FLAC_init(mixer) == 0 ) { + add_music_decoder("FLAC"); + } +#endif +#if defined(MP3_MUSIC) || defined(MP3_MAD_MUSIC) + /* Keep a copy of the mixer */ + used_mixer = *mixer; + add_music_decoder("MP3"); +#endif + + music_playing = NULL; + music_stopped = 0; + Mix_VolumeMusic(SDL_MIX_MAXVOLUME); + + /* Calculate the number of ms for each callback */ + ms_per_step = (int) (((float)mixer->samples * 1000.0) / mixer->freq); + + return(0); +} + +/* Portable case-insensitive string compare function */ +int MIX_string_equals(const char *str1, const char *str2) +{ + while ( *str1 && *str2 ) { + if ( toupper((unsigned char)*str1) != + toupper((unsigned char)*str2) ) + break; + ++str1; + ++str2; + } + return (!*str1 && !*str2); +} + +static int detect_mp3(Uint8 *magic) +{ + if ( strncmp((char *)magic, "ID3", 3) == 0 ) { + return 1; + } + + /* Detection code lifted from SMPEG */ + if(((magic[0] & 0xff) != 0xff) || // No sync bits + ((magic[1] & 0xf0) != 0xf0) || // + ((magic[2] & 0xf0) == 0x00) || // Bitrate is 0 + ((magic[2] & 0xf0) == 0xf0) || // Bitrate is 15 + ((magic[2] & 0x0c) == 0x0c) || // Frequency is 3 + ((magic[1] & 0x06) == 0x00)) { // Layer is 4 + return(0); + } + return 1; +} + +/* MUS_MOD can't be auto-detected. If no other format was detected, MOD is + * assumed and MUS_MOD will be returned, meaning that the format might not + * actually be MOD-based. + * + * Returns MUS_NONE in case of errors. */ +static Mix_MusicType detect_music_type(SDL_RWops *rw) +{ + Uint8 magic[5]; + Uint8 moremagic[9]; + + int start = SDL_RWtell(rw); + if (SDL_RWread(rw, magic, 1, 4) != 4 || SDL_RWread(rw, moremagic, 1, 8) != 8 ) { + Mix_SetError("Couldn't read from RWops"); + return MUS_NONE; + } + SDL_RWseek(rw, start, RW_SEEK_SET); + magic[4]='\0'; + moremagic[8] = '\0'; + + /* WAVE files have the magic four bytes "RIFF" + AIFF files have the magic 12 bytes "FORM" XXXX "AIFF" */ + if (((strcmp((char *)magic, "RIFF") == 0) && (strcmp((char *)(moremagic+4), "WAVE") == 0)) || + (strcmp((char *)magic, "FORM") == 0)) { + return MUS_WAV; + } + + /* Ogg Vorbis files have the magic four bytes "OggS" */ + if (strcmp((char *)magic, "OggS") == 0) { + return MUS_OGG; + } + + /* FLAC files have the magic four bytes "fLaC" */ + if (strcmp((char *)magic, "fLaC") == 0) { + return MUS_FLAC; + } + + /* MIDI files have the magic four bytes "MThd" */ + if (strcmp((char *)magic, "MThd") == 0) { + return MUS_MID; + } + + if (detect_mp3(magic)) { + return MUS_MP3; + } + + /* Assume MOD format. + * + * Apparently there is no way to check if the file is really a MOD, + * or there are too many formats supported by MikMod/ModPlug, or + * MikMod/ModPlug does this check by itself. */ + return MUS_MOD; +} + +/* Load a music file */ +Mix_Music *Mix_LoadMUS(const char *file) +{ + SDL_RWops *rw; + Mix_Music *music; + Mix_MusicType type; + char *ext = strrchr(file, '.'); + +#ifdef CMD_MUSIC + if ( music_cmd ) { + /* Allocate memory for the music structure */ + music = (Mix_Music *)SDL_malloc(sizeof(Mix_Music)); + if ( music == NULL ) { + Mix_SetError("Out of memory"); + return(NULL); + } + music->error = 0; + music->type = MUS_CMD; + music->data.cmd = MusicCMD_LoadSong(music_cmd, file); + if ( music->data.cmd == NULL ) { + SDL_free(music); + music == NULL; + } + return music; + } +#endif + + rw = SDL_RWFromFile(file, "rb"); + if ( rw == NULL ) { + Mix_SetError("Couldn't open '%s'", file); + return NULL; + } + + /* Use the extension as a first guess on the file type */ + type = MUS_NONE; + ext = strrchr(file, '.'); + /* No need to guard these with #ifdef *_MUSIC stuff, + * since we simply call Mix_LoadMUSType_RW() later */ + if ( ext ) { + ++ext; /* skip the dot in the extension */ + if ( MIX_string_equals(ext, "WAV") ) { + type = MUS_WAV; + } else if ( MIX_string_equals(ext, "MID") || + MIX_string_equals(ext, "MIDI") || + MIX_string_equals(ext, "KAR") ) { + type = MUS_MID; + } else if ( MIX_string_equals(ext, "OGG") ) { + type = MUS_OGG; + } else if ( MIX_string_equals(ext, "FLAC") ) { + type = MUS_FLAC; + } else if ( MIX_string_equals(ext, "MPG") || + MIX_string_equals(ext, "MPEG") || + MIX_string_equals(ext, "MP3") || + MIX_string_equals(ext, "MAD") ) { + type = MUS_MP3; + } + } + if ( type == MUS_NONE ) { + type = detect_music_type(rw); + } + + /* We need to know if a specific error occurs; if not, we'll set a + * generic one, so we clear the current one. */ + Mix_SetError(""); + music = Mix_LoadMUSType_RW(rw, type, SDL_TRUE); + if ( music == NULL && Mix_GetError()[0] == '\0' ) { + SDL_FreeRW(rw); + Mix_SetError("Couldn't open '%s'", file); + } + return music; +} + +Mix_Music *Mix_LoadMUS_RW(SDL_RWops *rw) +{ + return Mix_LoadMUSType_RW(rw, MUS_NONE, SDL_FALSE); +} + +Mix_Music *Mix_LoadMUSType_RW(SDL_RWops *rw, Mix_MusicType type, int freesrc) +{ + Mix_Music *music; + + if (!rw) { + Mix_SetError("RWops pointer is NULL"); + return NULL; + } + + /* If the caller wants auto-detection, figure out what kind of file + * this is. */ + if (type == MUS_NONE) { + if ((type = detect_music_type(rw)) == MUS_NONE) { + /* Don't call Mix_SetError() here since detect_music_type() + * does that. */ + return NULL; + } + } + + /* Allocate memory for the music structure */ + music = (Mix_Music *)SDL_malloc(sizeof(Mix_Music)); + if (music == NULL ) { + Mix_SetError("Out of memory"); + return NULL; + } + music->error = 0; + + switch (type) { +#ifdef WAV_MUSIC + case MUS_WAV: + /* The WAVE loader needs the first 4 bytes of the header */ + { + Uint8 magic[5]; + int start = SDL_RWtell(rw); + if (SDL_RWread(rw, magic, 1, 4) != 4) { + Mix_SetError("Couldn't read from RWops"); + return MUS_NONE; + } + SDL_RWseek(rw, start, RW_SEEK_SET); + magic[4] = '\0'; + music->type = MUS_WAV; + music->data.wave = WAVStream_LoadSong_RW(rw, (char *)magic, freesrc); + } + if (music->data.wave == NULL) { + music->error = 1; + } + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + music->type = MUS_OGG; + music->data.ogg = OGG_new_RW(rw, freesrc); + if ( music->data.ogg == NULL ) { + music->error = 1; + } + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + music->type = MUS_FLAC; + music->data.flac = FLAC_new_RW(rw, freesrc); + if ( music->data.flac == NULL ) { + music->error = 1; + } + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + if ( Mix_Init(MIX_INIT_MP3) ) { + SMPEG_Info info; + music->type = MUS_MP3; + music->data.mp3 = smpeg.SMPEG_new_rwops(rw, &info, 0); + if ( !info.has_audio ) { + Mix_SetError("MPEG file does not have any audio stream."); + music->error = 1; + } else { + smpeg.SMPEG_actualSpec(music->data.mp3, &used_mixer); + } + } else { + music->error = 1; + } + break; +#elif defined(MP3_MAD_MUSIC) + case MUS_MP3: + music->type = MUS_MP3_MAD; + music->data.mp3_mad = mad_openFileRW(rw, &used_mixer, freesrc); + if (music->data.mp3_mad == 0) { + Mix_SetError("Could not initialize MPEG stream."); + music->error = 1; + } + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: + music->type = MUS_MID; +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + music->data.nativemidi = native_midi_loadsong_RW(rw, freesrc); + if ( music->data.nativemidi == NULL ) { + Mix_SetError("%s", native_midi_error()); + music->error = 1; + } + break; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_ok ) { + music->data.fluidsynthmidi = fluidsynth_loadsong_RW(rw, freesrc); + if ( music->data.fluidsynthmidi == NULL ) { + music->error = 1; + } + break; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + music->data.midi = Timidity_LoadSong_RW(rw, freesrc); + if ( music->data.midi == NULL ) { + Mix_SetError("%s", Timidity_Error()); + music->error = 1; + } + //else + //printf("Timidity successfully loaded song!\n"); + } else { + Mix_SetError("%s", Timidity_Error()); + music->error = 1; + } +#endif + break; +#endif +#if defined(MODPLUG_MUSIC) || defined(MOD_MUSIC) + case MUS_MOD: + music->error = 1; +#ifdef MODPLUG_MUSIC + if ( music->error ) { + music->type = MUS_MODPLUG; + music->data.modplug = modplug_new_RW(rw, freesrc); + if ( music->data.modplug ) { + music->error = 0; + } + } +#endif +#ifdef MOD_MUSIC + if ( music->error ) { + music->type = MUS_MOD; + music->data.module = MOD_new_RW(rw, freesrc); + if ( music->data.module ) { + music->error = 0; + } + } +#endif + break; +#endif + + default: + Mix_SetError("Unrecognized music format"); + music->error=1; + } /* switch (want) */ + + + if (music->error) { + SDL_free(music); + music=NULL; + } + return(music); +} + +/* Free a music chunk previously loaded */ +void Mix_FreeMusic(Mix_Music *music) +{ + if ( music ) { + /* Stop the music if it's currently playing */ + SDL_LockAudio(); + if ( music == music_playing ) { + /* Wait for any fade out to finish */ + while ( music->fading == MIX_FADING_OUT ) { + SDL_UnlockAudio(); + SDL_Delay(100); + SDL_LockAudio(); + } + if ( music == music_playing ) { + music_internal_halt(); + } + } + SDL_UnlockAudio(); + switch (music->type) { +#ifdef CMD_MUSIC + case MUS_CMD: + MusicCMD_FreeSong(music->data.cmd); + break; +#endif +#ifdef WAV_MUSIC + case MUS_WAV: + WAVStream_FreeSong(music->data.wave); + break; +#endif +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + modplug_delete(music->data.modplug); + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + MOD_delete(music->data.module); + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + native_midi_freesong(music->data.nativemidi); + goto skip; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_ok ) { + fluidsynth_freesong(music->data.fluidsynthmidi); + goto skip; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + Timidity_FreeSong(music->data.midi); + goto skip; + } +#endif + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + OGG_delete(music->data.ogg); + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + FLAC_delete(music->data.flac); + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + smpeg.SMPEG_delete(music->data.mp3); + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + mad_closeFile(music->data.mp3_mad); + break; +#endif + default: + /* Unknown music type?? */ + break; + } + + skip: + SDL_free(music); + } +} + +/* Find out the music format of a mixer music, or the currently playing + music, if 'music' is NULL. +*/ +Mix_MusicType Mix_GetMusicType(const Mix_Music *music) +{ + Mix_MusicType type = MUS_NONE; + + if ( music ) { + type = music->type; + } else { + SDL_LockAudio(); + if ( music_playing ) { + type = music_playing->type; + } + SDL_UnlockAudio(); + } + return(type); +} + +/* Play a music chunk. Returns 0, or -1 if there was an error. + */ +static int music_internal_play(Mix_Music *music, double position) +{ + int retval = 0; + +#if defined(__MACOSX__) && defined(USE_NATIVE_MIDI) + /* This fixes a bug with native MIDI on Mac OS X, where you + can't really stop and restart MIDI from the audio callback. + */ + if ( music == music_playing && music->type == MUS_MID && native_midi_ok ) { + /* Just a seek suffices to restart playing */ + music_internal_position(position); + return 0; + } +#endif + + /* Note the music we're playing */ + if ( music_playing ) { + music_internal_halt(); + } + music_playing = music; + + /* Set the initial volume */ + if ( music->type != MUS_MOD ) { + music_internal_initialize_volume(); + } + + /* Set up for playback */ + switch (music->type) { +#ifdef CMD_MUSIC + case MUS_CMD: + MusicCMD_Start(music->data.cmd); + break; +#endif +#ifdef WAV_MUSIC + case MUS_WAV: + WAVStream_Start(music->data.wave); + break; +#endif +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + /* can't set volume until file is loaded, so finally set it now */ + music_internal_initialize_volume(); + modplug_play(music->data.modplug); + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + MOD_play(music->data.module); + /* Player_SetVolume() does nothing before Player_Start() */ + music_internal_initialize_volume(); + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + native_midi_start(music->data.nativemidi, music_loops); + goto skip; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if (fluidsynth_ok ) { + fluidsynth_start(music->data.fluidsynthmidi); + goto skip; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + Timidity_Start(music->data.midi); + goto skip; + } +#endif + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + OGG_play(music->data.ogg); + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + FLAC_play(music->data.flac); + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + smpeg.SMPEG_enableaudio(music->data.mp3,1); + smpeg.SMPEG_enablevideo(music->data.mp3,0); + smpeg.SMPEG_play(music_playing->data.mp3); + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + mad_start(music->data.mp3_mad); + break; +#endif + default: + Mix_SetError("Can't play unknown music type"); + retval = -1; + break; + } + +skip: + /* Set the playback position, note any errors if an offset is used */ + if ( retval == 0 ) { + if ( position > 0.0 ) { + if ( music_internal_position(position) < 0 ) { + Mix_SetError("Position not implemented for music type"); + retval = -1; + } + } else { + music_internal_position(0.0); + } + } + + /* If the setup failed, we're not playing any music anymore */ + if ( retval < 0 ) { + music_playing = NULL; + } + return(retval); +} +int Mix_FadeInMusicPos(Mix_Music *music, int loops, int ms, double position) +{ + int retval; + + if ( ms_per_step == 0 ) { + SDL_SetError("Audio device hasn't been opened"); + return(-1); + } + + /* Don't play null pointers :-) */ + if ( music == NULL ) { + Mix_SetError("music parameter was NULL"); + return(-1); + } + + /* Setup the data */ + if ( ms ) { + music->fading = MIX_FADING_IN; + } else { + music->fading = MIX_NO_FADING; + } + music->fade_step = 0; + music->fade_steps = ms/ms_per_step; + + /* Play the puppy */ + SDL_LockAudio(); + /* If the current music is fading out, wait for the fade to complete */ + while ( music_playing && (music_playing->fading == MIX_FADING_OUT) ) { + SDL_UnlockAudio(); + SDL_Delay(100); + SDL_LockAudio(); + } + music_active = 1; + if (loops == 1) { + /* Loop is the number of times to play the audio */ + loops = 0; + } + music_loops = loops; + retval = music_internal_play(music, position); + SDL_UnlockAudio(); + + return(retval); +} +int Mix_FadeInMusic(Mix_Music *music, int loops, int ms) +{ + return Mix_FadeInMusicPos(music, loops, ms, 0.0); +} +int Mix_PlayMusic(Mix_Music *music, int loops) +{ + return Mix_FadeInMusicPos(music, loops, 0, 0.0); +} + +/* Set the playing music position */ +int music_internal_position(double position) +{ + int retval = 0; + + switch (music_playing->type) { +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + modplug_jump_to_time(music_playing->data.modplug, position); + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + MOD_jump_to_time(music_playing->data.module, position); + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + OGG_jump_to_time(music_playing->data.ogg, position); + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + FLAC_jump_to_time(music_playing->data.flac, position); + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + smpeg.SMPEG_rewind(music_playing->data.mp3); + smpeg.SMPEG_play(music_playing->data.mp3); + if ( position > 0.0 ) { + smpeg.SMPEG_skip(music_playing->data.mp3, (float)position); + } + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + mad_seek(music_playing->data.mp3_mad, position); + break; +#endif + default: + /* TODO: Implement this for other music backends */ + retval = -1; + break; + } + return(retval); +} +int Mix_SetMusicPosition(double position) +{ + int retval; + + SDL_LockAudio(); + if ( music_playing ) { + retval = music_internal_position(position); + if ( retval < 0 ) { + Mix_SetError("Position not implemented for music type"); + } + } else { + Mix_SetError("Music isn't playing"); + retval = -1; + } + SDL_UnlockAudio(); + + return(retval); +} + +/* Set the music's initial volume */ +static void music_internal_initialize_volume(void) +{ + if ( music_playing->fading == MIX_FADING_IN ) { + music_internal_volume(0); + } else { + music_internal_volume(music_volume); + } +} + +/* Set the music volume */ +static void music_internal_volume(int volume) +{ + switch (music_playing->type) { +#ifdef CMD_MUSIC + case MUS_CMD: + MusicCMD_SetVolume(volume); + break; +#endif +#ifdef WAV_MUSIC + case MUS_WAV: + WAVStream_SetVolume(volume); + break; +#endif +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + modplug_setvolume(music_playing->data.modplug, volume); + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + MOD_setvolume(music_playing->data.module, volume); + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + native_midi_setvolume(volume); + return; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_ok ) { + fluidsynth_setvolume(music_playing->data.fluidsynthmidi, volume); + return; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + Timidity_SetVolume(volume); + return; + } +#endif + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + OGG_setvolume(music_playing->data.ogg, volume); + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + FLAC_setvolume(music_playing->data.flac, volume); + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + smpeg.SMPEG_setvolume(music_playing->data.mp3,(int)(((float)volume/(float)MIX_MAX_VOLUME)*100.0)); + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + mad_setVolume(music_playing->data.mp3_mad, volume); + break; +#endif + default: + /* Unknown music type?? */ + break; + } +} +int Mix_VolumeMusic(int volume) +{ + int prev_volume; + + prev_volume = music_volume; + if ( volume < 0 ) { + return prev_volume; + } + if ( volume > SDL_MIX_MAXVOLUME ) { + volume = SDL_MIX_MAXVOLUME; + } + music_volume = volume; + SDL_LockAudio(); + if ( music_playing ) { + music_internal_volume(music_volume); + } + SDL_UnlockAudio(); + return(prev_volume); +} + +/* Halt playing of music */ +static void music_internal_halt(void) +{ + switch (music_playing->type) { +#ifdef CMD_MUSIC + case MUS_CMD: + MusicCMD_Stop(music_playing->data.cmd); + break; +#endif +#ifdef WAV_MUSIC + case MUS_WAV: + WAVStream_Stop(); + break; +#endif +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + modplug_stop(music_playing->data.modplug); + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + MOD_stop(music_playing->data.module); + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + native_midi_stop(); + goto skip; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_ok ) { + fluidsynth_stop(music_playing->data.fluidsynthmidi); + goto skip; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + Timidity_Stop(); + goto skip; + } +#endif + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + OGG_stop(music_playing->data.ogg); + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + FLAC_stop(music_playing->data.flac); + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + smpeg.SMPEG_stop(music_playing->data.mp3); + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + mad_stop(music_playing->data.mp3_mad); + break; +#endif + default: + /* Unknown music type?? */ + return; + } + +skip: + music_playing->fading = MIX_NO_FADING; + music_playing = NULL; +} +int Mix_HaltMusic(void) +{ + SDL_LockAudio(); + if ( music_playing ) { + music_internal_halt(); + } + SDL_UnlockAudio(); + + return(0); +} + +/* Progressively stop the music */ +int Mix_FadeOutMusic(int ms) +{ + int retval = 0; + + if ( ms_per_step == 0 ) { + SDL_SetError("Audio device hasn't been opened"); + return 0; + } + + if (ms <= 0) { /* just halt immediately. */ + Mix_HaltMusic(); + return 1; + } + + SDL_LockAudio(); + if ( music_playing) { + int fade_steps = (ms + ms_per_step - 1)/ms_per_step; + if ( music_playing->fading == MIX_NO_FADING ) { + music_playing->fade_step = 0; + } else { + int step; + int old_fade_steps = music_playing->fade_steps; + if ( music_playing->fading == MIX_FADING_OUT ) { + step = music_playing->fade_step; + } else { + step = old_fade_steps + - music_playing->fade_step + 1; + } + music_playing->fade_step = (step * fade_steps) + / old_fade_steps; + } + music_playing->fading = MIX_FADING_OUT; + music_playing->fade_steps = fade_steps; + retval = 1; + } + SDL_UnlockAudio(); + + return(retval); +} + +Mix_Fading Mix_FadingMusic(void) +{ + Mix_Fading fading = MIX_NO_FADING; + + SDL_LockAudio(); + if ( music_playing ) { + fading = music_playing->fading; + } + SDL_UnlockAudio(); + + return(fading); +} + +/* Pause/Resume the music stream */ +void Mix_PauseMusic(void) +{ + music_active = 0; +} + +void Mix_ResumeMusic(void) +{ + music_active = 1; +} + +void Mix_RewindMusic(void) +{ + Mix_SetMusicPosition(0.0); +} + +int Mix_PausedMusic(void) +{ + return (music_active == 0); +} + +/* Check the status of the music */ +static int music_internal_playing() +{ + int playing = 1; + + if (music_playing == NULL) { + return 0; + } + + switch (music_playing->type) { +#ifdef CMD_MUSIC + case MUS_CMD: + if (!MusicCMD_Active(music_playing->data.cmd)) { + playing = 0; + } + break; +#endif +#ifdef WAV_MUSIC + case MUS_WAV: + if ( ! WAVStream_Active() ) { + playing = 0; + } + break; +#endif +#ifdef MODPLUG_MUSIC + case MUS_MODPLUG: + if ( ! modplug_playing(music_playing->data.modplug) ) { + playing = 0; + } + break; +#endif +#ifdef MOD_MUSIC + case MUS_MOD: + if ( ! MOD_playing(music_playing->data.module) ) { + playing = 0; + } + break; +#endif +#ifdef MID_MUSIC + case MUS_MID: +#ifdef USE_NATIVE_MIDI + if ( native_midi_ok ) { + if ( ! native_midi_active() ) + playing = 0; + goto skip; + } +#endif +#ifdef USE_FLUIDSYNTH_MIDI + if ( fluidsynth_ok ) { + if ( ! fluidsynth_active(music_playing->data.fluidsynthmidi) ) + playing = 0; + goto skip; + } +#endif +#ifdef USE_TIMIDITY_MIDI + if ( timidity_ok ) { + if ( ! Timidity_Active() ) + playing = 0; + goto skip; + } +#endif + break; +#endif +#ifdef OGG_MUSIC + case MUS_OGG: + if ( ! OGG_playing(music_playing->data.ogg) ) { + playing = 0; + } + break; +#endif +#ifdef FLAC_MUSIC + case MUS_FLAC: + if ( ! FLAC_playing(music_playing->data.flac) ) { + playing = 0; + } + break; +#endif +#ifdef MP3_MUSIC + case MUS_MP3: + if ( smpeg.SMPEG_status(music_playing->data.mp3) != SMPEG_PLAYING ) + playing = 0; + break; +#endif +#ifdef MP3_MAD_MUSIC + case MUS_MP3_MAD: + if (!mad_isPlaying(music_playing->data.mp3_mad)) { + playing = 0; + } + break; +#endif + default: + playing = 0; + break; + } + +skip: + return(playing); +} +int Mix_PlayingMusic(void) +{ + int playing = 0; + + SDL_LockAudio(); + if ( music_playing ) { + playing = music_loops || music_internal_playing(); + } + SDL_UnlockAudio(); + + return(playing); +} + +/* Set the external music playback command */ +int Mix_SetMusicCMD(const char *command) +{ + Mix_HaltMusic(); + if ( music_cmd ) { + SDL_free(music_cmd); + music_cmd = NULL; + } + if ( command ) { + music_cmd = (char *)SDL_malloc(strlen(command)+1); + if ( music_cmd == NULL ) { + return(-1); + } + strcpy(music_cmd, command); + } + return(0); +} + +int Mix_SetSynchroValue(int i) +{ + /* Not supported by any players at this time */ + return(-1); +} + +int Mix_GetSynchroValue(void) +{ + /* Not supported by any players at this time */ + return(-1); +} + + +/* Uninitialize the music players */ +void close_music(void) +{ + Mix_HaltMusic(); +#ifdef CMD_MUSIC + Mix_SetMusicCMD(NULL); +#endif +#ifdef MODPLUG_MUSIC + modplug_exit(); +#endif +#ifdef MOD_MUSIC + MOD_exit(); +#endif +#ifdef MID_MUSIC +# ifdef USE_TIMIDITY_MIDI + Timidity_Close(); +# endif +#endif + + /* rcg06042009 report available decoders at runtime. */ + SDL_free(music_decoders); + music_decoders = NULL; + num_decoders = 0; + + ms_per_step = 0; +} + +int Mix_SetSoundFonts(const char *paths) +{ +#ifdef MID_MUSIC + if (soundfont_paths) { + SDL_free(soundfont_paths); + soundfont_paths = NULL; + } + + if (paths) { + if (!(soundfont_paths = SDL_strdup(paths))) { + Mix_SetError("Insufficient memory to set SoundFonts"); + return 0; + } + } +#endif + return 1; +} + +#ifdef MID_MUSIC +const char* Mix_GetSoundFonts(void) +{ + const char* force = getenv("SDL_FORCE_SOUNDFONTS"); + + if (!soundfont_paths || (force && force[0] == '1')) { + return getenv("SDL_SOUNDFONTS"); + } else { + return soundfont_paths; + } +} + +int Mix_EachSoundFont(int (*function)(const char*, void*), void *data) +{ + char *context, *path, *paths; + const char* cpaths = Mix_GetSoundFonts(); + + if (!cpaths) { + Mix_SetError("No SoundFonts have been requested"); + return 0; + } + + if (!(paths = SDL_strdup(cpaths))) { + Mix_SetError("Insufficient memory to iterate over SoundFonts"); + return 0; + } + +#if defined(__MINGW32__) || defined(__MINGW64__) + for (path = strtok(paths, ";"); path; path = strtok(NULL, ";")) { +#elif defined(_WIN32) + for (path = strtok_s(paths, ";", &context); path; path = strtok_s(NULL, ";", &context)) { +#else + for (path = strtok_r(paths, ":;", &context); path; path = strtok_r(NULL, ":;", &context)) { +#endif + if (!function(path, data)) { + SDL_free(paths); + return 0; + } + } + + SDL_free(paths); + return 1; +} +#endif diff --git a/apps/plugins/sdl/SDL_mixer/music_cmd.c b/apps/plugins/sdl/SDL_mixer/music_cmd.c new file mode 100644 index 0000000..968794b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_cmd.c @@ -0,0 +1,241 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ +#include "SDL_config.h" + +/* This file supports an external command for playing music */ + +#ifdef CMD_MUSIC + +#include +#include +#include +#include +#include +#include +#include +#include + +#include "SDL_mixer.h" +#include "music_cmd.h" + +/* Unimplemented */ +void MusicCMD_SetVolume(int volume) +{ + Mix_SetError("No way to modify external player volume"); +} + +/* Load a music stream from the given file */ +MusicCMD *MusicCMD_LoadSong(const char *cmd, const char *file) +{ + MusicCMD *music; + + /* Allocate and fill the music structure */ + music = (MusicCMD *)SDL_malloc(sizeof *music); + if ( music == NULL ) { + Mix_SetError("Out of memory"); + return(NULL); + } + strncpy(music->file, file, (sizeof music->file)-1); + music->file[(sizeof music->file)-1] = '\0'; + strncpy(music->cmd, cmd, (sizeof music->cmd)-1); + music->cmd[(sizeof music->cmd)-1] = '\0'; + music->pid = 0; + + /* We're done */ + return(music); +} + +/* Parse a command line buffer into arguments */ +static int ParseCommandLine(char *cmdline, char **argv) +{ + char *bufp; + int argc; + + argc = 0; + for ( bufp = cmdline; *bufp; ) { + /* Skip leading whitespace */ + while ( isspace(*bufp) ) { + ++bufp; + } + /* Skip over argument */ + if ( *bufp == '"' ) { + ++bufp; + if ( *bufp ) { + if ( argv ) { + argv[argc] = bufp; + } + ++argc; + } + /* Skip over word */ + while ( *bufp && (*bufp != '"') ) { + ++bufp; + } + } else { + if ( *bufp ) { + if ( argv ) { + argv[argc] = bufp; + } + ++argc; + } + /* Skip over word */ + while ( *bufp && ! isspace(*bufp) ) { + ++bufp; + } + } + if ( *bufp ) { + if ( argv ) { + *bufp = '\0'; + } + ++bufp; + } + } + if ( argv ) { + argv[argc] = NULL; + } + return(argc); +} + +static char **parse_args(char *command, char *last_arg) +{ + int argc; + char **argv; + + /* Parse the command line */ + argc = ParseCommandLine(command, NULL); + if ( last_arg ) { + ++argc; + } + argv = (char **)SDL_malloc((argc+1)*(sizeof *argv)); + if ( argv == NULL ) { + return(NULL); + } + argc = ParseCommandLine(command, argv); + + /* Add last command line argument */ + if ( last_arg ) { + argv[argc++] = last_arg; + } + argv[argc] = NULL; + + /* We're ready! */ + return(argv); +} + +/* Start playback of a given music stream */ +void MusicCMD_Start(MusicCMD *music) +{ +#ifdef HAVE_FORK + music->pid = fork(); +#else + music->pid = vfork(); +#endif + switch(music->pid) { + /* Failed fork() system call */ + case -1: + Mix_SetError("fork() failed"); + return; + + /* Child process - executes here */ + case 0: { + char command[PATH_MAX]; + char **argv; + + /* Unblock signals in case we're called from a thread */ + { + sigset_t mask; + sigemptyset(&mask); + sigprocmask(SIG_SETMASK, &mask, NULL); + } + + /* Execute the command */ + strcpy(command, music->cmd); + argv = parse_args(command, music->file); + if ( argv != NULL ) { + execvp(argv[0], argv); + } + + /* exec() failed */ + perror(argv[0]); + _exit(-1); + } + break; + + /* Parent process - executes here */ + default: + break; + } + return; +} + +/* Stop playback of a stream previously started with MusicCMD_Start() */ +void MusicCMD_Stop(MusicCMD *music) +{ + int status; + + if ( music->pid > 0 ) { + while ( kill(music->pid, 0) == 0 ) { + kill(music->pid, SIGTERM); + sleep(1); + waitpid(music->pid, &status, WNOHANG); + } + music->pid = 0; + } +} + +/* Pause playback of a given music stream */ +void MusicCMD_Pause(MusicCMD *music) +{ + if ( music->pid > 0 ) { + kill(music->pid, SIGSTOP); + } +} + +/* Resume playback of a given music stream */ +void MusicCMD_Resume(MusicCMD *music) +{ + if ( music->pid > 0 ) { + kill(music->pid, SIGCONT); + } +} + +/* Close the given music stream */ +void MusicCMD_FreeSong(MusicCMD *music) +{ + SDL_free(music); +} + +/* Return non-zero if a stream is currently playing */ +int MusicCMD_Active(MusicCMD *music) +{ + int status; + int active; + + active = 0; + if ( music->pid > 0 ) { + waitpid(music->pid, &status, WNOHANG); + if ( kill(music->pid, 0) == 0 ) { + active = 1; + } + } + return(active); +} + +#endif /* CMD_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_cmd.h b/apps/plugins/sdl/SDL_mixer/music_cmd.h new file mode 100644 index 0000000..10168de --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_cmd.h @@ -0,0 +1,62 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This file supports an external command for playing music */ + +#ifdef CMD_MUSIC + +#include +#include +#include +#if defined(__linux__) && defined(__arm__) +# include +#endif +typedef struct { + char file[PATH_MAX]; + char cmd[PATH_MAX]; + pid_t pid; +} MusicCMD; + +/* Unimplemented */ +extern void MusicCMD_SetVolume(int volume); + +/* Load a music stream from the given file */ +extern MusicCMD *MusicCMD_LoadSong(const char *cmd, const char *file); + +/* Start playback of a given music stream */ +extern void MusicCMD_Start(MusicCMD *music); + +/* Stop playback of a stream previously started with MusicCMD_Start() */ +extern void MusicCMD_Stop(MusicCMD *music); + +/* Pause playback of a given music stream */ +extern void MusicCMD_Pause(MusicCMD *music); + +/* Resume playback of a given music stream */ +extern void MusicCMD_Resume(MusicCMD *music); + +/* Close the given music stream */ +extern void MusicCMD_FreeSong(MusicCMD *music); + +/* Return non-zero if a stream is currently playing */ +extern int MusicCMD_Active(MusicCMD *music); + +#endif /* CMD_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_flac.c b/apps/plugins/sdl/SDL_mixer/music_flac.c new file mode 100644 index 0000000..e2ffc57 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_flac.c @@ -0,0 +1,593 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + This file is used to support SDL_LoadMUS playback of FLAC files. + ~ Austen Dicken (admin@cvpcs.org) +*/ + +#ifdef FLAC_MUSIC + +#include "SDL_mixer.h" +#include "dynamic_flac.h" +#include "music_flac.h" + +/* This is the format of the audio mixer data */ +static SDL_AudioSpec mixer; + +/* Initialize the FLAC player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +int FLAC_init(SDL_AudioSpec *mixerfmt) +{ + mixer = *mixerfmt; + return(0); +} + +/* Set the volume for an FLAC stream */ +void FLAC_setvolume(FLAC_music *music, int volume) +{ + music->volume = volume; +} + +static FLAC__StreamDecoderReadStatus flac_read_music_cb( + const FLAC__StreamDecoder *decoder, + FLAC__byte buffer[], + size_t *bytes, + void *client_data) +{ + FLAC_music *data = (FLAC_music*)client_data; + + // make sure there is something to be reading + if (*bytes > 0) { + *bytes = SDL_RWread (data->rwops, buffer, sizeof (FLAC__byte), *bytes); + + if (*bytes < 0) { // error in read + return FLAC__STREAM_DECODER_READ_STATUS_ABORT; + } + else if (*bytes == 0 ) { // no data was read (EOF) + return FLAC__STREAM_DECODER_READ_STATUS_END_OF_STREAM; + } + else { // data was read, continue + return FLAC__STREAM_DECODER_READ_STATUS_CONTINUE; + } + } + else { + return FLAC__STREAM_DECODER_READ_STATUS_ABORT; + } +} + +static FLAC__StreamDecoderSeekStatus flac_seek_music_cb( + const FLAC__StreamDecoder *decoder, + FLAC__uint64 absolute_byte_offset, + void *client_data) +{ + FLAC_music *data = (FLAC_music*)client_data; + + if (SDL_RWseek (data->rwops, absolute_byte_offset, RW_SEEK_SET) < 0) { + return FLAC__STREAM_DECODER_SEEK_STATUS_ERROR; + } + else { + return FLAC__STREAM_DECODER_SEEK_STATUS_OK; + } +} + +static FLAC__StreamDecoderTellStatus flac_tell_music_cb( + const FLAC__StreamDecoder *decoder, + FLAC__uint64 *absolute_byte_offset, + void *client_data ) +{ + FLAC_music *data = (FLAC_music*)client_data; + + int pos = SDL_RWtell (data->rwops); + + if (pos < 0) { + return FLAC__STREAM_DECODER_TELL_STATUS_ERROR; + } + else { + *absolute_byte_offset = (FLAC__uint64)pos; + return FLAC__STREAM_DECODER_TELL_STATUS_OK; + } +} + +static FLAC__StreamDecoderLengthStatus flac_length_music_cb ( + const FLAC__StreamDecoder *decoder, + FLAC__uint64 *stream_length, + void *client_data) +{ + FLAC_music *data = (FLAC_music*)client_data; + + int pos = SDL_RWtell (data->rwops); + int length = SDL_RWseek (data->rwops, 0, RW_SEEK_END); + + if (SDL_RWseek (data->rwops, pos, RW_SEEK_SET) != pos || length < 0) { + /* there was an error attempting to return the stream to the original + * position, or the length was invalid. */ + return FLAC__STREAM_DECODER_LENGTH_STATUS_ERROR; + } + else { + *stream_length = (FLAC__uint64)length; + return FLAC__STREAM_DECODER_LENGTH_STATUS_OK; + } +} + +static FLAC__bool flac_eof_music_cb( + const FLAC__StreamDecoder *decoder, + void *client_data ) +{ + FLAC_music *data = (FLAC_music*)client_data; + + int pos = SDL_RWtell (data->rwops); + int end = SDL_RWseek (data->rwops, 0, RW_SEEK_END); + + // was the original position equal to the end (a.k.a. the seek didn't move)? + if (pos == end) { + // must be EOF + return true; + } + else { + // not EOF, return to the original position + SDL_RWseek (data->rwops, pos, RW_SEEK_SET); + + return false; + } +} + +static FLAC__StreamDecoderWriteStatus flac_write_music_cb( + const FLAC__StreamDecoder *decoder, + const FLAC__Frame *frame, + const FLAC__int32 *const buffer[], + void *client_data) +{ + FLAC_music *data = (FLAC_music *)client_data; + size_t i; + + if (data->flac_data.total_samples == 0) { + SDL_SetError ("Given FLAC file does not specify its sample count."); + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + + if (data->flac_data.channels != 2 || + data->flac_data.bits_per_sample != 16) { + SDL_SetError("Current FLAC support is only for 16 bit Stereo files."); + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + + for (i = 0; i < frame->header.blocksize; i++) { + FLAC__int16 i16; + FLAC__uint16 ui16; + + // make sure we still have at least two bytes that can be read (one for + // each channel) + if (data->flac_data.max_to_read >= 4) { + // does the data block exist? + if (!data->flac_data.data) { + data->flac_data.data_len = data->flac_data.max_to_read; + data->flac_data.data_read = 0; + + // create it + data->flac_data.data = + (char *)SDL_malloc (data->flac_data.data_len); + + if (!data->flac_data.data) { + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + } + + i16 = (FLAC__int16)buffer[0][i]; + ui16 = (FLAC__uint16)i16; + + *((data->flac_data.data) + (data->flac_data.data_read++)) = + (char)(ui16); + *((data->flac_data.data) + (data->flac_data.data_read++)) = + (char)(ui16 >> 8); + + i16 = (FLAC__int16)buffer[1][i]; + ui16 = (FLAC__uint16)i16; + + *((data->flac_data.data) + (data->flac_data.data_read++)) = + (char)(ui16); + *((data->flac_data.data) + (data->flac_data.data_read++)) = + (char)(ui16 >> 8); + + data->flac_data.max_to_read -= 4; + + if (data->flac_data.max_to_read < 4) { + // we need to set this so that the read halts from the + // FLAC_getsome function. + data->flac_data.max_to_read = 0; + } + } + else { + // we need to write to the overflow + if (!data->flac_data.overflow) { + data->flac_data.overflow_len = + 4 * (frame->header.blocksize - i); + data->flac_data.overflow_read = 0; + + // make it big enough for the rest of the block + data->flac_data.overflow = + (char *)SDL_malloc (data->flac_data.overflow_len); + + if (!data->flac_data.overflow) { + return FLAC__STREAM_DECODER_WRITE_STATUS_ABORT; + } + } + + i16 = (FLAC__int16)buffer[0][i]; + ui16 = (FLAC__uint16)i16; + + *((data->flac_data.overflow) + (data->flac_data.overflow_read++)) = + (char)(ui16); + *((data->flac_data.overflow) + (data->flac_data.overflow_read++)) = + (char)(ui16 >> 8); + + i16 = (FLAC__int16)buffer[1][i]; + ui16 = (FLAC__uint16)i16; + + *((data->flac_data.overflow) + (data->flac_data.overflow_read++)) = + (char)(ui16); + *((data->flac_data.overflow) + (data->flac_data.overflow_read++)) = + (char)(ui16 >> 8); + } + } + + return FLAC__STREAM_DECODER_WRITE_STATUS_CONTINUE; +} + +static void flac_metadata_music_cb( + const FLAC__StreamDecoder *decoder, + const FLAC__StreamMetadata *metadata, + void *client_data) +{ + FLAC_music *data = (FLAC_music *)client_data; + + if (metadata->type == FLAC__METADATA_TYPE_STREAMINFO) { + data->flac_data.sample_rate = metadata->data.stream_info.sample_rate; + data->flac_data.channels = metadata->data.stream_info.channels; + data->flac_data.total_samples = + metadata->data.stream_info.total_samples; + data->flac_data.bits_per_sample = + metadata->data.stream_info.bits_per_sample; + data->flac_data.sample_size = data->flac_data.channels * + ((data->flac_data.bits_per_sample) / 8); + } +} + +static void flac_error_music_cb( + const FLAC__StreamDecoder *decoder, + FLAC__StreamDecoderErrorStatus status, + void *client_data) +{ + // print an SDL error based on the error status + switch (status) { + case FLAC__STREAM_DECODER_ERROR_STATUS_LOST_SYNC: + SDL_SetError ("Error processing the FLAC file [LOST_SYNC]."); + break; + case FLAC__STREAM_DECODER_ERROR_STATUS_BAD_HEADER: + SDL_SetError ("Error processing the FLAC file [BAD_HEADER]."); + break; + case FLAC__STREAM_DECODER_ERROR_STATUS_FRAME_CRC_MISMATCH: + SDL_SetError ("Error processing the FLAC file [CRC_MISMATCH]."); + break; + case FLAC__STREAM_DECODER_ERROR_STATUS_UNPARSEABLE_STREAM: + SDL_SetError ("Error processing the FLAC file [UNPARSEABLE]."); + break; + default: + SDL_SetError ("Error processing the FLAC file [UNKNOWN]."); + break; + } +} + +/* Load an FLAC stream from an SDL_RWops object */ +FLAC_music *FLAC_new_RW(SDL_RWops *rw, int freerw) +{ + FLAC_music *music; + int init_stage = 0; + int was_error = 1; + + if (!Mix_Init(MIX_INIT_FLAC)) { + if (freerw) { + SDL_RWclose(rw); + } + return NULL; + } + + music = (FLAC_music *)SDL_malloc ( sizeof (*music)); + if (music) { + /* Initialize the music structure */ + memset (music, 0, (sizeof (*music))); + FLAC_stop (music); + FLAC_setvolume (music, MIX_MAX_VOLUME); + music->section = -1; + music->rwops = rw; + music->freerw = freerw; + music->flac_data.max_to_read = 0; + music->flac_data.overflow = NULL; + music->flac_data.overflow_len = 0; + music->flac_data.overflow_read = 0; + music->flac_data.data = NULL; + music->flac_data.data_len = 0; + music->flac_data.data_read = 0; + + init_stage++; // stage 1! + + music->flac_decoder = flac.FLAC__stream_decoder_new (); + + if (music->flac_decoder != NULL) { + init_stage++; // stage 2! + + if (flac.FLAC__stream_decoder_init_stream( + music->flac_decoder, + flac_read_music_cb, flac_seek_music_cb, + flac_tell_music_cb, flac_length_music_cb, + flac_eof_music_cb, flac_write_music_cb, + flac_metadata_music_cb, flac_error_music_cb, + music) == FLAC__STREAM_DECODER_INIT_STATUS_OK ) { + init_stage++; // stage 3! + + if (flac.FLAC__stream_decoder_process_until_end_of_metadata + (music->flac_decoder)) { + was_error = 0; + } else { + SDL_SetError("FLAC__stream_decoder_process_until_end_of_metadata() failed"); + } + } else { + SDL_SetError("FLAC__stream_decoder_init_stream() failed"); + } + } else { + SDL_SetError("FLAC__stream_decoder_new() failed"); + } + + if (was_error) { + switch (init_stage) { + case 3: + flac.FLAC__stream_decoder_finish( music->flac_decoder ); + case 2: + flac.FLAC__stream_decoder_delete( music->flac_decoder ); + case 1: + case 0: + SDL_free(music); + if (freerw) { + SDL_RWclose(rw); + } + break; + } + return NULL; + } + } else { + SDL_OutOfMemory(); + if (freerw) { + SDL_RWclose(rw); + } + return NULL; + } + + return music; +} + +/* Start playback of a given FLAC stream */ +void FLAC_play(FLAC_music *music) +{ + music->playing = 1; +} + +/* Return non-zero if a stream is currently playing */ +int FLAC_playing(FLAC_music *music) +{ + return(music->playing); +} + +/* Read some FLAC stream data and convert it for output */ +static void FLAC_getsome(FLAC_music *music) +{ + SDL_AudioCVT *cvt; + + /* GET AUDIO WAVE DATA */ + // set the max number of characters to read + music->flac_data.max_to_read = 8192; + music->flac_data.data_len = music->flac_data.max_to_read; + music->flac_data.data_read = 0; + if (!music->flac_data.data) { + music->flac_data.data = (char *)SDL_malloc (music->flac_data.data_len); + } + + // we have data to read + while(music->flac_data.max_to_read > 0) { + // first check if there is data in the overflow from before + if (music->flac_data.overflow) { + size_t overflow_len = music->flac_data.overflow_read; + + if (overflow_len > music->flac_data.max_to_read) { + size_t overflow_extra_len = overflow_len - + music->flac_data.max_to_read; + + memcpy (music->flac_data.data+music->flac_data.data_read, + music->flac_data.overflow, music->flac_data.max_to_read); + music->flac_data.data_read += music->flac_data.max_to_read; + memcpy (music->flac_data.overflow, + music->flac_data.overflow + music->flac_data.max_to_read, + overflow_extra_len); + music->flac_data.overflow_len = overflow_extra_len; + music->flac_data.overflow_read = overflow_extra_len; + music->flac_data.max_to_read = 0; + } + else { + memcpy (music->flac_data.data+music->flac_data.data_read, + music->flac_data.overflow, overflow_len); + music->flac_data.data_read += overflow_len; + free (music->flac_data.overflow); + music->flac_data.overflow = NULL; + music->flac_data.overflow_len = 0; + music->flac_data.overflow_read = 0; + music->flac_data.max_to_read -= overflow_len; + } + } + else { + if (!flac.FLAC__stream_decoder_process_single ( + music->flac_decoder)) { + music->flac_data.max_to_read = 0; + } + + if (flac.FLAC__stream_decoder_get_state (music->flac_decoder) + == FLAC__STREAM_DECODER_END_OF_STREAM) { + music->flac_data.max_to_read = 0; + } + } + } + + if (music->flac_data.data_read <= 0) { + if (music->flac_data.data_read == 0) { + music->playing = 0; + } + return; + } + cvt = &music->cvt; + if (music->section < 0) { + + SDL_BuildAudioCVT (cvt, AUDIO_S16, (Uint8)music->flac_data.channels, + (int)music->flac_data.sample_rate, mixer.format, + mixer.channels, mixer.freq); + if (cvt->buf) { + free (cvt->buf); + } + cvt->buf = (Uint8 *)SDL_malloc (music->flac_data.data_len * cvt->len_mult); + music->section = 0; + } + if (cvt->buf) { + memcpy (cvt->buf, music->flac_data.data, music->flac_data.data_read); + if (cvt->needed) { + cvt->len = music->flac_data.data_read; + SDL_ConvertAudio (cvt); + } + else { + cvt->len_cvt = music->flac_data.data_read; + } + music->len_available = music->cvt.len_cvt; + music->snd_available = music->cvt.buf; + } + else { + SDL_SetError ("Out of memory"); + music->playing = 0; + } +} + +/* Play some of a stream previously started with FLAC_play() */ +int FLAC_playAudio(FLAC_music *music, Uint8 *snd, int len) +{ + int mixable; + + while ((len > 0) && music->playing) { + if (!music->len_available) { + FLAC_getsome (music); + } + mixable = len; + if (mixable > music->len_available) { + mixable = music->len_available; + } + if (music->volume == MIX_MAX_VOLUME) { + memcpy (snd, music->snd_available, mixable); + } + else { + SDL_MixAudio (snd, music->snd_available, mixable, music->volume); + } + music->len_available -= mixable; + music->snd_available += mixable; + len -= mixable; + snd += mixable; + } + + return len; +} + +/* Stop playback of a stream previously started with FLAC_play() */ +void FLAC_stop(FLAC_music *music) +{ + music->playing = 0; +} + +/* Close the given FLAC_music object */ +void FLAC_delete(FLAC_music *music) +{ + if (music) { + if (music->flac_decoder) { + flac.FLAC__stream_decoder_finish (music->flac_decoder); + flac.FLAC__stream_decoder_delete (music->flac_decoder); + } + + if (music->flac_data.data) { + free (music->flac_data.data); + } + + if (music->flac_data.overflow) { + free (music->flac_data.overflow); + } + + if (music->cvt.buf) { + free (music->cvt.buf); + } + + if (music->freerw) { + SDL_RWclose(music->rwops); + } + free (music); + } +} + +/* Jump (seek) to a given position (time is in seconds) */ +void FLAC_jump_to_time(FLAC_music *music, double time) +{ + if (music) { + if (music->flac_decoder) { + double seek_sample = music->flac_data.sample_rate * time; + + // clear data if it has data + if (music->flac_data.data) { + free (music->flac_data.data); + music->flac_data.data = NULL; + } + + // clear overflow if it has data + if (music->flac_data.overflow) { + free (music->flac_data.overflow); + music->flac_data.overflow = NULL; + } + + if (!flac.FLAC__stream_decoder_seek_absolute (music->flac_decoder, + (FLAC__uint64)seek_sample)) { + if (flac.FLAC__stream_decoder_get_state (music->flac_decoder) + == FLAC__STREAM_DECODER_SEEK_ERROR) { + flac.FLAC__stream_decoder_flush (music->flac_decoder); + } + + SDL_SetError + ("Seeking of FLAC stream failed: libFLAC seek failed."); + } + } + else { + SDL_SetError + ("Seeking of FLAC stream failed: FLAC decoder was NULL."); + } + } + else { + SDL_SetError ("Seeking of FLAC stream failed: music was NULL."); + } +} + +#endif /* FLAC_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_flac.h b/apps/plugins/sdl/SDL_mixer/music_flac.h new file mode 100644 index 0000000..c87dc9e --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_flac.h @@ -0,0 +1,90 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. + + Header to handle loading FLAC music files in SDL. + ~ Austen Dicken (admin@cvpcs.org) +*/ + +/* $Id: $ */ + +#ifdef FLAC_MUSIC + +#include + +typedef struct { + FLAC__uint64 sample_size; + unsigned sample_rate; + unsigned channels; + unsigned bits_per_sample; + FLAC__uint64 total_samples; + + // the following are used to handle the callback nature of the writer + int max_to_read; + char *data; // pointer to beginning of data array + int data_len; // size of data array + int data_read; // amount of data array used + char *overflow; // pointer to beginning of overflow array + int overflow_len; // size of overflow array + int overflow_read; // amount of overflow array used +} FLAC_Data; + +typedef struct { + int playing; + int volume; + int section; + FLAC__StreamDecoder *flac_decoder; + FLAC_Data flac_data; + SDL_RWops *rwops; + int freerw; + SDL_AudioCVT cvt; + int len_available; + Uint8 *snd_available; +} FLAC_music; + +/* Initialize the FLAC player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +extern int FLAC_init(SDL_AudioSpec *mixer); + +/* Set the volume for a FLAC stream */ +extern void FLAC_setvolume(FLAC_music *music, int volume); + +/* Load an FLAC stream from an SDL_RWops object */ +extern FLAC_music *FLAC_new_RW(SDL_RWops *rw, int freerw); + +/* Start playback of a given FLAC stream */ +extern void FLAC_play(FLAC_music *music); + +/* Return non-zero if a stream is currently playing */ +extern int FLAC_playing(FLAC_music *music); + +/* Play some of a stream previously started with FLAC_play() */ +extern int FLAC_playAudio(FLAC_music *music, Uint8 *stream, int len); + +/* Stop playback of a stream previously started with FLAC_play() */ +extern void FLAC_stop(FLAC_music *music); + +/* Close the given FLAC stream */ +extern void FLAC_delete(FLAC_music *music); + +/* Jump (seek) to a given position (time is in seconds) */ +extern void FLAC_jump_to_time(FLAC_music *music, double time); + +#endif /* FLAC_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_mad.c b/apps/plugins/sdl/SDL_mixer/music_mad.c new file mode 100644 index 0000000..e9bedf5 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_mad.c @@ -0,0 +1,325 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef MP3_MAD_MUSIC + +#include "music_mad.h" + +mad_data * +mad_openFileRW(SDL_RWops *rw, SDL_AudioSpec *mixer, int freerw) +{ + mad_data *mp3_mad; + + mp3_mad = (mad_data *)SDL_malloc(sizeof(mad_data)); + if (mp3_mad) { + mp3_mad->rw = rw; + mp3_mad->freerw = freerw; + mad_stream_init(&mp3_mad->stream); + mad_frame_init(&mp3_mad->frame); + mad_synth_init(&mp3_mad->synth); + mp3_mad->frames_read = 0; + mad_timer_reset(&mp3_mad->next_frame_start); + mp3_mad->volume = MIX_MAX_VOLUME; + mp3_mad->status = 0; + mp3_mad->output_begin = 0; + mp3_mad->output_end = 0; + mp3_mad->mixer = *mixer; + } + return mp3_mad; +} + +void +mad_closeFile(mad_data *mp3_mad) +{ + mad_stream_finish(&mp3_mad->stream); + mad_frame_finish(&mp3_mad->frame); + mad_synth_finish(&mp3_mad->synth); + + if (mp3_mad->freerw) { + SDL_RWclose(mp3_mad->rw); + } + SDL_free(mp3_mad); +} + +/* Starts the playback. */ +void +mad_start(mad_data *mp3_mad) { + mp3_mad->status |= MS_playing; +} + +/* Stops the playback. */ +void +mad_stop(mad_data *mp3_mad) { + mp3_mad->status &= ~MS_playing; +} + +/* Returns true if the playing is engaged, false otherwise. */ +int +mad_isPlaying(mad_data *mp3_mad) { + return ((mp3_mad->status & MS_playing) != 0); +} + +/* Reads the next frame from the file. Returns true on success or + false on failure. */ +static int +read_next_frame(mad_data *mp3_mad) { + if (mp3_mad->stream.buffer == NULL || + mp3_mad->stream.error == MAD_ERROR_BUFLEN) { + size_t read_size; + size_t remaining; + unsigned char *read_start; + + /* There might be some bytes in the buffer left over from last + time. If so, move them down and read more bytes following + them. */ + if (mp3_mad->stream.next_frame != NULL) { + remaining = mp3_mad->stream.bufend - mp3_mad->stream.next_frame; + memmove(mp3_mad->input_buffer, mp3_mad->stream.next_frame, remaining); + read_start = mp3_mad->input_buffer + remaining; + read_size = MAD_INPUT_BUFFER_SIZE - remaining; + + } else { + read_size = MAD_INPUT_BUFFER_SIZE; + read_start = mp3_mad->input_buffer; + remaining = 0; + } + + /* Now read additional bytes from the input file. */ + read_size = SDL_RWread(mp3_mad->rw, read_start, 1, read_size); + + if (read_size <= 0) { + if ((mp3_mad->status & (MS_input_eof | MS_input_error)) == 0) { + if (read_size == 0) { + mp3_mad->status |= MS_input_eof; + } else { + mp3_mad->status |= MS_input_error; + } + + /* At the end of the file, we must stuff MAD_BUFFER_GUARD + number of 0 bytes. */ + memset(read_start + read_size, 0, MAD_BUFFER_GUARD); + read_size += MAD_BUFFER_GUARD; + } + } + + /* Now feed those bytes into the libmad stream. */ + mad_stream_buffer(&mp3_mad->stream, mp3_mad->input_buffer, + read_size + remaining); + mp3_mad->stream.error = MAD_ERROR_NONE; + } + + /* Now ask libmad to extract a frame from the data we just put in + its buffer. */ + if (mad_frame_decode(&mp3_mad->frame, &mp3_mad->stream)) { + if (MAD_RECOVERABLE(mp3_mad->stream.error)) { + return 0; + + } else if (mp3_mad->stream.error == MAD_ERROR_BUFLEN) { + return 0; + + } else { + mp3_mad->status |= MS_decode_error; + return 0; + } + } + + mp3_mad->frames_read++; + mad_timer_add(&mp3_mad->next_frame_start, mp3_mad->frame.header.duration); + + return 1; +} + +/* Scale a MAD sample to 16 bits for output. */ +static signed int +scale(mad_fixed_t sample) { + /* round */ + sample += (1L << (MAD_F_FRACBITS - 16)); + + /* clip */ + if (sample >= MAD_F_ONE) + sample = MAD_F_ONE - 1; + else if (sample < -MAD_F_ONE) + sample = -MAD_F_ONE; + + /* quantize */ + return sample >> (MAD_F_FRACBITS + 1 - 16); +} + +/* Once the frame has been read, copies its samples into the output + buffer. */ +static void +decode_frame(mad_data *mp3_mad) { + struct mad_pcm *pcm; + unsigned int nchannels, nsamples; + mad_fixed_t const *left_ch, *right_ch; + unsigned char *out; + int ret; + + mad_synth_frame(&mp3_mad->synth, &mp3_mad->frame); + pcm = &mp3_mad->synth.pcm; + out = mp3_mad->output_buffer + mp3_mad->output_end; + + if ((mp3_mad->status & MS_cvt_decoded) == 0) { + mp3_mad->status |= MS_cvt_decoded; + + /* The first frame determines some key properties of the stream. + In particular, it tells us enough to set up the convert + structure now. */ + SDL_BuildAudioCVT(&mp3_mad->cvt, AUDIO_S16, pcm->channels, mp3_mad->frame.header.samplerate, mp3_mad->mixer.format, mp3_mad->mixer.channels, mp3_mad->mixer.freq); + } + + /* pcm->samplerate contains the sampling frequency */ + + nchannels = pcm->channels; + nsamples = pcm->length; + left_ch = pcm->samples[0]; + right_ch = pcm->samples[1]; + + while (nsamples--) { + signed int sample; + + /* output sample(s) in 16-bit signed little-endian PCM */ + + sample = scale(*left_ch++); + *out++ = ((sample >> 0) & 0xff); + *out++ = ((sample >> 8) & 0xff); + + if (nchannels == 2) { + sample = scale(*right_ch++); + *out++ = ((sample >> 0) & 0xff); + *out++ = ((sample >> 8) & 0xff); + } + } + + mp3_mad->output_end = out - mp3_mad->output_buffer; + /*assert(mp3_mad->output_end <= MAD_OUTPUT_BUFFER_SIZE);*/ +} + +int +mad_getSamples(mad_data *mp3_mad, Uint8 *stream, int len) { + int bytes_remaining; + int num_bytes; + Uint8 *out; + + if ((mp3_mad->status & MS_playing) == 0) { + /* We're not supposed to be playing, so send silence instead. */ + memset(stream, 0, len); + return; + } + + out = stream; + bytes_remaining = len; + while (bytes_remaining > 0) { + if (mp3_mad->output_end == mp3_mad->output_begin) { + /* We need to get a new frame. */ + mp3_mad->output_begin = 0; + mp3_mad->output_end = 0; + if (!read_next_frame(mp3_mad)) { + if ((mp3_mad->status & MS_error_flags) != 0) { + /* Couldn't read a frame; either an error condition or + end-of-file. Stop. */ + memset(out, 0, bytes_remaining); + mp3_mad->status &= ~MS_playing; + return bytes_remaining; + } + } else { + decode_frame(mp3_mad); + + /* Now convert the frame data to the appropriate format for + output. */ + mp3_mad->cvt.buf = mp3_mad->output_buffer; + mp3_mad->cvt.len = mp3_mad->output_end; + + mp3_mad->output_end = (int)(mp3_mad->output_end * mp3_mad->cvt.len_ratio); + /*assert(mp3_mad->output_end <= MAD_OUTPUT_BUFFER_SIZE);*/ + SDL_ConvertAudio(&mp3_mad->cvt); + } + } + + num_bytes = mp3_mad->output_end - mp3_mad->output_begin; + if (bytes_remaining < num_bytes) { + num_bytes = bytes_remaining; + } + + if (mp3_mad->volume == MIX_MAX_VOLUME) { + memcpy(out, mp3_mad->output_buffer + mp3_mad->output_begin, num_bytes); + } else { + SDL_MixAudio(out, mp3_mad->output_buffer + mp3_mad->output_begin, + num_bytes, mp3_mad->volume); + } + out += num_bytes; + mp3_mad->output_begin += num_bytes; + bytes_remaining -= num_bytes; + } + return 0; +} + +void +mad_seek(mad_data *mp3_mad, double position) { + mad_timer_t target; + int int_part; + + int_part = (int)position; + mad_timer_set(&target, int_part, + (int)((position - int_part) * 1000000), 1000000); + + if (mad_timer_compare(mp3_mad->next_frame_start, target) > 0) { + /* In order to seek backwards in a VBR file, we have to rewind and + start again from the beginning. This isn't necessary if the + file happens to be CBR, of course; in that case we could seek + directly to the frame we want. But I leave that little + optimization for the future developer who discovers she really + needs it. */ + mp3_mad->frames_read = 0; + mad_timer_reset(&mp3_mad->next_frame_start); + mp3_mad->status &= ~MS_error_flags; + mp3_mad->output_begin = 0; + mp3_mad->output_end = 0; + + SDL_RWseek(mp3_mad->rw, 0, RW_SEEK_SET); + } + + /* Now we have to skip frames until we come to the right one. + Again, only truly necessary if the file is VBR. */ + while (mad_timer_compare(mp3_mad->next_frame_start, target) < 0) { + if (!read_next_frame(mp3_mad)) { + if ((mp3_mad->status & MS_error_flags) != 0) { + /* Couldn't read a frame; either an error condition or + end-of-file. Stop. */ + mp3_mad->status &= ~MS_playing; + return; + } + } + } + + /* Here we are, at the beginning of the frame that contains the + target time. Ehh, I say that's close enough. If we wanted to, + we could get more precise by decoding the frame now and counting + the appropriate number of samples out of it. */ +} + +void +mad_setVolume(mad_data *mp3_mad, int volume) { + mp3_mad->volume = volume; +} + + +#endif /* MP3_MAD_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_mad.h b/apps/plugins/sdl/SDL_mixer/music_mad.h new file mode 100644 index 0000000..af93c8d --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_mad.h @@ -0,0 +1,72 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifdef MP3_MAD_MUSIC + +#include "mad.h" +#include "SDL_rwops.h" +#include "SDL_audio.h" +#include "SDL_mixer.h" + +#define MAD_INPUT_BUFFER_SIZE (5*8192) +#define MAD_OUTPUT_BUFFER_SIZE 8192 + +enum { + MS_input_eof = 0x0001, + MS_input_error = 0x0001, + MS_decode_eof = 0x0002, + MS_decode_error = 0x0004, + MS_error_flags = 0x000f, + + MS_playing = 0x0100, + MS_cvt_decoded = 0x0200, +}; + +typedef struct { + SDL_RWops *rw; + int freerw; + struct mad_stream stream; + struct mad_frame frame; + struct mad_synth synth; + int frames_read; + mad_timer_t next_frame_start; + int volume; + int status; + int output_begin, output_end; + SDL_AudioSpec mixer; + SDL_AudioCVT cvt; + + unsigned char input_buffer[MAD_INPUT_BUFFER_SIZE + MAD_BUFFER_GUARD]; + unsigned char output_buffer[MAD_OUTPUT_BUFFER_SIZE]; +} mad_data; + +mad_data *mad_openFileRW(SDL_RWops *rw, SDL_AudioSpec *mixer, int freerw); +void mad_closeFile(mad_data *mp3_mad); + +void mad_start(mad_data *mp3_mad); +void mad_stop(mad_data *mp3_mad); +int mad_isPlaying(mad_data *mp3_mad); + +int mad_getSamples(mad_data *mp3_mad, Uint8 *stream, int len); +void mad_seek(mad_data *mp3_mad, double position); +void mad_setVolume(mad_data *mp3_mad, int volume); + +#endif diff --git a/apps/plugins/sdl/SDL_mixer/music_mod.c b/apps/plugins/sdl/SDL_mixer/music_mod.c new file mode 100644 index 0000000..be17902 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_mod.c @@ -0,0 +1,346 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id: music_mod.c 4211 2008-12-08 00:27:32Z slouken $ */ + +#ifdef MOD_MUSIC + +/* This file supports MOD tracker music streams */ + +#include "SDL_mixer.h" +#include "dynamic_mod.h" +#include "music_mod.h" + +#include "mikmod.h" + +#define SDL_SURROUND +#ifdef SDL_SURROUND +#define MAX_OUTPUT_CHANNELS 6 +#else +#define MAX_OUTPUT_CHANNELS 2 +#endif + +/* Reference for converting mikmod output to 4/6 channels */ +static int current_output_channels; +static Uint16 current_output_format; + +static int music_swap8; +static int music_swap16; + +/* Initialize the MOD player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +int MOD_init(SDL_AudioSpec *mixerfmt) +{ + CHAR *list; + + if ( !Mix_Init(MIX_INIT_MOD) ) { + return -1; + } + + /* Set the MikMod music format */ + music_swap8 = 0; + music_swap16 = 0; + switch (mixerfmt->format) { + + case AUDIO_U8: + case AUDIO_S8: { + if ( mixerfmt->format == AUDIO_S8 ) { + music_swap8 = 1; + } + *mikmod.md_mode = 0; + } + break; + + case AUDIO_S16LSB: + case AUDIO_S16MSB: { + /* See if we need to correct MikMod mixing */ +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + if ( mixerfmt->format == AUDIO_S16MSB ) { +#else + if ( mixerfmt->format == AUDIO_S16LSB ) { +#endif + music_swap16 = 1; + } + *mikmod.md_mode = DMODE_16BITS; + } + break; + + default: { + Mix_SetError("Unknown hardware audio format"); + return -1; + } + } + current_output_channels = mixerfmt->channels; + current_output_format = mixerfmt->format; + if ( mixerfmt->channels > 1 ) { + if ( mixerfmt->channels > MAX_OUTPUT_CHANNELS ) { + Mix_SetError("Hardware uses more channels than mixerfmt"); + return -1; + } + *mikmod.md_mode |= DMODE_STEREO; + } + *mikmod.md_mixfreq = mixerfmt->freq; + *mikmod.md_device = 0; + *mikmod.md_volume = 96; + *mikmod.md_musicvolume = 128; + *mikmod.md_sndfxvolume = 128; + *mikmod.md_pansep = 128; + *mikmod.md_reverb = 0; + *mikmod.md_mode |= DMODE_HQMIXER|DMODE_SOFT_MUSIC|DMODE_SURROUND; + + list = mikmod.MikMod_InfoDriver(); + if ( list ) + free(list); + else + mikmod.MikMod_RegisterDriver(mikmod.drv_nos); + + list = mikmod.MikMod_InfoLoader(); + if ( list ) + free(list); + else + mikmod.MikMod_RegisterAllLoaders(); + + if ( mikmod.MikMod_Init(NULL) ) { + Mix_SetError("%s", mikmod.MikMod_strerror(*mikmod.MikMod_errno)); + return -1; + } + + return 0; +} + +/* Uninitialize the music players */ +void MOD_exit(void) +{ + if (mikmod.MikMod_Exit) { + mikmod.MikMod_Exit(); + } +} + +/* Set the volume for a MOD stream */ +void MOD_setvolume(MODULE *music, int volume) +{ + mikmod.Player_SetVolume((SWORD)volume); +} + +typedef struct +{ + MREADER mr; + long offset; + long eof; + SDL_RWops *rw; +} LMM_MREADER; + +BOOL LMM_Seek(struct MREADER *mr,long to,int dir) +{ + LMM_MREADER* lmmmr = (LMM_MREADER*)mr; + if ( dir == SEEK_SET ) { + to += lmmmr->offset; + } + return (SDL_RWseek(lmmmr->rw, to, dir) < lmmmr->offset); +} +long LMM_Tell(struct MREADER *mr) +{ + LMM_MREADER* lmmmr = (LMM_MREADER*)mr; + return SDL_RWtell(lmmmr->rw) - lmmmr->offset; +} +BOOL LMM_Read(struct MREADER *mr,void *buf,size_t sz) +{ + LMM_MREADER* lmmmr = (LMM_MREADER*)mr; + return SDL_RWread(lmmmr->rw, buf, sz, 1); +} +int LMM_Get(struct MREADER *mr) +{ + unsigned char c; + LMM_MREADER* lmmmr = (LMM_MREADER*)mr; + if ( SDL_RWread(lmmmr->rw, &c, 1, 1) ) { + return c; + } + return EOF; +} +BOOL LMM_Eof(struct MREADER *mr) +{ + long offset; + LMM_MREADER* lmmmr = (LMM_MREADER*)mr; + offset = LMM_Tell(mr); + return offset >= lmmmr->eof; +} +MODULE *MikMod_LoadSongRW(SDL_RWops *rw, int maxchan) +{ + LMM_MREADER lmmmr = { + { LMM_Seek, LMM_Tell, LMM_Read, LMM_Get, LMM_Eof }, + 0, + 0, + 0 + }; + lmmmr.offset = SDL_RWtell(rw); + SDL_RWseek(rw, 0, RW_SEEK_END); + lmmmr.eof = SDL_RWtell(rw); + SDL_RWseek(rw, lmmmr.offset, RW_SEEK_SET); + lmmmr.rw = rw; + return mikmod.Player_LoadGeneric((MREADER*)&lmmmr, maxchan, 0); +} + +/* Load a MOD stream from an SDL_RWops object */ +MODULE *MOD_new_RW(SDL_RWops *rw, int freerw) +{ + MODULE *module; + + /* Make sure the mikmod library is loaded */ + if ( !Mix_Init(MIX_INIT_MOD) ) { + if ( freerw ) { + SDL_RWclose(rw); + } + return NULL; + } + + module = MikMod_LoadSongRW(rw,64); + if (!module) { + Mix_SetError("%s", mikmod.MikMod_strerror(*mikmod.MikMod_errno)); + if ( freerw ) { + SDL_RWclose(rw); + } + return NULL; + } + + /* Stop implicit looping, fade out and other flags. */ + module->extspd = 1; + module->panflag = 1; + module->wrap = 0; + module->loop = 0; +#if 0 /* Don't set fade out by default - unfortunately there's no real way +to query the status of the song or set trigger actions. Hum. */ + module->fadeout = 1; +#endif + + if ( freerw ) { + SDL_RWclose(rw); + } + return module; +} + +/* Start playback of a given MOD stream */ +void MOD_play(MODULE *music) +{ + mikmod.Player_Start(music); +} + +/* Return non-zero if a stream is currently playing */ +int MOD_playing(MODULE *music) +{ + return mikmod.Player_Active(); +} + +/* Play some of a stream previously started with MOD_play() */ +int MOD_playAudio(MODULE *music, Uint8 *stream, int len) +{ + if (current_output_channels > 2) { + int small_len = 2 * len / current_output_channels; + int i; + Uint8 *src, *dst; + + mikmod.VC_WriteBytes((SBYTE *)stream, small_len); + /* and extend to len by copying channels */ + src = stream + small_len; + dst = stream + len; + + switch (current_output_format & 0xFF) { + case 8: + for ( i=small_len/2; i; --i ) { + src -= 2; + dst -= current_output_channels; + dst[0] = src[0]; + dst[1] = src[1]; + dst[2] = src[0]; + dst[3] = src[1]; + if (current_output_channels == 6) { + dst[4] = src[0]; + dst[5] = src[1]; + } + } + break; + case 16: + for ( i=small_len/4; i; --i ) { + src -= 4; + dst -= 2 * current_output_channels; + dst[0] = src[0]; + dst[1] = src[1]; + dst[2] = src[2]; + dst[3] = src[3]; + dst[4] = src[0]; + dst[5] = src[1]; + dst[6] = src[2]; + dst[7] = src[3]; + if (current_output_channels == 6) { + dst[8] = src[0]; + dst[9] = src[1]; + dst[10] = src[2]; + dst[11] = src[3]; + } + } + break; + } + } else { + mikmod.VC_WriteBytes((SBYTE *)stream, len); + } + if ( music_swap8 ) { + Uint8 *dst; + int i; + + dst = stream; + for ( i=len; i; --i ) { + *dst++ ^= 0x80; + } + } else + if ( music_swap16 ) { + Uint8 *dst, tmp; + int i; + + dst = stream; + for ( i=(len/2); i; --i ) { + tmp = dst[0]; + dst[0] = dst[1]; + dst[1] = tmp; + dst += 2; + } + } + return 0; +} + +/* Stop playback of a stream previously started with MOD_play() */ +void MOD_stop(MODULE *music) +{ + mikmod.Player_Stop(); +} + +/* Close the given MOD stream */ +void MOD_delete(MODULE *music) +{ + mikmod.Player_Free(music); +} + +/* Jump (seek) to a given position (time is in seconds) */ +void MOD_jump_to_time(MODULE *music, double time) +{ + mikmod.Player_SetPosition((UWORD)time); +} + +#endif /* MOD_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_mod.h b/apps/plugins/sdl/SDL_mixer/music_mod.h new file mode 100644 index 0000000..4328e2b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_mod.h @@ -0,0 +1,62 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id: music_mod.h 4211 2008-12-08 00:27:32Z slouken $ */ + +#ifdef MOD_MUSIC + +/* This file supports MOD tracker music streams */ + +struct MODULE; + +/* Initialize the Ogg Vorbis player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +extern int MOD_init(SDL_AudioSpec *mixer); + +/* Uninitialize the music players */ +extern void MOD_exit(void); + +/* Set the volume for a MOD stream */ +extern void MOD_setvolume(struct MODULE *music, int volume); + +/* Load a MOD stream from an SDL_RWops object */ +extern struct MODULE *MOD_new_RW(SDL_RWops *rw, int freerw); + +/* Start playback of a given MOD stream */ +extern void MOD_play(struct MODULE *music); + +/* Return non-zero if a stream is currently playing */ +extern int MOD_playing(struct MODULE *music); + +/* Play some of a stream previously started with MOD_play() */ +extern int MOD_playAudio(struct MODULE *music, Uint8 *stream, int len); + +/* Stop playback of a stream previously started with MOD_play() */ +extern void MOD_stop(struct MODULE *music); + +/* Close the given MOD stream */ +extern void MOD_delete(struct MODULE *music); + +/* Jump (seek) to a given position (time is in seconds) */ +extern void MOD_jump_to_time(struct MODULE *music, double time); + +#endif /* MOD_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_modplug.c b/apps/plugins/sdl/SDL_mixer/music_modplug.c new file mode 100644 index 0000000..31a7ba2 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_modplug.c @@ -0,0 +1,239 @@ +#ifdef MODPLUG_MUSIC + +#include "music_modplug.h" + +static int current_output_channels=0; +static int music_swap8=0; +static int music_swap16=0; +static ModPlug_Settings settings; + +int modplug_init(SDL_AudioSpec *spec) +{ + ModPlug_GetSettings(&settings); + settings.mFlags=MODPLUG_ENABLE_OVERSAMPLING; + current_output_channels=spec->channels; + settings.mChannels=spec->channels>1?2:1; + settings.mBits=spec->format&0xFF; + + music_swap8 = 0; + music_swap16 = 0; + + switch(spec->format) + { + case AUDIO_U8: + case AUDIO_S8: { + if ( spec->format == AUDIO_S8 ) { + music_swap8 = 1; + } + settings.mBits=8; + } + break; + + case AUDIO_S16LSB: + case AUDIO_S16MSB: { + /* See if we need to correct MikMod mixing */ +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + if ( spec->format == AUDIO_S16MSB ) { +#else + if ( spec->format == AUDIO_S16LSB ) { +#endif + music_swap16 = 1; + } + settings.mBits=16; + } + break; + + default: { + Mix_SetError("Unknown hardware audio format"); + return -1; + } + + } + + settings.mFrequency=spec->freq; /*TODO: limit to 11025, 22050, or 44100 ? */ + settings.mResamplingMode=MODPLUG_RESAMPLE_FIR; + settings.mReverbDepth=0; + settings.mReverbDelay=100; + settings.mBassAmount=0; + settings.mBassRange=50; + settings.mSurroundDepth=0; + settings.mSurroundDelay=10; + settings.mLoopCount=0; + ModPlug_SetSettings(&settings); + return 0; +} + +/* Uninitialize the music players */ +void modplug_exit() +{ +} + +/* Set the volume for a modplug stream */ +void modplug_setvolume(modplug_data *music, int volume) +{ + ModPlug_SetMasterVolume(music->file, volume*4); +} + +/* Load a modplug stream from an SDL_RWops object */ +modplug_data *modplug_new_RW(SDL_RWops *rw, int freerw) +{ + modplug_data *music=NULL; + long offset,sz; + char *buf=NULL; + + offset = SDL_RWtell(rw); + SDL_RWseek(rw, 0, RW_SEEK_END); + sz = SDL_RWtell(rw)-offset; + SDL_RWseek(rw, offset, RW_SEEK_SET); + buf=(char*)SDL_malloc(sz); + if(buf) + { + if(SDL_RWread(rw, buf, sz, 1)==1) + { + music=(modplug_data*)SDL_malloc(sizeof(modplug_data)); + if (music) + { + music->playing=0; + music->file=ModPlug_Load(buf,sz); + if(!music->file) + { + SDL_free(music); + music=NULL; + } + } + else + { + SDL_OutOfMemory(); + } + } + SDL_free(buf); + } + else + { + SDL_OutOfMemory(); + } + if (freerw) { + SDL_RWclose(rw); + } + return music; +} + +/* Start playback of a given modplug stream */ +void modplug_play(modplug_data *music) +{ + ModPlug_Seek(music->file,0); + music->playing=1; +} + +/* Return non-zero if a stream is currently playing */ +int modplug_playing(modplug_data *music) +{ + return music && music->playing; +} + +/* Play some of a stream previously started with modplug_play() */ +int modplug_playAudio(modplug_data *music, Uint8 *stream, int len) +{ + if (current_output_channels > 2) { + int small_len = 2 * len / current_output_channels; + int i; + Uint8 *src, *dst; + + i=ModPlug_Read(music->file, stream, small_len); + if(iplaying=0; + } + /* and extend to len by copying channels */ + src = stream + small_len; + dst = stream + len; + + switch (settings.mBits) { + case 8: + for ( i=small_len/2; i; --i ) { + src -= 2; + dst -= current_output_channels; + dst[0] = src[0]; + dst[1] = src[1]; + dst[2] = src[0]; + dst[3] = src[1]; + if (current_output_channels == 6) { + dst[4] = src[0]; + dst[5] = src[1]; + } + } + break; + case 16: + for ( i=small_len/4; i; --i ) { + src -= 4; + dst -= 2 * current_output_channels; + dst[0] = src[0]; + dst[1] = src[1]; + dst[2] = src[2]; + dst[3] = src[3]; + dst[4] = src[0]; + dst[5] = src[1]; + dst[6] = src[2]; + dst[7] = src[3]; + if (current_output_channels == 6) { + dst[8] = src[0]; + dst[9] = src[1]; + dst[10] = src[2]; + dst[11] = src[3]; + } + } + break; + } + } else { + int i=ModPlug_Read(music->file, stream, len); + if(iplaying=0; + } + } + if ( music_swap8 ) { + Uint8 *dst; + int i; + + dst = stream; + for ( i=len; i; --i ) { + *dst++ ^= 0x80; + } + } else + if ( music_swap16 ) { + Uint8 *dst, tmp; + int i; + + dst = stream; + for ( i=(len/2); i; --i ) { + tmp = dst[0]; + dst[0] = dst[1]; + dst[1] = tmp; + dst += 2; + } + } + return 0; +} + +/* Stop playback of a stream previously started with modplug_play() */ +void modplug_stop(modplug_data *music) +{ + music->playing=0; +} + +/* Close the given modplug stream */ +void modplug_delete(modplug_data *music) +{ + ModPlug_Unload(music->file); + SDL_free(music); +} + +/* Jump (seek) to a given position (time is in seconds) */ +void modplug_jump_to_time(modplug_data *music, double time) +{ + ModPlug_Seek(music->file,(int)(time*1000)); +} + +#endif diff --git a/apps/plugins/sdl/SDL_mixer/music_modplug.h b/apps/plugins/sdl/SDL_mixer/music_modplug.h new file mode 100644 index 0000000..92cbafd --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_modplug.h @@ -0,0 +1,42 @@ +#ifdef MODPLUG_MUSIC + +#include "modplug.h" +#include "SDL_rwops.h" +#include "SDL_audio.h" +#include "SDL_mixer.h" + +typedef struct { + ModPlugFile *file; + int playing; +} modplug_data; + +int modplug_init(SDL_AudioSpec *mixer); + +/* Uninitialize the music players */ +void modplug_exit(void); + +/* Set the volume for a modplug stream */ +void modplug_setvolume(modplug_data *music, int volume); + +/* Load a modplug stream from an SDL_RWops object */ +modplug_data *modplug_new_RW(SDL_RWops *rw, int freerw); + +/* Start playback of a given modplug stream */ +void modplug_play(modplug_data *music); + +/* Return non-zero if a stream is currently playing */ +int modplug_playing(modplug_data *music); + +/* Play some of a stream previously started with modplug_play() */ +int modplug_playAudio(modplug_data *music, Uint8 *stream, int len); + +/* Stop playback of a stream previously started with modplug_play() */ +void modplug_stop(modplug_data *music); + +/* Close the given modplug stream */ +void modplug_delete(modplug_data *music); + +/* Jump (seek) to a given position (time is in seconds) */ +void modplug_jump_to_time(modplug_data *music, double time); + +#endif diff --git a/apps/plugins/sdl/SDL_mixer/music_ogg.c b/apps/plugins/sdl/SDL_mixer/music_ogg.c new file mode 100644 index 0000000..de5f9c5 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_ogg.c @@ -0,0 +1,230 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#ifdef OGG_MUSIC + +/* This file supports Ogg Vorbis music streams */ + +#include "SDL_mixer.h" +#include "dynamic_ogg.h" +#include "music_ogg.h" + +/* This is the format of the audio mixer data */ +static SDL_AudioSpec mixer; + +/* Initialize the Ogg Vorbis player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +int OGG_init(SDL_AudioSpec *mixerfmt) +{ + mixer = *mixerfmt; + return(0); +} + +/* Set the volume for an OGG stream */ +void OGG_setvolume(OGG_music *music, int volume) +{ + music->volume = volume; +} + +static size_t sdl_read_func(void *ptr, size_t size, size_t nmemb, void *datasource) +{ + return SDL_RWread((SDL_RWops*)datasource, ptr, size, nmemb); +} + +static int sdl_seek_func(void *datasource, ogg_int64_t offset, int whence) +{ + return SDL_RWseek((SDL_RWops*)datasource, (int)offset, whence); +} + +static long sdl_tell_func(void *datasource) +{ + return SDL_RWtell((SDL_RWops*)datasource); +} + +/* Load an OGG stream from an SDL_RWops object */ +OGG_music *OGG_new_RW(SDL_RWops *rw, int freerw) +{ + OGG_music *music; + ov_callbacks callbacks; + + if ( !Mix_Init(MIX_INIT_OGG) ) { + if ( freerw ) { + SDL_RWclose(rw); + } + return(NULL); + } + + SDL_memset(&callbacks, 0, sizeof(callbacks)); + callbacks.read_func = sdl_read_func; + callbacks.seek_func = sdl_seek_func; + callbacks.tell_func = sdl_tell_func; + + music = (OGG_music *)SDL_malloc(sizeof *music); + if ( music ) { + /* Initialize the music structure */ + memset(music, 0, (sizeof *music)); + music->rw = rw; + music->freerw = freerw; + OGG_stop(music); + OGG_setvolume(music, MIX_MAX_VOLUME); + music->section = -1; + + if ( vorbis.ov_open_callbacks(rw, &music->vf, NULL, 0, callbacks) < 0 ) { + SDL_free(music); + if ( freerw ) { + SDL_RWclose(rw); + } + SDL_SetError("Not an Ogg Vorbis audio stream"); + return(NULL); + } + } else { + if ( freerw ) { + SDL_RWclose(rw); + } + SDL_OutOfMemory(); + return(NULL); + } + return(music); +} + +/* Start playback of a given OGG stream */ +void OGG_play(OGG_music *music) +{ + music->playing = 1; +} + +/* Return non-zero if a stream is currently playing */ +int OGG_playing(OGG_music *music) +{ + return(music->playing); +} + +/* Read some Ogg stream data and convert it for output */ +static void OGG_getsome(OGG_music *music) +{ + int section; + int len; + char data[4096]; + SDL_AudioCVT *cvt; + +#ifdef OGG_USE_TREMOR + len = vorbis.ov_read(&music->vf, data, sizeof(data), §ion); +#else + len = vorbis.ov_read(&music->vf, data, sizeof(data), 0, 2, 1, §ion); +#endif + if ( len <= 0 ) { + if ( len == 0 ) { + music->playing = 0; + } + return; + } + cvt = &music->cvt; + if ( section != music->section ) { + vorbis_info *vi; + + vi = vorbis.ov_info(&music->vf, -1); + SDL_BuildAudioCVT(cvt, AUDIO_S16, vi->channels, vi->rate, + mixer.format,mixer.channels,mixer.freq); + if ( cvt->buf ) { + SDL_free(cvt->buf); + } + cvt->buf = (Uint8 *)SDL_malloc(sizeof(data)*cvt->len_mult); + music->section = section; + } + if ( cvt->buf ) { + memcpy(cvt->buf, data, len); + if ( cvt->needed ) { + cvt->len = len; + SDL_ConvertAudio(cvt); + } else { + cvt->len_cvt = len; + } + music->len_available = music->cvt.len_cvt; + music->snd_available = music->cvt.buf; + } else { + SDL_SetError("Out of memory"); + music->playing = 0; + } +} + +/* Play some of a stream previously started with OGG_play() */ +int OGG_playAudio(OGG_music *music, Uint8 *snd, int len) +{ + int mixable; + + while ( (len > 0) && music->playing ) { + if ( ! music->len_available ) { + OGG_getsome(music); + } + mixable = len; + if ( mixable > music->len_available ) { + mixable = music->len_available; + } + if ( music->volume == MIX_MAX_VOLUME ) { + memcpy(snd, music->snd_available, mixable); + } else { + SDL_MixAudio(snd, music->snd_available, mixable, + music->volume); + } + music->len_available -= mixable; + music->snd_available += mixable; + len -= mixable; + snd += mixable; + } + + return len; +} + +/* Stop playback of a stream previously started with OGG_play() */ +void OGG_stop(OGG_music *music) +{ + music->playing = 0; +} + +/* Close the given OGG stream */ +void OGG_delete(OGG_music *music) +{ + if ( music ) { + if ( music->cvt.buf ) { + SDL_free(music->cvt.buf); + } + if ( music->freerw ) { + SDL_RWclose(music->rw); + } + vorbis.ov_clear(&music->vf); + SDL_free(music); + } +} + +/* Jump (seek) to a given position (time is in seconds) */ +void OGG_jump_to_time(OGG_music *music, double time) +{ +#ifdef OGG_USE_TREMOR + vorbis.ov_time_seek( &music->vf, (ogg_int64_t)time ); +#else + vorbis.ov_time_seek( &music->vf, time ); +#endif +} + +#endif /* OGG_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/music_ogg.h b/apps/plugins/sdl/SDL_mixer/music_ogg.h new file mode 100644 index 0000000..4d93a2b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/music_ogg.h @@ -0,0 +1,75 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#ifdef OGG_MUSIC + +/* This file supports Ogg Vorbis music streams */ + +#ifdef OGG_USE_TREMOR +#include +#else +#include +#endif + +typedef struct { + SDL_RWops *rw; + int freerw; + int playing; + int volume; + OggVorbis_File vf; + int section; + SDL_AudioCVT cvt; + int len_available; + Uint8 *snd_available; +} OGG_music; + +/* Initialize the Ogg Vorbis player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +extern int OGG_init(SDL_AudioSpec *mixer); + +/* Set the volume for an OGG stream */ +extern void OGG_setvolume(OGG_music *music, int volume); + +/* Load an OGG stream from an SDL_RWops object */ +extern OGG_music *OGG_new_RW(SDL_RWops *rw, int freerw); + +/* Start playback of a given OGG stream */ +extern void OGG_play(OGG_music *music); + +/* Return non-zero if a stream is currently playing */ +extern int OGG_playing(OGG_music *music); + +/* Play some of a stream previously started with OGG_play() */ +extern int OGG_playAudio(OGG_music *music, Uint8 *stream, int len); + +/* Stop playback of a stream previously started with OGG_play() */ +extern void OGG_stop(OGG_music *music); + +/* Close the given OGG stream */ +extern void OGG_delete(OGG_music *music); + +/* Jump (seek) to a given position (time is in seconds) */ +extern void OGG_jump_to_time(OGG_music *music, double time); + +#endif /* OGG_MUSIC */ diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi.h b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi.h new file mode 100644 index 0000000..17e4769 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi.h @@ -0,0 +1,38 @@ +/* + native_midi: Hardware Midi support for the SDL_mixer library + Copyright (C) 2000 Florian 'Proff' Schulze + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifndef _NATIVE_MIDI_H_ +#define _NATIVE_MIDI_H_ + +#include + +typedef struct _NativeMidiSong NativeMidiSong; + +int native_midi_detect(); +NativeMidiSong *native_midi_loadsong_RW(SDL_RWops *rw, int freerw); +void native_midi_freesong(NativeMidiSong *song); +void native_midi_start(NativeMidiSong *song, int loops); +void native_midi_stop(); +int native_midi_active(); +void native_midi_setvolume(int volume); +const char *native_midi_error(void); + +#endif /* _NATIVE_MIDI_H_ */ diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.c b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.c new file mode 100644 index 0000000..1229475 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.c @@ -0,0 +1,409 @@ +/* + native_midi: Hardware Midi support for the SDL_mixer library + Copyright (C) 2000,2001 Florian 'Proff' Schulze + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + + +#include "native_midi_common.h" + +#include "../SDL_mixer.h" + +#include +#include +#include + + +/* The maximum number of midi tracks that we can handle +#define MIDI_TRACKS 32 */ + + +/* A single midi track as read from the midi file */ +typedef struct +{ + Uint8 *data; /* MIDI message stream */ + int len; /* length of the track data */ +} MIDITrack; + +/* A midi file, stripped down to the absolute minimum - divison & track data */ +typedef struct +{ + int division; /* number of pulses per quarter note (ppqn) */ + int nTracks; /* number of tracks */ + MIDITrack *track; /* tracks */ +} MIDIFile; + + +/* Some macros that help us stay endianess-independant */ +#if SDL_BYTEORDER == SDL_BIG_ENDIAN +#define BE_SHORT(x) (x) +#define BE_LONG(x) (x) +#else +#define BE_SHORT(x) ((((x)&0xFF)<<8) | (((x)>>8)&0xFF)) +#define BE_LONG(x) ((((x)&0x0000FF)<<24) | \ + (((x)&0x00FF00)<<8) | \ + (((x)&0xFF0000)>>8) | \ + (((x)>>24)&0xFF)) +#endif + + + +/* Get Variable Length Quantity */ +static int GetVLQ(MIDITrack *track, int *currentPos) +{ + int l = 0; + Uint8 c; + while(1) + { + c = track->data[*currentPos]; + (*currentPos)++; + l += (c & 0x7f); + if (!(c & 0x80)) + return l; + l <<= 7; + } +} + +/* Create a single MIDIEvent */ +static MIDIEvent *CreateEvent(Uint32 time, Uint8 event, Uint8 a, Uint8 b) +{ + MIDIEvent *newEvent; + + newEvent = calloc(1, sizeof(MIDIEvent)); + + if (newEvent) + { + newEvent->time = time; + newEvent->status = event; + newEvent->data[0] = a; + newEvent->data[1] = b; + } + else + Mix_SetError("Out of memory"); + + return newEvent; +} + +/* Convert a single midi track to a list of MIDIEvents */ +static MIDIEvent *MIDITracktoStream(MIDITrack *track) +{ + Uint32 atime = 0; + Uint32 len = 0; + Uint8 event,type,a,b; + Uint8 laststatus = 0; + Uint8 lastchan = 0; + int currentPos = 0; + int end = 0; + MIDIEvent *head = CreateEvent(0,0,0,0); /* dummy event to make handling the list easier */ + MIDIEvent *currentEvent = head; + + while (!end) + { + if (currentPos >= track->len) + break; /* End of data stream reached */ + + atime += GetVLQ(track, ¤tPos); + event = track->data[currentPos++]; + + /* Handle SysEx seperatly */ + if (((event>>4) & 0x0F) == MIDI_STATUS_SYSEX) + { + if (event == 0xFF) + { + type = track->data[currentPos]; + currentPos++; + switch(type) + { + case 0x2f: /* End of data marker */ + end = 1; + case 0x51: /* Tempo change */ + /* + a=track->data[currentPos]; + b=track->data[currentPos+1]; + c=track->data[currentPos+2]; + AddEvent(song, atime, MEVT_TEMPO, c, b, a); + */ + break; + } + } + else + type = 0; + + len = GetVLQ(track, ¤tPos); + + /* Create an event and attach the extra data, if any */ + currentEvent->next = CreateEvent(atime, event, type, 0); + currentEvent = currentEvent->next; + if (NULL == currentEvent) + { + FreeMIDIEventList(head); + return NULL; + } + if (len) + { + currentEvent->extraLen = len; + currentEvent->extraData = malloc(len); + memcpy(currentEvent->extraData, &(track->data[currentPos]), len); + currentPos += len; + } + } + else + { + a = event; + if (a & 0x80) /* It's a status byte */ + { + /* Extract channel and status information */ + lastchan = a & 0x0F; + laststatus = (a>>4) & 0x0F; + + /* Read the next byte which should always be a data byte */ + a = track->data[currentPos++] & 0x7F; + } + switch(laststatus) + { + case MIDI_STATUS_NOTE_OFF: + case MIDI_STATUS_NOTE_ON: /* Note on */ + case MIDI_STATUS_AFTERTOUCH: /* Key Pressure */ + case MIDI_STATUS_CONTROLLER: /* Control change */ + case MIDI_STATUS_PITCH_WHEEL: /* Pitch wheel */ + b = track->data[currentPos++] & 0x7F; + currentEvent->next = CreateEvent(atime, (Uint8)((laststatus<<4)+lastchan), a, b); + currentEvent = currentEvent->next; + if (NULL == currentEvent) + { + FreeMIDIEventList(head); + return NULL; + } + break; + + case MIDI_STATUS_PROG_CHANGE: /* Program change */ + case MIDI_STATUS_PRESSURE: /* Channel pressure */ + a &= 0x7f; + currentEvent->next = CreateEvent(atime, (Uint8)((laststatus<<4)+lastchan), a, 0); + currentEvent = currentEvent->next; + if (NULL == currentEvent) + { + FreeMIDIEventList(head); + return NULL; + } + break; + + default: /* Sysex already handled above */ + break; + } + } + } + + currentEvent = head->next; + free(head); /* release the dummy head event */ + return currentEvent; +} + +/* + * Convert a midi song, consisting of up to 32 tracks, to a list of MIDIEvents. + * To do so, first convert the tracks seperatly, then interweave the resulting + * MIDIEvent-Lists to one big list. + */ +static MIDIEvent *MIDItoStream(MIDIFile *mididata) +{ + MIDIEvent **track; + MIDIEvent *head = CreateEvent(0,0,0,0); /* dummy event to make handling the list easier */ + MIDIEvent *currentEvent = head; + int trackID; + + if (NULL == head) + return NULL; + + track = (MIDIEvent**) calloc(1, sizeof(MIDIEvent*) * mididata->nTracks); + if (NULL == head) + return NULL; + + /* First, convert all tracks to MIDIEvent lists */ + for (trackID = 0; trackID < mididata->nTracks; trackID++) + track[trackID] = MIDITracktoStream(&mididata->track[trackID]); + + /* Now, merge the lists. */ + /* TODO */ + while(1) + { + Uint32 lowestTime = INT_MAX; + int currentTrackID = -1; + + /* Find the next event */ + for (trackID = 0; trackID < mididata->nTracks; trackID++) + { + if (track[trackID] && (track[trackID]->time < lowestTime)) + { + currentTrackID = trackID; + lowestTime = track[currentTrackID]->time; + } + } + + /* Check if we processes all events */ + if (currentTrackID == -1) + break; + + currentEvent->next = track[currentTrackID]; + track[currentTrackID] = track[currentTrackID]->next; + + currentEvent = currentEvent->next; + + + lowestTime = 0; + } + + /* Make sure the list is properly terminated */ + currentEvent->next = 0; + + currentEvent = head->next; + free(track); + free(head); /* release the dummy head event */ + return currentEvent; +} + +static int ReadMIDIFile(MIDIFile *mididata, SDL_RWops *rw) +{ + int i = 0; + Uint32 ID; + Uint32 size; + Uint16 format; + Uint16 tracks; + Uint16 division; + + if (!mididata) + return 0; + if (!rw) + return 0; + + /* Make sure this is really a MIDI file */ + SDL_RWread(rw, &ID, 1, 4); + if (BE_LONG(ID) != 'MThd') + return 0; + + /* Header size must be 6 */ + SDL_RWread(rw, &size, 1, 4); + size = BE_LONG(size); + if (size != 6) + return 0; + + /* We only support format 0 and 1, but not 2 */ + SDL_RWread(rw, &format, 1, 2); + format = BE_SHORT(format); + if (format != 0 && format != 1) + return 0; + + SDL_RWread(rw, &tracks, 1, 2); + tracks = BE_SHORT(tracks); + mididata->nTracks = tracks; + + /* Allocate tracks */ + mididata->track = (MIDITrack*) calloc(1, sizeof(MIDITrack) * mididata->nTracks); + if (NULL == mididata->track) + { + Mix_SetError("Out of memory"); + goto bail; + } + + /* Retrieve the PPQN value, needed for playback */ + SDL_RWread(rw, &division, 1, 2); + mididata->division = BE_SHORT(division); + + + for (i=0; itrack[i].len = size; + mididata->track[i].data = malloc(size); + if (NULL == mididata->track[i].data) + { + Mix_SetError("Out of memory"); + goto bail; + } + SDL_RWread(rw, mididata->track[i].data, 1, size); + } + return 1; + +bail: + for(;i >= 0; i--) + { + if (mididata->track[i].data) + free(mididata->track[i].data); + } + + return 0; +} + +MIDIEvent *CreateMIDIEventList(SDL_RWops *rw, Uint16 *division) +{ + MIDIFile *mididata = NULL; + MIDIEvent *eventList; + int trackID; + + mididata = calloc(1, sizeof(MIDIFile)); + if (!mididata) + return NULL; + + /* Open the file */ + if ( rw != NULL ) + { + /* Read in the data */ + if ( ! ReadMIDIFile(mididata, rw)) + { + free(mididata); + return NULL; + } + } + else + { + free(mididata); + return NULL; + } + + if (division) + *division = mididata->division; + + eventList = MIDItoStream(mididata); + + for(trackID = 0; trackID < mididata->nTracks; trackID++) + { + if (mididata->track[trackID].data) + free(mididata->track[trackID].data); + } + free(mididata->track); + free(mididata); + + return eventList; +} + +void FreeMIDIEventList(MIDIEvent *head) +{ + MIDIEvent *cur, *next; + + cur = head; + + while (cur) + { + next = cur->next; + if (cur->extraData) + free (cur->extraData); + free (cur); + cur = next; + } +} diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.h b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.h new file mode 100644 index 0000000..e040027 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_common.h @@ -0,0 +1,63 @@ +/* + native_midi: Hardware Midi support for the SDL_mixer library + Copyright (C) 2000,2001 Florian 'Proff' Schulze + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +#ifndef _NATIVE_MIDI_COMMON_H_ +#define _NATIVE_MIDI_COMMON_H_ + +#include "SDL.h" + +/* Midi Status Bytes */ +#define MIDI_STATUS_NOTE_OFF 0x8 +#define MIDI_STATUS_NOTE_ON 0x9 +#define MIDI_STATUS_AFTERTOUCH 0xA +#define MIDI_STATUS_CONTROLLER 0xB +#define MIDI_STATUS_PROG_CHANGE 0xC +#define MIDI_STATUS_PRESSURE 0xD +#define MIDI_STATUS_PITCH_WHEEL 0xE +#define MIDI_STATUS_SYSEX 0xF + +/* We store the midi events in a linked list; this way it is + easy to shuffle the tracks together later on; and we are + flexible in the size of each elemnt. + */ +typedef struct MIDIEvent +{ + Uint32 time; /* Time at which this midi events occurs */ + Uint8 status; /* Status byte */ + Uint8 data[2]; /* 1 or 2 bytes additional data for most events */ + + Uint32 extraLen; /* For some SysEx events, we need additional storage */ + Uint8 *extraData; + + struct MIDIEvent *next; +} MIDIEvent; + + +/* Load a midifile to memory, converting it to a list of MIDIEvents. + This function returns a linked lists of MIDIEvents, 0 if an error occured. + */ +MIDIEvent *CreateMIDIEventList(SDL_RWops *rw, Uint16 *division); + +/* Release a MIDIEvent list after usage. */ +void FreeMIDIEventList(MIDIEvent *head); + + +#endif /* _NATIVE_MIDI_COMMON_H_ */ diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_haiku.cpp b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_haiku.cpp new file mode 100644 index 0000000..8de350e --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_haiku.cpp @@ -0,0 +1,281 @@ +/* + native_midi_haiku: Native Midi support on Haiku for the SDL_mixer library + Copyright (C) 2010 Egor Suvorov + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ +#include "SDL_config.h" + +#ifdef __HAIKU__ +#include +#include +#include +#include +#include +#include +#include +#include +extern "C" { +#include "native_midi.h" +#include "native_midi_common.h" +} + +bool compareMIDIEvent(const MIDIEvent &a, const MIDIEvent &b) +{ + return a.time < b.time; +} + +class MidiEventsStore : public BMidi +{ + public: + MidiEventsStore() + { + fPlaying = false; + fLoops = 0; + } + virtual status_t Import(SDL_RWops *rw) + { + fEvs = CreateMIDIEventList(rw, &fDivision); + if (!fEvs) { + return B_BAD_MIDI_DATA; + } + fTotal = 0; + for (MIDIEvent *x = fEvs; x; x = x->next) fTotal++; + fPos = fTotal; + + sort_events(); + return B_OK; + } + virtual void Run() + { + fPlaying = true; + fPos = 0; + MIDIEvent *ev = fEvs; + + uint32 startTime = B_NOW; + while (KeepRunning()) + { + if (!ev) { + if (fLoops && fEvs) { + --fLoops; + fPos = 0; + ev = fEvs; + } else + break; + } + SprayEvent(ev, ev->time + startTime); + ev = ev->next; + fPos++; + } + fPos = fTotal; + fPlaying = false; + } + virtual ~MidiEventsStore() + { + if (!fEvs) return; + FreeMIDIEventList(fEvs); + fEvs = 0; + } + + bool IsPlaying() + { + return fPlaying; + } + + void SetLoops(int loops) + { + fLoops = loops; + } + + protected: + MIDIEvent *fEvs; + Uint16 fDivision; + + int fPos, fTotal; + int fLoops; + bool fPlaying; + + void SprayEvent(MIDIEvent *ev, uint32 time) + { + switch (ev->status & 0xF0) + { + case B_NOTE_OFF: + SprayNoteOff((ev->status & 0x0F) + 1, ev->data[0], ev->data[1], time); + break; + case B_NOTE_ON: + SprayNoteOn((ev->status & 0x0F) + 1, ev->data[0], ev->data[1], time); + break; + case B_KEY_PRESSURE: + SprayKeyPressure((ev->status & 0x0F) + 1, ev->data[0], ev->data[1], time); + break; + case B_CONTROL_CHANGE: + SprayControlChange((ev->status & 0x0F) + 1, ev->data[0], ev->data[1], time); + break; + case B_PROGRAM_CHANGE: + SprayProgramChange((ev->status & 0x0F) + 1, ev->data[0], time); + break; + case B_CHANNEL_PRESSURE: + SprayChannelPressure((ev->status & 0x0F) + 1, ev->data[0], time); + break; + case B_PITCH_BEND: + SprayPitchBend((ev->status & 0x0F) + 1, ev->data[0], ev->data[1], time); + break; + case 0xF: + switch (ev->status) + { + case B_SYS_EX_START: + SpraySystemExclusive(ev->extraData, ev->extraLen, time); + break; + case B_MIDI_TIME_CODE: + case B_SONG_POSITION: + case B_SONG_SELECT: + case B_CABLE_MESSAGE: + case B_TUNE_REQUEST: + case B_SYS_EX_END: + SpraySystemCommon(ev->status, ev->data[0], ev->data[1], time); + break; + case B_TIMING_CLOCK: + case B_START: + case B_STOP: + case B_CONTINUE: + case B_ACTIVE_SENSING: + SpraySystemRealTime(ev->status, time); + break; + case B_SYSTEM_RESET: + if (ev->data[0] == 0x51 && ev->data[1] == 0x03) + { + assert(ev->extraLen == 3); + int val = (ev->extraData[0] << 16) | (ev->extraData[1] << 8) | ev->extraData[2]; + int tempo = 60000000 / val; + SprayTempoChange(tempo, time); + } + else + { + SpraySystemRealTime(ev->status, time); + } + } + break; + } + } + + void sort_events() + { + MIDIEvent *items = new MIDIEvent[fTotal]; + MIDIEvent *x = fEvs; + for (int i = 0; i < fTotal; i++) + { + memcpy(items + i, x, sizeof(MIDIEvent)); + x = x->next; + } + std::sort(items, items + fTotal, compareMIDIEvent); + + x = fEvs; + for (int i = 0; i < fTotal; i++) + { + MIDIEvent *ne = x->next; + memcpy(x, items + i, sizeof(MIDIEvent)); + x->next = ne; + x = ne; + } + + for (x = fEvs; x && x->next; x = x->next) + assert(x->time <= x->next->time); + + delete[] items; + } +}; + +BMidiSynth synth; +struct _NativeMidiSong { + MidiEventsStore *store; +} *currentSong = NULL; + +char lasterr[1024]; + +int native_midi_detect() +{ + status_t res = synth.EnableInput(true, false); + return res == B_OK; +} + +void native_midi_setvolume(int volume) +{ + if (volume < 0) volume = 0; + if (volume > 128) volume = 128; + synth.SetVolume(volume / 128.0); +} + +NativeMidiSong *native_midi_loadsong_RW(SDL_RWops *rw, int freerw) +{ + NativeMidiSong *song = new NativeMidiSong; + song->store = new MidiEventsStore; + status_t res = song->store->Import(rw); + + if (freerw) { + SDL_RWclose(rw); + } + if (res != B_OK) + { + snprintf(lasterr, sizeof lasterr, "Cannot Import() midi file: status_t=%d", res); + delete song->store; + delete song; + return NULL; + } + return song; +} + +void native_midi_freesong(NativeMidiSong *song) +{ + if (song == NULL) return; + song->store->Stop(); + song->store->Disconnect(&synth); + if (currentSong == song) + { + currentSong = NULL; + } + delete song->store; + delete song; song = 0; +} +void native_midi_start(NativeMidiSong *song, int loops) +{ + native_midi_stop(); + song->store->Connect(&synth); + song->store->SetLoops(loops); + song->store->Start(); + currentSong = song; +} +void native_midi_stop() +{ + if (currentSong == NULL) return; + currentSong->store->Stop(); + currentSong->store->Disconnect(&synth); + while (currentSong->store->IsPlaying()) + usleep(1000); + currentSong = NULL; +} +int native_midi_active() +{ + if (currentSong == NULL) return 0; + return currentSong->store->IsPlaying(); +} + +const char* native_midi_error(void) +{ + return lasterr; +} + +#endif /* __HAIKU__ */ diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_mac.c b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_mac.c new file mode 100644 index 0000000..01e7877 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_mac.c @@ -0,0 +1,644 @@ +/* + native_midi_mac: Native Midi support on MacOS for the SDL_mixer library + Copyright (C) 2001 Max Horn + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ +#include "SDL_config.h" +#include "SDL_endian.h" + +#if __MACOS__ /*|| __MACOSX__ */ + +#include "native_midi.h" +#include "native_midi_common.h" + +#if __MACOSX__ +#include +#else +#include +#endif + +#include +#include +#include + + +/* Native Midi song */ +struct _NativeMidiSong +{ + Uint32 *tuneSequence; + Uint32 *tuneHeader; +}; + +enum +{ + /* number of (32-bit) long words in a note request event */ + kNoteRequestEventLength = ((sizeof(NoteRequest)/sizeof(long)) + 2), + + /* number of (32-bit) long words in a marker event */ + kMarkerEventLength = 1, + + /* number of (32-bit) long words in a general event, minus its data */ + kGeneralEventLength = 2 +}; + +#define ERROR_BUF_SIZE 256 +#define BUFFER_INCREMENT 5000 + +#define REST_IF_NECESSARY() do {\ + int timeDiff = eventPos->time - lastEventTime; \ + if(timeDiff) \ + { \ + timeDiff = (int)(timeDiff*tick); \ + qtma_StuffRestEvent(*tunePos, timeDiff); \ + tunePos++; \ + lastEventTime = eventPos->time; \ + } \ + } while(0) + + +static Uint32 *BuildTuneSequence(MIDIEvent *evntlist, int ppqn, int part_poly_max[32], int part_to_inst[32], int *numParts); +static Uint32 *BuildTuneHeader(int part_poly_max[32], int part_to_inst[32], int numParts); + +/* The global TunePlayer instance */ +static TunePlayer gTunePlayer = NULL; +static int gInstaceCount = 0; +static Uint32 *gCurrentTuneSequence = NULL; +static char gErrorBuffer[ERROR_BUF_SIZE] = ""; + + +/* Check whether QuickTime is available */ +int native_midi_detect() +{ + /* TODO */ + return 1; +} + +NativeMidiSong *native_midi_loadsong_RW(SDL_RWops *rw, int freerw) +{ + NativeMidiSong *song = NULL; + MIDIEvent *evntlist = NULL; + int part_to_inst[32]; + int part_poly_max[32]; + int numParts = 0; + Uint16 ppqn; + + /* Init the arrays */ + memset(part_poly_max,0,sizeof(part_poly_max)); + memset(part_to_inst,-1,sizeof(part_to_inst)); + + /* Attempt to load the midi file */ + evntlist = CreateMIDIEventList(rw, &ppqn); + if (!evntlist) + goto bail; + + /* Allocate memory for the song struct */ + song = malloc(sizeof(NativeMidiSong)); + if (!song) + goto bail; + + /* Build a tune sequence from the event list */ + song->tuneSequence = BuildTuneSequence(evntlist, ppqn, part_poly_max, part_to_inst, &numParts); + if(!song->tuneSequence) + goto bail; + + /* Now build a tune header from the data we collect above, create + all parts as needed and assign them the correct instrument. + */ + song->tuneHeader = BuildTuneHeader(part_poly_max, part_to_inst, numParts); + if(!song->tuneHeader) + goto bail; + + /* Increment the instance count */ + gInstaceCount++; + if (gTunePlayer == NULL) + gTunePlayer = OpenDefaultComponent(kTunePlayerComponentType, 0); + + /* Finally, free the event list */ + FreeMIDIEventList(evntlist); + + if (freerw) { + SDL_RWclose(rw); + } + return song; + +bail: + if (evntlist) + FreeMIDIEventList(evntlist); + + if (song) + { + if(song->tuneSequence) + free(song->tuneSequence); + + if(song->tuneHeader) + DisposePtr((Ptr)song->tuneHeader); + + free(song); + } + + if (freerw) { + SDL_RWclose(rw); + } + return NULL; +} + +void native_midi_freesong(NativeMidiSong *song) +{ + if(!song || !song->tuneSequence) + return; + + /* If this is the currently playing song, stop it now */ + if (song->tuneSequence == gCurrentTuneSequence) + native_midi_stop(); + + /* Finally, free the data storage */ + free(song->tuneSequence); + DisposePtr((Ptr)song->tuneHeader); + free(song); + + /* Increment the instance count */ + gInstaceCount--; + if ((gTunePlayer != NULL) && (gInstaceCount == 0)) + { + CloseComponent(gTunePlayer); + gTunePlayer = NULL; + } +} + +void native_midi_start(NativeMidiSong *song, int loops) +{ + UInt32 queueFlags = 0; + ComponentResult tpError; + + assert (gTunePlayer != NULL); + + /* FIXME: is this code even used anymore? */ + assert (loops == 0); + + SDL_PauseAudio(1); + SDL_UnlockAudio(); + + /* First, stop the currently playing music */ + native_midi_stop(); + + /* Set up the queue flags */ + queueFlags = kTuneStartNow; + + /* Set the time scale (units per second), we want milliseconds */ + tpError = TuneSetTimeScale(gTunePlayer, 1000); + if (tpError != noErr) + { + strncpy (gErrorBuffer, "MIDI error during TuneSetTimeScale", ERROR_BUF_SIZE); + goto done; + } + + /* Set the header, to tell what instruments are used */ + tpError = TuneSetHeader(gTunePlayer, (UInt32 *)song->tuneHeader); + if (tpError != noErr) + { + strncpy (gErrorBuffer, "MIDI error during TuneSetHeader", ERROR_BUF_SIZE); + goto done; + } + + /* Have it allocate whatever resources are needed */ + tpError = TunePreroll(gTunePlayer); + if (tpError != noErr) + { + strncpy (gErrorBuffer, "MIDI error during TunePreroll", ERROR_BUF_SIZE); + goto done; + } + + /* We want to play at normal volume */ + tpError = TuneSetVolume(gTunePlayer, 0x00010000); + if (tpError != noErr) + { + strncpy (gErrorBuffer, "MIDI error during TuneSetVolume", ERROR_BUF_SIZE); + goto done; + } + + /* Finally, start playing the full song */ + gCurrentTuneSequence = song->tuneSequence; + tpError = TuneQueue(gTunePlayer, (UInt32 *)song->tuneSequence, 0x00010000, 0, 0xFFFFFFFF, queueFlags, NULL, 0); + if (tpError != noErr) + { + strncpy (gErrorBuffer, "MIDI error during TuneQueue", ERROR_BUF_SIZE); + goto done; + } + +done: + SDL_LockAudio(); + SDL_PauseAudio(0); +} + +void native_midi_stop() +{ + if (gTunePlayer == NULL) + return; + + /* Stop music */ + TuneStop(gTunePlayer, 0); + + /* Deallocate all instruments */ + TuneUnroll(gTunePlayer); +} + +int native_midi_active() +{ + if (gTunePlayer != NULL) + { + TuneStatus ts; + + TuneGetStatus(gTunePlayer,&ts); + return ts.queueTime != 0; + } + else + return 0; +} + +void native_midi_setvolume(int volume) +{ + if (gTunePlayer == NULL) + return; + + /* QTMA olume may range from 0.0 to 1.0 (in 16.16 fixed point encoding) */ + TuneSetVolume(gTunePlayer, (0x00010000 * volume)/SDL_MIX_MAXVOLUME); +} + +const char *native_midi_error(void) +{ + return gErrorBuffer; +} + +Uint32 *BuildTuneSequence(MIDIEvent *evntlist, int ppqn, int part_poly_max[32], int part_to_inst[32], int *numParts) +{ + int part_poly[32]; + int channel_to_part[16]; + + int channel_pan[16]; + int channel_vol[16]; + int channel_pitch_bend[16]; + + int lastEventTime = 0; + int tempo = 500000; + double Ippqn = 1.0 / (1000*ppqn); + double tick = tempo * Ippqn; + MIDIEvent *eventPos = evntlist; + MIDIEvent *noteOffPos; + Uint32 *tunePos, *endPos; + Uint32 *tuneSequence; + size_t tuneSize; + + /* allocate space for the tune header */ + tuneSize = 5000; + tuneSequence = (Uint32 *)malloc(tuneSize * sizeof(Uint32)); + if (tuneSequence == NULL) + return NULL; + + /* Set starting position in our tune memory */ + tunePos = tuneSequence; + endPos = tuneSequence + tuneSize; + + /* Initialise the arrays */ + memset(part_poly,0,sizeof(part_poly)); + + memset(channel_to_part,-1,sizeof(channel_to_part)); + memset(channel_pan,-1,sizeof(channel_pan)); + memset(channel_vol,-1,sizeof(channel_vol)); + memset(channel_pitch_bend,-1,sizeof(channel_pitch_bend)); + + *numParts = 0; + + /* + * Now the major work - iterate over all GM events, + * and turn them into QuickTime Music format. + * At the same time, calculate the max. polyphony for each part, + * and also the part->instrument mapping. + */ + while(eventPos) + { + int status = (eventPos->status&0xF0)>>4; + int channel = eventPos->status&0x0F; + int part = channel_to_part[channel]; + int velocity, pitch; + int value, controller; + int bend; + int newInst; + + /* Check if we are running low on space... */ + if((tunePos+16) > endPos) + { + /* Resize our data storage. */ + Uint32 *oldTuneSequence = tuneSequence; + + tuneSize += BUFFER_INCREMENT; + tuneSequence = (Uint32 *)realloc(tuneSequence, tuneSize * sizeof(Uint32)); + if(oldTuneSequence != tuneSequence) + tunePos += tuneSequence - oldTuneSequence; + endPos = tuneSequence + tuneSize; + } + + switch (status) + { + case MIDI_STATUS_NOTE_OFF: + assert(part>=0 && part<=31); + + /* Keep track of the polyphony of the current part */ + part_poly[part]--; + break; + case MIDI_STATUS_NOTE_ON: + if (part < 0) + { + /* If no part is specified yet, we default to the first instrument, which + is piano (or the first drum kit if we are on the drum channel) + */ + int newInst; + + if (channel == 9) + newInst = kFirstDrumkit + 1; /* the first drum kit is the "no drum" kit! */ + else + newInst = kFirstGMInstrument; + part = channel_to_part[channel] = *numParts; + part_to_inst[(*numParts)++] = newInst; + } + /* TODO - add support for more than 32 parts using eXtended QTMA events */ + assert(part<=31); + + /* Decode pitch & velocity */ + pitch = eventPos->data[0]; + velocity = eventPos->data[1]; + + if (velocity == 0) + { + /* was a NOTE OFF in disguise, so we decrement the polyphony */ + part_poly[part]--; + } + else + { + /* Keep track of the polyphony of the current part */ + int foo = ++part_poly[part]; + if (part_poly_max[part] < foo) + part_poly_max[part] = foo; + + /* Now scan forward to find the matching NOTE OFF event */ + for(noteOffPos = eventPos; noteOffPos; noteOffPos = noteOffPos->next) + { + if ((noteOffPos->status&0xF0)>>4 == MIDI_STATUS_NOTE_OFF + && channel == (eventPos->status&0x0F) + && pitch == noteOffPos->data[0]) + break; + /* NOTE ON with velocity == 0 is the same as a NOTE OFF */ + if ((noteOffPos->status&0xF0)>>4 == MIDI_STATUS_NOTE_ON + && channel == (eventPos->status&0x0F) + && pitch == noteOffPos->data[0] + && 0 == noteOffPos->data[1]) + break; + } + + /* Did we find a note off? Should always be the case, but who knows... */ + if (noteOffPos) + { + /* We found a NOTE OFF, now calculate the note duration */ + int duration = (int)((noteOffPos->time - eventPos->time)*tick); + + REST_IF_NECESSARY(); + /* Now we need to check if we get along with a normal Note Event, or if we need an extended one... */ + if (duration < 2048 && pitch>=32 && pitch<=95 && velocity>=0 && velocity<=127) + { + qtma_StuffNoteEvent(*tunePos, part, pitch, velocity, duration); + tunePos++; + } + else + { + qtma_StuffXNoteEvent(*tunePos, *(tunePos+1), part, pitch, velocity, duration); + tunePos+=2; + } + } + } + break; + case MIDI_STATUS_AFTERTOUCH: + /* NYI - use kControllerAfterTouch. But how are the parameters to be mapped? */ + break; + case MIDI_STATUS_CONTROLLER: + controller = eventPos->data[0]; + value = eventPos->data[1]; + + switch(controller) + { + case 0: /* bank change - igore for now */ + break; + case kControllerVolume: + if(channel_vol[channel] != value<<8) + { + channel_vol[channel] = value<<8; + if(part>=0 && part<=31) + { + REST_IF_NECESSARY(); + qtma_StuffControlEvent(*tunePos, part, kControllerVolume, channel_vol[channel]); + tunePos++; + } + } + break; + case kControllerPan: + if(channel_pan[channel] != (value << 1) + 256) + { + channel_pan[channel] = (value << 1) + 256; + if(part>=0 && part<=31) + { + REST_IF_NECESSARY(); + qtma_StuffControlEvent(*tunePos, part, kControllerPan, channel_pan[channel]); + tunePos++; + } + } + break; + default: + /* No other controllers implemented yet */; + break; + } + + break; + case MIDI_STATUS_PROG_CHANGE: + /* Instrument changed */ + newInst = eventPos->data[0]; + + /* Channel 9 (the 10th channel) is different, it indicates a drum kit */ + if (channel == 9) + newInst += kFirstDrumkit; + else + newInst += kFirstGMInstrument; + /* Only if the instrument for this channel *really* changed, add a new part. */ + if(newInst != part_to_inst[part]) + { + /* TODO maybe make use of kGeneralEventPartChange here, + to help QT reuse note channels? + */ + part = channel_to_part[channel] = *numParts; + part_to_inst[(*numParts)++] = newInst; + + if(channel_vol[channel] >= 0) + { + REST_IF_NECESSARY(); + qtma_StuffControlEvent(*tunePos, part, kControllerVolume, channel_vol[channel]); + tunePos++; + } + if(channel_pan[channel] >= 0) + { + REST_IF_NECESSARY(); + qtma_StuffControlEvent(*tunePos, part, kControllerPan, channel_pan[channel]); + tunePos++; + } + if(channel_pitch_bend[channel] >= 0) + { + REST_IF_NECESSARY(); + qtma_StuffControlEvent(*tunePos, part, kControllerPitchBend, channel_pitch_bend[channel]); + tunePos++; + } + } + break; + case MIDI_STATUS_PRESSURE: + /* NYI */ + break; + case MIDI_STATUS_PITCH_WHEEL: + /* In the midi spec, 0x2000 = center, 0x0000 = - 2 semitones, 0x3FFF = +2 semitones + but for QTMA, we specify it as a 8.8 fixed point of semitones + TODO: detect "pitch bend range changes" & honor them! + */ + bend = (eventPos->data[0] & 0x7f) | ((eventPos->data[1] & 0x7f) << 7); + + /* "Center" the bend */ + bend -= 0x2000; + + /* Move it to our format: */ + bend <<= 4; + + /* If it turns out the pitch bend didn't change, stop here */ + if(channel_pitch_bend[channel] == bend) + break; + + channel_pitch_bend[channel] = bend; + if(part>=0 && part<=31) + { + /* Stuff a control event */ + REST_IF_NECESSARY(); + qtma_StuffControlEvent(*tunePos, part, kControllerPitchBend, bend); + tunePos++; + } + break; + case MIDI_STATUS_SYSEX: + if (eventPos->status == 0xFF && eventPos->data[0] == 0x51) /* Tempo change */ + { + tempo = (eventPos->extraData[0] << 16) + + (eventPos->extraData[1] << 8) + + eventPos->extraData[2]; + + tick = tempo * Ippqn; + } + break; + } + + /* on to the next event */ + eventPos = eventPos->next; + } + + /* Finally, place an end marker */ + *tunePos = kEndMarkerValue; + + return tuneSequence; +} + +Uint32 *BuildTuneHeader(int part_poly_max[32], int part_to_inst[32], int numParts) +{ + Uint32 *myHeader; + Uint32 *myPos1, *myPos2; /* pointers to the head and tail long words of a music event */ + NoteRequest *myNoteRequest; + NoteAllocator myNoteAllocator; /* for the NAStuffToneDescription call */ + ComponentResult myErr = noErr; + int part; + + myHeader = NULL; + myNoteAllocator = NULL; + + /* + * Open up the Note Allocator + */ + myNoteAllocator = OpenDefaultComponent(kNoteAllocatorComponentType,0); + if (myNoteAllocator == NULL) + goto bail; + + /* + * Allocate space for the tune header + */ + myHeader = (Uint32 *) + NewPtrClear((numParts * kNoteRequestEventLength + kMarkerEventLength) * sizeof(Uint32)); + if (myHeader == NULL) + goto bail; + + myPos1 = myHeader; + + /* + * Loop over all parts + */ + for(part = 0; part < numParts; ++part) + { + /* + * Stuff request for the instrument with the given polyphony + */ + myPos2 = myPos1 + (kNoteRequestEventLength - 1); /* last longword of general event */ + qtma_StuffGeneralEvent(*myPos1, *myPos2, part, kGeneralEventNoteRequest, kNoteRequestEventLength); + myNoteRequest = (NoteRequest *)(myPos1 + 1); + myNoteRequest->info.flags = 0; + /* I'm told by the Apple people that the Quicktime types were poorly designed and it was + * too late to change them. On little endian, the BigEndian(Short|Fixed) types are structs + * while on big endian they are primitive types. Furthermore, Quicktime failed to + * provide setter and getter functions. To get this to work, we need to case the + * code for the two possible situations. + * My assumption is that the right-side value was always expected to be BigEndian + * as it was written way before the Universal Binary transition. So in the little endian + * case, OSSwap is used. + */ +#if SDL_BYTEORDER == SDL_LIL_ENDIAN + myNoteRequest->info.polyphony.bigEndianValue = OSSwapHostToBigInt16(part_poly_max[part]); + myNoteRequest->info.typicalPolyphony.bigEndianValue = OSSwapHostToBigInt32(0x00010000); +#else + myNoteRequest->info.polyphony = part_poly_max[part]; + myNoteRequest->info.typicalPolyphony = 0x00010000; +#endif + myErr = NAStuffToneDescription(myNoteAllocator,part_to_inst[part],&myNoteRequest->tone); + if (myErr != noErr) + goto bail; + + /* move pointer to beginning of next event */ + myPos1 += kNoteRequestEventLength; + } + + *myPos1 = kEndMarkerValue; /* end of sequence marker */ + + +bail: + if(myNoteAllocator) + CloseComponent(myNoteAllocator); + + /* if we encountered an error, dispose of the storage we allocated and return NULL */ + if (myErr != noErr) { + DisposePtr((Ptr)myHeader); + myHeader = NULL; + } + + return myHeader; +} + +#endif /* MacOS native MIDI support */ diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_macosx.c b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_macosx.c new file mode 100644 index 0000000..8fefbc9 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_macosx.c @@ -0,0 +1,322 @@ +/* + native_midi_macosx: Native Midi support on Mac OS X for the SDL_mixer library + Copyright (C) 2009 Ryan C. Gordon + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* This is Mac OS X only, using Core MIDI. + Mac OS 9 support via QuickTime is in native_midi_mac.c */ + +#include "SDL_config.h" + +#if __MACOSX__ + +#include +#include +#include + +#include "../SDL_mixer.h" +#include "SDL_endian.h" +#include "native_midi.h" + +/* Native Midi song */ +struct _NativeMidiSong +{ + MusicPlayer player; + MusicSequence sequence; + MusicTimeStamp endTime; + AudioUnit audiounit; + int loops; +}; + +static NativeMidiSong *currentsong = NULL; +static int latched_volume = MIX_MAX_VOLUME; + +static OSStatus +GetSequenceLength(MusicSequence sequence, MusicTimeStamp *_sequenceLength) +{ + // http://lists.apple.com/archives/Coreaudio-api/2003/Jul/msg00370.html + // figure out sequence length + UInt32 ntracks, i; + MusicTimeStamp sequenceLength = 0; + OSStatus err; + + err = MusicSequenceGetTrackCount(sequence, &ntracks); + if (err != noErr) + return err; + + for (i = 0; i < ntracks; ++i) + { + MusicTrack track; + MusicTimeStamp tracklen = 0; + UInt32 tracklenlen = sizeof (tracklen); + + err = MusicSequenceGetIndTrack(sequence, i, &track); + if (err != noErr) + return err; + + err = MusicTrackGetProperty(track, kSequenceTrackProperty_TrackLength, + &tracklen, &tracklenlen); + if (err != noErr) + return err; + + if (sequenceLength < tracklen) + sequenceLength = tracklen; + } + + *_sequenceLength = sequenceLength; + + return noErr; +} + + +/* we're looking for the sequence output audiounit. */ +static OSStatus +GetSequenceAudioUnit(MusicSequence sequence, AudioUnit *aunit) +{ + AUGraph graph; + UInt32 nodecount, i; + OSStatus err; + + err = MusicSequenceGetAUGraph(sequence, &graph); + if (err != noErr) + return err; + + err = AUGraphGetNodeCount(graph, &nodecount); + if (err != noErr) + return err; + + for (i = 0; i < nodecount; i++) { + AUNode node; + + if (AUGraphGetIndNode(graph, i, &node) != noErr) + continue; /* better luck next time. */ + +#if MAC_OS_X_VERSION_MIN_REQUIRED < 1060 /* this is deprecated, but works back to 10.0 */ + { + struct ComponentDescription desc; + UInt32 classdatasize = 0; + void *classdata = NULL; + err = AUGraphGetNodeInfo(graph, node, &desc, &classdatasize, + &classdata, aunit); + if (err != noErr) + continue; + else if (desc.componentType != kAudioUnitType_Output) + continue; + else if (desc.componentSubType != kAudioUnitSubType_DefaultOutput) + continue; + } + #else /* not deprecated, but requires 10.5 or later */ + { + AudioComponentDescription desc; + if (AUGraphNodeInfo(graph, node, &desc, aunit) != noErr) + continue; + else if (desc.componentType != kAudioUnitType_Output) + continue; + else if (desc.componentSubType != kAudioUnitSubType_DefaultOutput) + continue; + } + #endif + + return noErr; /* found it! */ + } + + return kAUGraphErr_NodeNotFound; +} + + +int native_midi_detect() +{ + return 1; /* always available. */ +} + +NativeMidiSong *native_midi_loadsong_RW(SDL_RWops *rw, int freerw) +{ + NativeMidiSong *retval = NULL; + void *buf = NULL; + int len = 0; + CFDataRef data = NULL; + + if (SDL_RWseek(rw, 0, RW_SEEK_END) < 0) + goto fail; + len = SDL_RWtell(rw); + if (len < 0) + goto fail; + if (SDL_RWseek(rw, 0, RW_SEEK_SET) < 0) + goto fail; + + buf = malloc(len); + if (buf == NULL) + goto fail; + + if (SDL_RWread(rw, buf, len, 1) != 1) + goto fail; + + retval = malloc(sizeof(NativeMidiSong)); + if (retval == NULL) + goto fail; + + memset(retval, '\0', sizeof (*retval)); + + if (NewMusicPlayer(&retval->player) != noErr) + goto fail; + if (NewMusicSequence(&retval->sequence) != noErr) + goto fail; + + data = CFDataCreate(NULL, (const UInt8 *) buf, len); + if (data == NULL) + goto fail; + + free(buf); + buf = NULL; + + #if MAC_OS_X_VERSION_MIN_REQUIRED <= MAC_OS_X_VERSION_10_4 /* this is deprecated, but works back to 10.3 */ + if (MusicSequenceLoadSMFDataWithFlags(retval->sequence, data, 0) != noErr) + goto fail; + #else /* not deprecated, but requires 10.5 or later */ + if (MusicSequenceFileLoadData(retval->sequence, data, 0, 0) != noErr) + goto fail; + #endif + + CFRelease(data); + data = NULL; + + if (GetSequenceLength(retval->sequence, &retval->endTime) != noErr) + goto fail; + + if (MusicPlayerSetSequence(retval->player, retval->sequence) != noErr) + goto fail; + + if (freerw) + SDL_RWclose(rw); + + return retval; + +fail: + if (retval) { + if (retval->sequence) + DisposeMusicSequence(retval->sequence); + if (retval->player) + DisposeMusicPlayer(retval->player); + free(retval); + } + + if (data) + CFRelease(data); + + if (buf) + free(buf); + + if (freerw) + SDL_RWclose(rw); + + return NULL; +} + +void native_midi_freesong(NativeMidiSong *song) +{ + if (song != NULL) { + if (currentsong == song) + currentsong = NULL; + MusicPlayerStop(song->player); + DisposeMusicSequence(song->sequence); + DisposeMusicPlayer(song->player); + free(song); + } +} + +void native_midi_start(NativeMidiSong *song, int loops) +{ + int vol; + + if (song == NULL) + return; + + SDL_PauseAudio(1); + SDL_UnlockAudio(); + + if (currentsong) + MusicPlayerStop(currentsong->player); + + currentsong = song; + currentsong->loops = loops; + + MusicPlayerPreroll(song->player); + MusicPlayerSetTime(song->player, 0); + MusicPlayerStart(song->player); + + GetSequenceAudioUnit(song->sequence, &song->audiounit); + + vol = latched_volume; + latched_volume++; /* just make this not match. */ + native_midi_setvolume(vol); + + SDL_LockAudio(); + SDL_PauseAudio(0); +} + +void native_midi_stop() +{ + if (currentsong) { + SDL_PauseAudio(1); + SDL_UnlockAudio(); + MusicPlayerStop(currentsong->player); + currentsong = NULL; + SDL_LockAudio(); + SDL_PauseAudio(0); + } +} + +int native_midi_active() +{ + MusicTimeStamp currentTime = 0; + if (currentsong == NULL) + return 0; + + MusicPlayerGetTime(currentsong->player, ¤tTime); + if ((currentTime < currentsong->endTime) || + (currentTime >= kMusicTimeStamp_EndOfTrack)) { + return 1; + } else if (currentsong->loops) { + --currentsong->loops; + MusicPlayerSetTime(currentsong->player, 0); + return 1; + } + return 0; +} + +void native_midi_setvolume(int volume) +{ + if (latched_volume == volume) + return; + + latched_volume = volume; + if ((currentsong) && (currentsong->audiounit)) { + const float floatvol = ((float) volume) / ((float) MIX_MAX_VOLUME); + AudioUnitSetParameter(currentsong->audiounit, kHALOutputParam_Volume, + kAudioUnitScope_Global, 0, floatvol, 0); + } +} + +const char *native_midi_error(void) +{ + return ""; /* !!! FIXME */ +} + +#endif /* Mac OS X native MIDI support */ + diff --git a/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_win32.c b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_win32.c new file mode 100644 index 0000000..187d989 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/native_midi/native_midi_win32.c @@ -0,0 +1,312 @@ +/* + native_midi: Hardware Midi support for the SDL_mixer library + Copyright (C) 2000,2001 Florian 'Proff' Schulze + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ +#include "SDL_config.h" + +/* everything below is currently one very big bad hack ;) Proff */ + +#if __WIN32__ +#define WIN32_LEAN_AND_MEAN +#include +#include +#include +#include +#include +#include +#include "native_midi.h" +#include "native_midi_common.h" + +struct _NativeMidiSong { + int MusicLoaded; + int MusicPlaying; + int Loops; + int CurrentHdr; + MIDIHDR MidiStreamHdr[2]; + MIDIEVENT *NewEvents; + Uint16 ppqn; + int Size; + int NewPos; +}; + +static UINT MidiDevice=MIDI_MAPPER; +static HMIDISTRM hMidiStream; +static NativeMidiSong *currentsong; + +static int BlockOut(NativeMidiSong *song) +{ + MMRESULT err; + int BlockSize; + MIDIHDR *hdr; + + if ((song->MusicLoaded) && (song->NewEvents)) + { + // proff 12/8/98: Added for safety + song->CurrentHdr = !song->CurrentHdr; + hdr = &song->MidiStreamHdr[song->CurrentHdr]; + midiOutUnprepareHeader((HMIDIOUT)hMidiStream,hdr,sizeof(MIDIHDR)); + if (song->NewPos>=song->Size) + return 0; + BlockSize=(song->Size-song->NewPos); + if (BlockSize<=0) + return 0; + if (BlockSize>36000) + BlockSize=36000; + hdr->lpData=(void *)((unsigned char *)song->NewEvents+song->NewPos); + song->NewPos+=BlockSize; + hdr->dwBufferLength=BlockSize; + hdr->dwBytesRecorded=BlockSize; + hdr->dwFlags=0; + hdr->dwOffset=0; + err=midiOutPrepareHeader((HMIDIOUT)hMidiStream,hdr,sizeof(MIDIHDR)); + if (err!=MMSYSERR_NOERROR) + return 0; + err=midiStreamOut(hMidiStream,hdr,sizeof(MIDIHDR)); + return 0; + } + return 1; +} + +static void MIDItoStream(NativeMidiSong *song, MIDIEvent *evntlist) +{ + int eventcount; + MIDIEvent *event; + MIDIEVENT *newevent; + + eventcount=0; + event=evntlist; + while (event) + { + eventcount++; + event=event->next; + } + song->NewEvents=malloc(eventcount*3*sizeof(DWORD)); + if (!song->NewEvents) + return; + memset(song->NewEvents,0,(eventcount*3*sizeof(DWORD))); + + eventcount=0; + event=evntlist; + newevent=song->NewEvents; + while (event) + { + int status = (event->status&0xF0)>>4; + switch (status) + { + case MIDI_STATUS_NOTE_OFF: + case MIDI_STATUS_NOTE_ON: + case MIDI_STATUS_AFTERTOUCH: + case MIDI_STATUS_CONTROLLER: + case MIDI_STATUS_PROG_CHANGE: + case MIDI_STATUS_PRESSURE: + case MIDI_STATUS_PITCH_WHEEL: + newevent->dwDeltaTime=event->time; + newevent->dwEvent=(event->status|0x80)|(event->data[0]<<8)|(event->data[1]<<16)|(MEVT_SHORTMSG<<24); + newevent=(MIDIEVENT*)((char*)newevent+(3*sizeof(DWORD))); + eventcount++; + break; + + case MIDI_STATUS_SYSEX: + if (event->status == 0xFF && event->data[0] == 0x51) /* Tempo change */ + { + int tempo = (event->extraData[0] << 16) | + (event->extraData[1] << 8) | + event->extraData[2]; + newevent->dwDeltaTime=event->time; + newevent->dwEvent=(MEVT_TEMPO<<24) | tempo; + newevent=(MIDIEVENT*)((char*)newevent+(3*sizeof(DWORD))); + eventcount++; + } + break; + } + + event=event->next; + } + + song->Size=eventcount*3*sizeof(DWORD); + + { + int time; + int temptime; + + song->NewPos=0; + time=0; + newevent=song->NewEvents; + while (song->NewPosSize) + { + temptime=newevent->dwDeltaTime; + newevent->dwDeltaTime-=time; + time=temptime; + if ((song->NewPos+12)>=song->Size) + newevent->dwEvent |= MEVT_F_CALLBACK; + newevent=(MIDIEVENT*)((char*)newevent+(3*sizeof(DWORD))); + song->NewPos+=12; + } + } + song->NewPos=0; + song->MusicLoaded=1; +} + +void CALLBACK MidiProc( HMIDIIN hMidi, UINT uMsg, DWORD_PTR dwInstance, + DWORD_PTR dwParam1, DWORD_PTR dwParam2 ) +{ + switch( uMsg ) + { + case MOM_DONE: + if ((currentsong->MusicLoaded) && (dwParam1 == (DWORD_PTR)¤tsong->MidiStreamHdr[currentsong->CurrentHdr])) + BlockOut(currentsong); + break; + case MOM_POSITIONCB: + if ((currentsong->MusicLoaded) && (dwParam1 == (DWORD_PTR)¤tsong->MidiStreamHdr[currentsong->CurrentHdr])) { + if (currentsong->Loops) { + --currentsong->Loops; + currentsong->NewPos=0; + BlockOut(currentsong); + } else { + currentsong->MusicPlaying=0; + } + } + break; + default: + break; + } +} + +int native_midi_detect() +{ + MMRESULT merr; + HMIDISTRM MidiStream; + + merr=midiStreamOpen(&MidiStream,&MidiDevice,(DWORD)1,(DWORD_PTR)MidiProc,(DWORD_PTR)0,CALLBACK_FUNCTION); + if (merr!=MMSYSERR_NOERROR) + return 0; + midiStreamClose(MidiStream); + return 1; +} + +NativeMidiSong *native_midi_loadsong_RW(SDL_RWops *rw, int freerw) +{ + NativeMidiSong *newsong; + MIDIEvent *evntlist = NULL; + + newsong=malloc(sizeof(NativeMidiSong)); + if (!newsong) { + if (freerw) { + SDL_RWclose(rw); + } + return NULL; + } + memset(newsong,0,sizeof(NativeMidiSong)); + + /* Attempt to load the midi file */ + evntlist = CreateMIDIEventList(rw, &newsong->ppqn); + if (!evntlist) + { + free(newsong); + if (freerw) { + SDL_RWclose(rw); + } + return NULL; + } + + MIDItoStream(newsong, evntlist); + + FreeMIDIEventList(evntlist); + + if (freerw) { + SDL_RWclose(rw); + } + return newsong; +} + +void native_midi_freesong(NativeMidiSong *song) +{ + if (hMidiStream) + { + midiStreamStop(hMidiStream); + midiStreamClose(hMidiStream); + } + if (song) + { + if (song->NewEvents) + free(song->NewEvents); + free(song); + } +} + +void native_midi_start(NativeMidiSong *song, int loops) +{ + MMRESULT merr; + MIDIPROPTIMEDIV mptd; + + native_midi_stop(); + if (!hMidiStream) + { + merr=midiStreamOpen(&hMidiStream,&MidiDevice,(DWORD)1,(DWORD_PTR)MidiProc,(DWORD_PTR)0,CALLBACK_FUNCTION); + if (merr!=MMSYSERR_NOERROR) + { + hMidiStream = NULL; // should I do midiStreamClose(hMidiStream) before? + return; + } + //midiStreamStop(hMidiStream); + currentsong=song; + currentsong->NewPos=0; + currentsong->MusicPlaying=1; + currentsong->Loops=loops; + mptd.cbStruct=sizeof(MIDIPROPTIMEDIV); + mptd.dwTimeDiv=currentsong->ppqn; + merr=midiStreamProperty(hMidiStream,(LPBYTE)&mptd,MIDIPROP_SET | MIDIPROP_TIMEDIV); + BlockOut(song); + merr=midiStreamRestart(hMidiStream); + } +} + +void native_midi_stop() +{ + if (!hMidiStream) + return; + midiStreamStop(hMidiStream); + midiStreamClose(hMidiStream); + currentsong=NULL; + hMidiStream = NULL; +} + +int native_midi_active() +{ + return currentsong->MusicPlaying; +} + +void native_midi_setvolume(int volume) +{ + int calcVolume; + if (volume > 128) + volume = 128; + if (volume < 0) + volume = 0; + calcVolume = (65535 * volume / 128); + + midiOutSetVolume((HMIDIOUT)hMidiStream, MAKELONG(calcVolume , calcVolume)); +} + +const char *native_midi_error(void) +{ + return ""; +} + +#endif /* Windows native MIDI support */ diff --git a/apps/plugins/sdl/SDL_mixer/playmus.c b/apps/plugins/sdl/SDL_mixer/playmus.c new file mode 100644 index 0000000..4f8bb61 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/playmus.c @@ -0,0 +1,234 @@ +/* + PLAYMUS: A test application for the SDL mixer library. + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#ifdef unix +#include +#endif + +#include "SDL.h" +#include "SDL_mixer.h" + +#ifdef HAVE_SIGNAL_H +#include +#endif + + +static int audio_open = 0; +static Mix_Music *music = NULL; +static int next_track = 0; + +void CleanUp(int exitcode) +{ + if( Mix_PlayingMusic() ) { + Mix_FadeOutMusic(1500); + SDL_Delay(1500); + } + if ( music ) { + Mix_FreeMusic(music); + music = NULL; + } + if ( audio_open ) { + Mix_CloseAudio(); + audio_open = 0; + } + SDL_Quit(); + exit(exitcode); +} + +void Usage(char *argv0) +{ + fprintf(stderr, "Usage: %s [-i] [-l] [-8] [-r rate] [-c channels] [-b buffers] [-v N] [-rwops] \n", argv0); +} + +void Menu(void) +{ + char buf[10]; + + printf("Available commands: (p)ause (r)esume (h)alt volume(v#) > "); + if (scanf("%s",buf) == 1) { + switch(buf[0]){ + case 'p': case 'P': + Mix_PauseMusic(); + break; + case 'r': case 'R': + Mix_ResumeMusic(); + break; + case 'h': case 'H': + Mix_HaltMusic(); + break; + case 'v': case 'V': + Mix_VolumeMusic(atoi(buf+1)); + break; + } + } + printf("Music playing: %s Paused: %s\n", Mix_PlayingMusic() ? "yes" : "no", + Mix_PausedMusic() ? "yes" : "no"); +} + +#ifdef HAVE_SIGNAL_H + +void IntHandler(int sig) +{ + switch (sig) { + case SIGINT: + next_track++; + break; + } +} + +#endif + +int main(int argc, char *argv[]) +{ + SDL_RWops *rwfp = NULL; + int audio_rate; + Uint16 audio_format; + int audio_channels; + int audio_buffers; + int audio_volume = MIX_MAX_VOLUME; + int looping = 0; + int interactive = 0; + int rwops = 0; + int i; + + /* Initialize variables */ + audio_rate = 22050; + audio_format = AUDIO_S16; + audio_channels = 2; + audio_buffers = 4096; + + /* Check command line usage */ + for ( i=1; argv[i] && (*argv[i] == '-'); ++i ) { + if ( (strcmp(argv[i], "-r") == 0) && argv[i+1] ) { + ++i; + audio_rate = atoi(argv[i]); + } else + if ( strcmp(argv[i], "-m") == 0 ) { + audio_channels = 1; + } else + if ( (strcmp(argv[i], "-c") == 0) && argv[i+1] ) { + ++i; + audio_channels = atoi(argv[i]); + } else + if ( (strcmp(argv[i], "-b") == 0) && argv[i+1] ) { + ++i; + audio_buffers = atoi(argv[i]); + } else + if ( (strcmp(argv[i], "-v") == 0) && argv[i+1] ) { + ++i; + audio_volume = atoi(argv[i]); + } else + if ( strcmp(argv[i], "-l") == 0 ) { + looping = -1; + } else + if ( strcmp(argv[i], "-i") == 0 ) { + interactive = 1; + } else + if ( strcmp(argv[i], "-8") == 0 ) { + audio_format = AUDIO_U8; + } else + if ( strcmp(argv[i], "-rwops") == 0 ) { + rwops = 1; + } else { + Usage(argv[0]); + return(1); + } + } + if ( ! argv[i] ) { + Usage(argv[0]); + return(1); + } + + /* Initialize the SDL library */ + if ( SDL_Init(SDL_INIT_AUDIO) < 0 ) { + fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); + return(255); + } + +#ifdef HAVE_SIGNAL_H + signal(SIGINT, IntHandler); + signal(SIGTERM, CleanUp); +#endif + + /* Open the audio device */ + if (Mix_OpenAudio(audio_rate, audio_format, audio_channels, audio_buffers) < 0) { + fprintf(stderr, "Couldn't open audio: %s\n", SDL_GetError()); + return(2); + } else { + Mix_QuerySpec(&audio_rate, &audio_format, &audio_channels); + printf("Opened audio at %d Hz %d bit %s (%s), %d bytes audio buffer\n", audio_rate, + (audio_format&0xFF), + (audio_channels > 2) ? "surround" : (audio_channels > 1) ? "stereo" : "mono", + (audio_format&0x1000) ? "BE" : "LE", + audio_buffers ); + } + audio_open = 1; + + /* Set the music volume */ + Mix_VolumeMusic(audio_volume); + + /* Set the external music player, if any */ + Mix_SetMusicCMD(SDL_getenv("MUSIC_CMD")); + + while (argv[i]) { + next_track = 0; + + /* Load the requested music file */ + if ( rwops ) { + rwfp = SDL_RWFromFile(argv[i], "rb"); + music = Mix_LoadMUS_RW(rwfp); + } else { + music = Mix_LoadMUS(argv[i]); + } + if ( music == NULL ) { + fprintf(stderr, "Couldn't load %s: %s\n", + argv[i], SDL_GetError()); + CleanUp(2); + } + + /* Play and then exit */ + printf("Playing %s\n", argv[i]); + Mix_FadeInMusic(music,looping,2000); + while ( !next_track && (Mix_PlayingMusic() || Mix_PausedMusic()) ) { + if(interactive) + Menu(); + else + SDL_Delay(100); + } + Mix_FreeMusic(music); + if ( rwops ) { + SDL_RWclose(rwfp); + } + music = NULL; + + /* If the user presses Ctrl-C more than once, exit. */ + SDL_Delay(500); + if ( next_track > 1 ) break; + + i++; + } + CleanUp(0); + + /* Not reached, but fixes compiler warnings */ + return 0; +} diff --git a/apps/plugins/sdl/SDL_mixer/playwave.c b/apps/plugins/sdl/SDL_mixer/playwave.c new file mode 100644 index 0000000..e53f1a9 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/playwave.c @@ -0,0 +1,497 @@ +/* + PLAYWAVE: A test application for the SDL mixer library. + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#ifdef unix +#include +#endif + +#include "SDL.h" +#include "SDL_mixer.h" + +#ifdef HAVE_SIGNAL_H +#include +#endif + + +/* + * rcg06132001 various mixer tests. Define the ones you want. + */ +/*#define TEST_MIX_DECODERS*/ +/*#define TEST_MIX_VERSIONS*/ +/*#define TEST_MIX_CHANNELFINISHED*/ +/*#define TEST_MIX_PANNING*/ +/*#define TEST_MIX_DISTANCE*/ +/*#define TEST_MIX_POSITION*/ + + +#if (defined TEST_MIX_POSITION) + +#if (defined TEST_MIX_PANNING) +#error TEST_MIX_POSITION interferes with TEST_MIX_PANNING. +#endif + +#if (defined TEST_MIX_DISTANCE) +#error TEST_MIX_POSITION interferes with TEST_MIX_DISTANCE. +#endif + +#endif + + +/* rcg06192001 for debugging purposes. */ +static void output_test_warnings(void) +{ +#if (defined TEST_MIX_CHANNELFINISHED) + fprintf(stderr, "Warning: TEST_MIX_CHANNELFINISHED is enabled in this binary...\n"); +#endif +#if (defined TEST_MIX_PANNING) + fprintf(stderr, "Warning: TEST_MIX_PANNING is enabled in this binary...\n"); +#endif +#if (defined TEST_MIX_VERSIONS) + fprintf(stderr, "Warning: TEST_MIX_VERSIONS is enabled in this binary...\n"); +#endif +#if (defined TEST_MIX_DISTANCE) + fprintf(stderr, "Warning: TEST_MIX_DISTANCE is enabled in this binary...\n"); +#endif +#if (defined TEST_MIX_POSITION) + fprintf(stderr, "Warning: TEST_MIX_POSITION is enabled in this binary...\n"); +#endif +} + + +static int audio_open = 0; +static Mix_Chunk *wave = NULL; + +/* rcg06042009 Report available decoders. */ +#if (defined TEST_MIX_DECODERS) +static void report_decoders(void) +{ + int i, total; + + printf("Supported decoders...\n"); + total = Mix_GetNumChunkDecoders(); + for (i = 0; i < total; i++) { + fprintf(stderr, " - chunk decoder: %s\n", Mix_GetChunkDecoder(i)); + } + + total = Mix_GetNumMusicDecoders(); + for (i = 0; i < total; i++) { + fprintf(stderr, " - music decoder: %s\n", Mix_GetMusicDecoder(i)); + } +} +#endif + +/* rcg06192001 Check new Mixer version API. */ +#if (defined TEST_MIX_VERSIONS) +static void output_versions(const char *libname, const SDL_version *compiled, + const SDL_version *linked) +{ + fprintf(stderr, + "This program was compiled against %s %d.%d.%d,\n" + " and is dynamically linked to %d.%d.%d.\n", libname, + compiled->major, compiled->minor, compiled->patch, + linked->major, linked->minor, linked->patch); +} + +static void test_versions(void) +{ + SDL_version compiled; + const SDL_version *linked; + + SDL_VERSION(&compiled); + linked = SDL_Linked_Version(); + output_versions("SDL", &compiled, linked); + + SDL_MIXER_VERSION(&compiled); + linked = Mix_Linked_Version(); + output_versions("SDL_mixer", &compiled, linked); +} +#endif + + +#ifdef TEST_MIX_CHANNELFINISHED /* rcg06072001 */ +static volatile int channel_is_done = 0; +static void channel_complete_callback(int chan) +{ + Mix_Chunk *done_chunk = Mix_GetChunk(chan); + fprintf(stderr, "We were just alerted that Mixer channel #%d is done.\n", chan); + fprintf(stderr, "Channel's chunk pointer is (%p).\n", done_chunk); + fprintf(stderr, " Which %s correct.\n", (wave == done_chunk) ? "is" : "is NOT"); + channel_is_done = 1; +} +#endif + + +/* rcg06192001 abstract this out for testing purposes. */ +static int still_playing(void) +{ +#ifdef TEST_MIX_CHANNELFINISHED + return(!channel_is_done); +#else + return(Mix_Playing(0)); +#endif +} + + +#if (defined TEST_MIX_PANNING) +static void do_panning_update(void) +{ + static Uint8 leftvol = 128; + static Uint8 rightvol = 128; + static Uint8 leftincr = -1; + static Uint8 rightincr = 1; + static int panningok = 1; + static Uint32 next_panning_update = 0; + + if ((panningok) && (SDL_GetTicks() >= next_panning_update)) { + panningok = Mix_SetPanning(0, leftvol, rightvol); + if (!panningok) { + fprintf(stderr, "Mix_SetPanning(0, %d, %d) failed!\n", + (int) leftvol, (int) rightvol); + fprintf(stderr, "Reason: [%s].\n", Mix_GetError()); + } + + if ((leftvol == 255) || (leftvol == 0)) { + if (leftvol == 255) + printf("All the way in the left speaker.\n"); + leftincr *= -1; + } + + if ((rightvol == 255) || (rightvol == 0)) { + if (rightvol == 255) + printf("All the way in the right speaker.\n"); + rightincr *= -1; + } + + leftvol += leftincr; + rightvol += rightincr; + next_panning_update = SDL_GetTicks() + 10; + } +} +#endif + + +#if (defined TEST_MIX_DISTANCE) +static void do_distance_update(void) +{ + static Uint8 distance = 1; + static Uint8 distincr = 1; + static int distanceok = 1; + static Uint32 next_distance_update = 0; + + if ((distanceok) && (SDL_GetTicks() >= next_distance_update)) { + distanceok = Mix_SetDistance(0, distance); + if (!distanceok) { + fprintf(stderr, "Mix_SetDistance(0, %d) failed!\n", (int) distance); + fprintf(stderr, "Reason: [%s].\n", Mix_GetError()); + } + + if (distance == 0) { + printf("Distance at nearest point.\n"); + distincr *= -1; + } + else if (distance == 255) { + printf("Distance at furthest point.\n"); + distincr *= -1; + } + + distance += distincr; + next_distance_update = SDL_GetTicks() + 15; + } +} +#endif + + +#if (defined TEST_MIX_POSITION) +static void do_position_update(void) +{ + static Sint16 distance = 1; + static Sint8 distincr = 1; + static Uint16 angle = 0; + static Sint8 angleincr = 1; + static int positionok = 1; + static Uint32 next_position_update = 0; + + if ((positionok) && (SDL_GetTicks() >= next_position_update)) { + positionok = Mix_SetPosition(0, angle, distance); + if (!positionok) { + fprintf(stderr, "Mix_SetPosition(0, %d, %d) failed!\n", + (int) angle, (int) distance); + fprintf(stderr, "Reason: [%s].\n", Mix_GetError()); + } + + if (angle == 0) { + printf("Due north; now rotating clockwise...\n"); + angleincr = 1; + } + + else if (angle == 360) { + printf("Due north; now rotating counter-clockwise...\n"); + angleincr = -1; + } + + distance += distincr; + + if (distance < 0) { + distance = 0; + distincr = 3; + printf("Distance is very, very near. Stepping away by threes...\n"); + } else if (distance > 255) { + distance = 255; + distincr = -3; + printf("Distance is very, very far. Stepping towards by threes...\n"); + } + + angle += angleincr; + next_position_update = SDL_GetTicks() + 30; + } +} +#endif + + +static void CleanUp(int exitcode) +{ + if ( wave ) { + Mix_FreeChunk(wave); + wave = NULL; + } + if ( audio_open ) { + Mix_CloseAudio(); + audio_open = 0; + } + SDL_Quit(); + + exit(exitcode); +} + + +static void Usage(char *argv0) +{ + fprintf(stderr, "Usage: %s [-8] [-r rate] [-c channels] [-f] [-F] [-l] [-m] \n", argv0); +} + + +/* + * rcg06182001 This is sick, but cool. + * + * Actually, it's meant to be an example of how to manipulate a voice + * without having to use the mixer effects API. This is more processing + * up front, but no extra during the mixing process. Also, in a case like + * this, when you need to touch the whole sample at once, it's the only + * option you've got. And, with the effects API, you are altering a copy of + * the original sample for each playback, and thus, your changes aren't + * permanent; here, you've got a reversed sample, and that's that until + * you either reverse it again, or reload it. + */ +static void flip_sample(Mix_Chunk *wave) +{ + Uint16 format; + int channels, i, incr; + Uint8 *start = wave->abuf; + Uint8 *end = wave->abuf + wave->alen; + + Mix_QuerySpec(NULL, &format, &channels); + incr = (format & 0xFF) * channels; + + end -= incr; + + switch (incr) { + case 8: + for (i = wave->alen / 2; i >= 0; i -= 1) { + Uint8 tmp = *start; + *start = *end; + *end = tmp; + start++; + end--; + } + break; + + case 16: + for (i = wave->alen / 2; i >= 0; i -= 2) { + Uint16 tmp = *start; + *((Uint16 *) start) = *((Uint16 *) end); + *((Uint16 *) end) = tmp; + start += 2; + end -= 2; + } + break; + + case 32: + for (i = wave->alen / 2; i >= 0; i -= 4) { + Uint32 tmp = *start; + *((Uint32 *) start) = *((Uint32 *) end); + *((Uint32 *) end) = tmp; + start += 4; + end -= 4; + } + break; + + default: + fprintf(stderr, "Unhandled format in sample flipping.\n"); + return; + } +} + + +int main(int argc, char *argv[]) +{ + int audio_rate; + Uint16 audio_format; + int audio_channels; + int loops = 0; + int i; + int reverse_stereo = 0; + int reverse_sample = 0; + +#ifdef HAVE_SETBUF + setbuf(stdout, NULL); /* rcg06132001 for debugging purposes. */ + setbuf(stderr, NULL); /* rcg06192001 for debugging purposes, too. */ +#endif + output_test_warnings(); + + /* Initialize variables */ + audio_rate = MIX_DEFAULT_FREQUENCY; + audio_format = MIX_DEFAULT_FORMAT; + audio_channels = 2; + + /* Check command line usage */ + for ( i=1; argv[i] && (*argv[i] == '-'); ++i ) { + if ( (strcmp(argv[i], "-r") == 0) && argv[i+1] ) { + ++i; + audio_rate = atoi(argv[i]); + } else + if ( strcmp(argv[i], "-m") == 0 ) { + audio_channels = 1; + } else + if ( (strcmp(argv[i], "-c") == 0) && argv[i+1] ) { + ++i; + audio_channels = atoi(argv[i]); + } else + if ( strcmp(argv[i], "-l") == 0 ) { + loops = -1; + } else + if ( strcmp(argv[i], "-8") == 0 ) { + audio_format = AUDIO_U8; + } else + if ( strcmp(argv[i], "-f") == 0 ) { /* rcg06122001 flip stereo */ + reverse_stereo = 1; + } else + if ( strcmp(argv[i], "-F") == 0 ) { /* rcg06172001 flip sample */ + reverse_sample = 1; + } else { + Usage(argv[0]); + return(1); + } + } + if ( ! argv[i] ) { + Usage(argv[0]); + return(1); + } + + /* Initialize the SDL library */ + if ( SDL_Init(SDL_INIT_AUDIO) < 0 ) { + fprintf(stderr, "Couldn't initialize SDL: %s\n",SDL_GetError()); + return(255); + } +#ifdef HAVE_SIGNAL_H + signal(SIGINT, CleanUp); + signal(SIGTERM, CleanUp); +#endif + + /* Open the audio device */ + if (Mix_OpenAudio(audio_rate, audio_format, audio_channels, 4096) < 0) { + fprintf(stderr, "Couldn't open audio: %s\n", SDL_GetError()); + CleanUp(2); + } else { + Mix_QuerySpec(&audio_rate, &audio_format, &audio_channels); + printf("Opened audio at %d Hz %d bit %s", audio_rate, + (audio_format&0xFF), + (audio_channels > 2) ? "surround" : + (audio_channels > 1) ? "stereo" : "mono"); + if ( loops ) { + printf(" (looping)\n"); + } else { + putchar('\n'); + } + } + audio_open = 1; + +#if (defined TEST_MIX_VERSIONS) + test_versions(); +#endif + +#if (defined TEST_MIX_DECODERS) + report_decoders(); +#endif + + /* Load the requested wave file */ + wave = Mix_LoadWAV(argv[i]); + if ( wave == NULL ) { + fprintf(stderr, "Couldn't load %s: %s\n", + argv[i], SDL_GetError()); + CleanUp(2); + } + + if (reverse_sample) { + flip_sample(wave); + } + +#ifdef TEST_MIX_CHANNELFINISHED /* rcg06072001 */ + Mix_ChannelFinished(channel_complete_callback); +#endif + + if ( (!Mix_SetReverseStereo(MIX_CHANNEL_POST, reverse_stereo)) && + (reverse_stereo) ) + { + printf("Failed to set up reverse stereo effect!\n"); + printf("Reason: [%s].\n", Mix_GetError()); + } + + /* Play and then exit */ + Mix_PlayChannel(0, wave, loops); + + while (still_playing()) { + +#if (defined TEST_MIX_PANNING) /* rcg06132001 */ + do_panning_update(); +#endif + +#if (defined TEST_MIX_DISTANCE) /* rcg06192001 */ + do_distance_update(); +#endif + +#if (defined TEST_MIX_POSITION) /* rcg06202001 */ + do_position_update(); +#endif + + SDL_Delay(1); + + } /* while still_playing() loop... */ + + CleanUp(0); + + /* Not reached, but fixes compiler warnings */ + return 0; +} + +/* end of playwave.c ... */ + diff --git a/apps/plugins/sdl/SDL_mixer/timidity/COPYING b/apps/plugins/sdl/SDL_mixer/timidity/COPYING new file mode 100644 index 0000000..cdbb291 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/COPYING @@ -0,0 +1,127 @@ + The "Artistic License" + + Preamble + +The intent of this document is to state the conditions under which a +Package may be copied, such that the Copyright Holder maintains some +semblance of artistic control over the development of the package, +while giving the users of the package the right to use and distribute +the Package in a more-or-less customary fashion, plus the right to make +reasonable modifications. + +Definitions: + + "Package" refers to the collection of files distributed by the + Copyright Holder, and derivatives of that collection of files + created through textual modification. + + "Standard Version" refers to such a Package if it has not been + modified, or has been modified in accordance with the wishes + of the Copyright Holder as specified below. + + "Copyright Holder" is whoever is named in the copyright or + copyrights for the package. + + "You" is you, if you're thinking about copying or distributing + this Package. + + "Reasonable copying fee" is whatever you can justify on the + basis of media cost, duplication charges, time of people involved, + and so on. (You will not be required to justify it to the + Copyright Holder, but only to the computing community at large + as a market that must bear the fee.) + + "Freely Available" means that no fee is charged for the item + itself, though there may be fees involved in handling the item. + It also means that recipients of the item may redistribute it + under the same conditions they received it. + +1. You may make and give away verbatim copies of the source form of the +Standard Version of this Package without restriction, provided that you +duplicate all of the original copyright notices and associated disclaimers. + +2. You may apply bug fixes, portability fixes and other modifications +derived from the Public Domain or from the Copyright Holder. A Package +modified in such a way shall still be considered the Standard Version. + +3. You may otherwise modify your copy of this Package in any way, provided +that you insert a prominent notice in each changed file stating how and +when you changed that file, and provided that you do at least ONE of the +following: + + a) place your modifications in the Public Domain or otherwise make them + Freely Available, such as by posting said modifications to Usenet or + an equivalent medium, or placing the modifications on a major archive + site such as uunet.uu.net, or by allowing the Copyright Holder to include + your modifications in the Standard Version of the Package. + + b) use the modified Package only within your corporation or organization. + + c) rename any non-standard executables so the names do not conflict + with standard executables, which must also be provided, and provide + a separate manual page for each non-standard executable that clearly + documents how it differs from the Standard Version. + + d) make other distribution arrangements with the Copyright Holder. + +4. You may distribute the programs of this Package in object code or +executable form, provided that you do at least ONE of the following: + + a) distribute a Standard Version of the executables and library files, + together with instructions (in the manual page or equivalent) on where + to get the Standard Version. + + b) accompany the distribution with the machine-readable source of + the Package with your modifications. + + c) give non-standard executables non-standard names, and clearly + document the differences in manual pages (or equivalent), together + with instructions on where to get the Standard Version. + + d) make other distribution arrangements with the Copyright Holder. + +5. You may charge a reasonable copying fee for any distribution of this +Package. You may charge any fee you choose for support of this +Package. You may not charge a fee for this Package itself. However, +you may distribute this Package in aggregate with other (possibly +commercial) programs as part of a larger (possibly commercial) software +distribution provided that you do not advertise this Package as a +product of your own. You may embed this Package's interpreter within +an executable of yours (by linking); this shall be construed as a mere +form of aggregation, provided that the complete Standard Version of the +interpreter is so embedded. + +6. The scripts and library files supplied as input to or produced as +output from the programs of this Package do not automatically fall +under the copyright of this Package, but belong to whoever generated +them, and may be sold commercially, and may be aggregated with this +Package. If such scripts or library files are aggregated with this +Package via the so-called "undump" or "unexec" methods of producing a +binary executable image, then distribution of such an image shall +neither be construed as a distribution of this Package nor shall it +fall under the restrictions of Paragraphs 3 and 4, provided that you do +not represent such an executable image as a Standard Version of this +Package. + +7. C subroutines (or comparably compiled subroutines in other +languages) supplied by you and linked into this Package in order to +emulate subroutines and variables of the language defined by this +Package shall not be considered part of this Package, but are the +equivalent of input as in Paragraph 6, provided these subroutines do +not change the language in any way that would cause it to fail the +regression tests for the language. + +8. Aggregation of this Package with a commercial distribution is always +permitted provided that the use of this Package is embedded; that is, +when no overt attempt is made to make this Package's interfaces visible +to the end user of the commercial distribution. Such use shall not be +construed as a distribution of this Package. + +9. The name of the Copyright Holder may not be used to endorse or promote +products derived from this software without specific prior written permission. + +10. THIS PACKAGE IS PROVIDED "AS IS" AND WITHOUT ANY EXPRESS OR +IMPLIED WARRANTIES, INCLUDING, WITHOUT LIMITATION, THE IMPLIED +WARRANTIES OF MERCHANTIBILITY AND FITNESS FOR A PARTICULAR PURPOSE. + + The End diff --git a/apps/plugins/sdl/SDL_mixer/timidity/FAQ b/apps/plugins/sdl/SDL_mixer/timidity/FAQ new file mode 100644 index 0000000..f1f8e23 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/FAQ @@ -0,0 +1,112 @@ +---------------------------*-indented-text-*------------------------------ + + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + +-------------------------------------------------------------------------- + + Frequently Asked Questions with answers: + +-------------------------------------------------------------------------- +Q: What is it? + +A: Where? Well Chris, TiMidity is a software-only synthesizer, MIDI + renderer, MIDI to WAVE converter, realtime MIDI player for UNIX machines, + even (I've heard) a Netscape helper application. It takes a MIDI file + and writes a WAVE or raw PCM data or plays it on your digital audio + device. It sounds much more realistic than FM synthesis, but you need a + ~100Mhz processor to listen to 32kHz stereo music in the background while + you work. 11kHz mono can be played on a low-end 486, and, to some, it + still sounds better than FM. + +-------------------------------------------------------------------------- +Q: I don't have a GUS, can I use TiMidity? + +A: Yes. That's the point. You don't need a Gravis Ultrasound to use + TiMidity, you just need GUS-compatible patches, which are freely + available on the Internet. See below for pointers. + +-------------------------------------------------------------------------- +Q: I have a GUS, can I use TiMidity? + +A: The DOS port doesn't have GUS support, and TiMidity won't be taking + advantage of the board's internal synthesizer under other operating + systems either. So it kind of defeats the purpose. But you can use it. + +-------------------------------------------------------------------------- +Q: I tried playing a MIDI file I got off the Net but all I got was a + dozen warnings saying "No instrument mapped to tone bank 0, program + xx - this instrument will not be heard". What's wrong? + +A: The General MIDI standard specifies 128 melodic instruments and + some sixty percussion sounds. If you wish to play arbitrary General + MIDI files, you'll need to get more patch files. + + There's a program called Midia for SGI's, which also plays MIDI + files and has a lot more bells and whistles than TiMidity. It uses + GUS-compatible patches, too -- so you can get the 8 MB set at + ftp://archive.cs.umbc.edu/pub/midia for pretty good GM compatibility. + + There are also many excellent patches on the Ultrasound FTP sites. + I can recommend Dustin McCartney's collections gsdrum*.zip and + wow*.zip in the "[.../]sound/patches/files" directory. The huge + ProPats series (pp3-*.zip) contains good patches as well. General + MIDI files can also be found on these sites. + + This site list is from the GUS FAQ: + +> FTP Sites Archive Directories +> --------- ------------------- +> Main N.American Site: archive.orst.edu pub/packages/gravis +> wuarchive.wustl.edu systems/ibmpc/ultrasound +> Main Asian Site: nctuccca.edu.tw PC/ultrasound +> Main European Site: src.doc.ic.ac.uk packages/ultrasound +> Main Australian Site: ftp.mpx.com.au /ultrasound/general +> /ultrasound/submit +> South African Site: ftp.sun.ac.za /pub/packages/ultrasound +> Submissions: archive.epas.utoronto.ca pub/pc/ultrasound/submit +> Newly Validated Files: archive.epas.utoronto.ca pub/pc/ultrasound +> +> Mirrors: garbo.uwasa.fi mirror/ultrasound +> ftp.st.nepean.uws.edu.au pc/ultrasound +> ftp.luth.se pub/msdos/ultrasound + +-------------------------------------------------------------------------- +Q: Some files have awful clicks and pops. + +A: Find out which patch is responsible for the clicking (try "timidity + -P ". Add "strip=tail" in + the config file after its name. If this doesn't fix it, mail me the + patch. + +-------------------------------------------------------------------------- +Q: I'm playing Fantasie Impromptu in the background. When I run Netscape, + the sound gets choppy and it takes ten minutes to load. What can I do? + +A: Here are some things to try: + + - Use a lower sampling rate. + + - Use mono output. This can improve performance by 10-30%. + (Using 8-bit instead of 16-bit output makes no difference.) + + - Use a smaller number of simultaneous voices. + + - Make sure you compiled with FAST_DECAY and PRECALC_LOOPS enabled + in config.h + + - If you don't have hardware to compute sines, recompile with + LOOKUP_SINE enabled in config.h + + - Recompile with LOOKUP_HACK enabled in config.h. + + - Recompile with LINEAR_INTERPOLATION disabled in config.h. + + - Recompile with DANGEROUS_RENICE enabled in config.h, and make + TiMidity setuid root. This will help only if you frequently play + music while other processes are running. + + - Recompile with an Intel-optimized gcc for a 5-15% + performance increase. + +-------------------------------------------------------------------------- diff --git a/apps/plugins/sdl/SDL_mixer/timidity/README b/apps/plugins/sdl/SDL_mixer/timidity/README new file mode 100644 index 0000000..e0882f3 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/README @@ -0,0 +1,57 @@ +[This version of timidity has been stripped for simplicity in porting to SDL] +---------------------------------*-text-*--------------------------------- + + From http://www.cgs.fi/~tt/discontinued.html : + + If you'd like to continue hacking on TiMidity, feel free. I'm + hereby extending the TiMidity license agreement: you can now + select the most convenient license for your needs from (1) the + GNU GPL, (2) the GNU LGPL, or (3) the Perl Artistic License. + +-------------------------------------------------------------------------- + + This is the README file for TiMidity v0.2i + + TiMidity is a MIDI to WAVE converter that uses Gravis +Ultrasound(*)-compatible patch files to generate digital audio data +from General MIDI files. The audio data can be played through any +sound device or stored on disk. On a fast machine, music can be +played in real time. TiMidity runs under Linux, FreeBSD, HP-UX, SunOS, and +Win32, and porting to other systems with gcc should be easy. + + TiMidity Features: + + * 32 or more dynamically allocated fully independent voices + * Compatibility with GUS patch files + * Output to 16- or 8-bit PCM or uLaw audio device, file, or + stdout at any sampling rate + * Optional interactive mode with real-time status display + under ncurses and SLang terminal control libraries. Also + a user friendly motif interface since version 0.2h + * Support for transparent loading of compressed MIDI files and + patch files + + * Support for the following MIDI events: + - Program change + - Key pressure + - Channel main volume + - Tempo + - Panning + - Damper pedal (Sustain) + - Pitch wheel + - Pitch wheel sensitivity + - Change drum set + +* TiMidity requires sampled instruments (patches) to play MIDI files. You + should get the file "timidity-lib-0.1.tar.gz" and unpack it in the same + directory where you unpacked the source code archive. You'll want more + patches later -- read the file "FAQ" for pointers. + +* Timidity is no longer supported, but can be found by searching the web. + + + Tuukka Toivonen + +[(*) Any Registered Trademarks used anywhere in the documentation or +source code for TiMidity are acknowledged as belonging to their +respective owners.] diff --git a/apps/plugins/sdl/SDL_mixer/timidity/common.c b/apps/plugins/sdl/SDL_mixer/timidity/common.c new file mode 100644 index 0000000..bc284e6 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/common.c @@ -0,0 +1,238 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "common.h" +#include "output.h" +#include "ctrlmode.h" + +/* I guess "rb" should be right for any libc */ +#define OPEN_MODE "rb" + +char current_filename[PATH_MAX]; + +static PathList *pathlist=NULL; + +/* Try to open a file for reading. If the filename ends in one of the + defined compressor extensions, pipe the file through the decompressor */ +static FILE *try_to_open(const char *name, int decompress, int noise_mode) +{ + FILE *fp; + + fp=fopen(name, OPEN_MODE); /* First just check that the file exists */ + + if (!fp) + return 0; + +#ifdef DECOMPRESSOR_LIST + if (decompress) + { + int l,el; + static char *decompressor_list[] = DECOMPRESSOR_LIST, **dec; + const char *cp; + char tmp[PATH_MAX], tmp2[PATH_MAX], *cp2; + /* Check if it's a compressed file */ + l=strlen(name); + for (dec=decompressor_list; *dec; dec+=2) + { + el=strlen(*dec); + if ((el>=l) || (strcmp(name+l-el, *dec))) + continue; + + /* Yes. Close the file, open a pipe instead. */ + fclose(fp); + + /* Quote some special characters in the file name */ + cp=name; + cp2=tmp2; + while (*cp) + { + switch(*cp) + { + case '\'': + case '\\': + case ' ': + case '`': + case '!': + case '"': + case '&': + case ';': + *cp2++='\\'; + } + *cp2++=*cp++; + } + *cp2=0; + + sprintf(tmp, *(dec+1), tmp2); + fp=popen(tmp, "r"); + break; + } + } +#endif + + return fp; +} + +/* This is meant to find and open files for reading, possibly piping + them through a decompressor. */ +FILE *open_file(const char *name, int decompress, int noise_mode) +{ + FILE *fp; + PathList *plp; + int l; + + if (!name || !(*name)) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "Attempted to open nameless file."); + return 0; + } + + if (pathlist==NULL) { + /* Generate path list */ +#ifdef DEFAULT_PATH + add_to_pathlist(DEFAULT_PATH); +#endif +#ifdef DEFAULT_PATH1 + add_to_pathlist(DEFAULT_PATH1); +#endif +#ifdef DEFAULT_PATH2 + add_to_pathlist(DEFAULT_PATH2); +#endif +#ifdef DEFAULT_PATH3 + add_to_pathlist(DEFAULT_PATH3); +#endif + } + + /* First try the given name */ + + strncpy(current_filename, name, PATH_MAX - 1); + current_filename[PATH_MAX - 1]='\0'; + + ctl->cmsg(CMSG_INFO, VERB_DEBUG, "Trying to open %s", current_filename); + if ((fp=try_to_open(current_filename, decompress, noise_mode))) + return fp; + +#ifdef ENOENT + if (noise_mode && (errno != ENOENT)) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: %s", + current_filename, strerror(errno)); + return 0; + } +#endif + + plp=pathlist; + if (name[0] != PATH_SEP) + while (plp) /* Try along the path then */ + { + *current_filename=0; + l=strlen(plp->path); + if(l) + { + strcpy(current_filename, plp->path); + if(current_filename[l-1]!=PATH_SEP) + strcat(current_filename, PATH_STRING); + } + strcat(current_filename, name); + ctl->cmsg(CMSG_INFO, VERB_DEBUG, "Trying to open %s", current_filename); + if ((fp=try_to_open(current_filename, decompress, noise_mode))) + return fp; +#ifdef ENOENT + if (noise_mode && (errno != ENOENT)) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: %s", + current_filename, strerror(errno)); + return 0; + } +#endif + plp=plp->next; + } + + /* Nothing could be opened. */ + + *current_filename=0; + + if (noise_mode>=2) + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: %s", name, strerror(errno)); + + return 0; +} + +/* This closes files opened with open_file */ +void close_file(FILE *fp) +{ +#ifdef DECOMPRESSOR_LIST + if (pclose(fp)) /* Any better ideas? */ +#endif + fclose(fp); + + strncpy(current_filename, "MIDI file", PATH_MAX - 1); +} + +/* This is meant for skipping a few bytes in a file or fifo. */ +void skip(FILE *fp, size_t len) +{ + size_t c; + char tmp[PATH_MAX]; + while (len>0) + { + c=len; + if (c>PATH_MAX) c=PATH_MAX; + len-=c; + if (c!=fread(tmp, 1, c, fp)) + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: skip: %s", + current_filename, strerror(errno)); + } +} + +/* This'll allocate memory or die. */ +void *safe_malloc(size_t count) +{ + void *p; + if (count > (1<<21)) + { + ctl->cmsg(CMSG_FATAL, VERB_NORMAL, + "Strange, I feel like allocating %d bytes. This must be a bug.", + count); + } + else if ((p=malloc(count))) + return p; + else + ctl->cmsg(CMSG_FATAL, VERB_NORMAL, "Sorry. Couldn't malloc %d bytes.", count); + + ctl->close(); + exit(10); + return(NULL); +} + +/* This adds a directory to the path list */ +void add_to_pathlist(const char *s) +{ + PathList *plp=safe_malloc(sizeof(PathList)); + strcpy((plp->path=safe_malloc(strlen(s)+1)),s); + plp->next=pathlist; + pathlist=plp; +} + +/* Free memory associated to path list */ +void free_pathlist(void) +{ + PathList *plp, *next_plp; + + plp = pathlist; + while (plp) { + if (plp->path) { + free(plp->path); + plp->path=NULL; + } + next_plp = plp->next; + free(plp); + plp = next_plp; + } + pathlist = NULL; +} diff --git a/apps/plugins/sdl/SDL_mixer/timidity/common.h b/apps/plugins/sdl/SDL_mixer/timidity/common.h new file mode 100644 index 0000000..8d9c0ec --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/common.h @@ -0,0 +1,39 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include + +#ifndef PATH_MAX /* GNU Hurd doesn't limit path size, thus no PATH_MAX... */ +#define PATH_MAX 1024 /* ...so we'll just impose an arbitrary limit. */ +#endif + +extern char *program_name, current_filename[]; + +extern FILE *msgfp; + +extern int num_ochannels; + +#define MULTICHANNEL_OUT +#define MAX_OUT_CHANNELS 6 + +typedef struct { + char *path; + void *next; +} PathList; + +/* Noise modes for open_file */ +#define OF_SILENT 0 +#define OF_NORMAL 1 +#define OF_VERBOSE 2 + +extern FILE *open_file(const char *name, int decompress, int noise_mode); +extern void add_to_pathlist(const char *s); +extern void free_pathlist(void); +extern void close_file(FILE *fp); +extern void skip(FILE *fp, size_t len); +extern void *safe_malloc(size_t count); diff --git a/apps/plugins/sdl/SDL_mixer/timidity/config.h b/apps/plugins/sdl/SDL_mixer/timidity/config.h new file mode 100644 index 0000000..46f1aa9 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/config.h @@ -0,0 +1,229 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +/* This is for use with the SDL library */ +#ifndef __TIMIDITY_CONFIG_H__ +#define __TIMIDITY_CONFIG_H__ +#define SDL +#include "SDL_config.h" +#include "SDL_endian.h" + +#define TIMIDITY_ERROR_SIZE 1024 + +/* When a patch file can't be opened, one of these extensions is + appended to the filename and the open is tried again. + */ +#define PATCH_EXT_LIST { ".pat", 0 } + +/* Acoustic Grand Piano seems to be the usual default instrument. */ +#define DEFAULT_PROGRAM 0 + +/* 9 here is MIDI channel 10, which is the standard percussion channel. + Some files (notably C:\WINDOWS\CANYON.MID) think that 16 is one too. + On the other hand, some files know that 16 is not a drum channel and + try to play music on it. This is now a runtime option, so this isn't + a critical choice anymore. */ +#define DEFAULT_DRUMCHANNELS (1<<9) + +/* A somewhat arbitrary frequency range. The low end of this will + sound terrible as no lowpass filtering is performed on most + instruments before resampling. */ +#define MIN_OUTPUT_RATE 4000 +#define MAX_OUTPUT_RATE 65000 + +/* In percent. */ +/* #define DEFAULT_AMPLIFICATION 70 */ +/* #define DEFAULT_AMPLIFICATION 50 */ +#define DEFAULT_AMPLIFICATION 30 + +/* Default sampling rate, default polyphony, and maximum polyphony. + All but the last can be overridden from the command line. */ +#define DEFAULT_RATE 32000 +/* #define DEFAULT_VOICES 32 */ +/* #define MAX_VOICES 48 */ +#define DEFAULT_VOICES 256 +#define MAX_VOICES 256 +#define MAXCHAN 16 +/* #define MAXCHAN 64 */ +#define MAXNOTE 128 + +/* 1000 here will give a control ratio of 22:1 with 22 kHz output. + Higher CONTROLS_PER_SECOND values allow more accurate rendering + of envelopes and tremolo. The cost is CPU time. */ +#define CONTROLS_PER_SECOND 1000 + +/* Strongly recommended. This option increases CPU usage by half, but + without it sound quality is very poor. */ +#define LINEAR_INTERPOLATION + +/* This is an experimental kludge that needs to be done right, but if + you've got an 8-bit sound card, or cheap multimedia speakers hooked + to your 16-bit output device, you should definitely give it a try. + + Defining LOOKUP_HACK causes table lookups to be used in mixing + instead of multiplication. We convert the sample data to 8 bits at + load time and volumes to logarithmic 7-bit values before looking up + the product, which degrades sound quality noticeably. + + Defining LOOKUP_HACK should save ~20% of CPU on an Intel machine. + LOOKUP_INTERPOLATION might give another ~5% */ +/* #define LOOKUP_HACK + #define LOOKUP_INTERPOLATION */ + +/* Make envelopes twice as fast. Saves ~20% CPU time (notes decay + faster) and sounds more like a GUS. There is now a command line + option to toggle this as well. */ +/* #define FAST_DECAY */ + +/* How many bits to use for the fractional part of sample positions. + This affects tonal accuracy. The entire position counter must fit + in 32 bits, so with FRACTION_BITS equal to 12, the maximum size of + a sample is 1048576 samples (2 megabytes in memory). The GUS gets + by with just 9 bits and a little help from its friends... + "The GUS does not SUCK!!!" -- a happy user :) */ +#define FRACTION_BITS 12 + +#define MAX_SAMPLE_SIZE (1 << (32-FRACTION_BITS)) + +typedef double FLOAT_T; + +/* For some reason the sample volume is always set to maximum in all + patch files. Define this for a crude adjustment that may help + equalize instrument volumes. */ +#define ADJUST_SAMPLE_VOLUMES + +/* The number of samples to use for ramping out a dying note. Affects + click removal. */ +#define MAX_DIE_TIME 20 + +/* On some machines (especially PCs without math coprocessors), + looking up sine values in a table will be significantly faster than + computing them on the fly. Uncomment this to use lookups. */ +/* #define LOOKUP_SINE */ + +/* Shawn McHorse's resampling optimizations. These may not in fact be + faster on your particular machine and compiler. You'll have to run + a benchmark to find out. */ +#define PRECALC_LOOPS + +/* If calling ldexp() is faster than a floating point multiplication + on your machine/compiler/libm, uncomment this. It doesn't make much + difference either way, but hey -- it was on the TODO list, so it + got done. */ +/* #define USE_LDEXP */ + +/**************************************************************************/ +/* Anything below this shouldn't need to be changed unless you're porting + to a new machine with other than 32-bit, big-endian words. */ +/**************************************************************************/ + +/* change FRACTION_BITS above, not these */ +#define INTEGER_BITS (32 - FRACTION_BITS) +#define INTEGER_MASK (0xFFFFFFFF << FRACTION_BITS) +#define FRACTION_MASK (~ INTEGER_MASK) + +/* This is enforced by some computations that must fit in an int */ +#define MAX_CONTROL_RATIO 255 + +typedef unsigned int uint32; +typedef int int32; +typedef unsigned short uint16; +typedef short int16; +typedef unsigned char uint8; +typedef char int8; + +/* Instrument files are little-endian, MIDI files big-endian, so we + need to do some conversions. */ + +#define XCHG_SHORT(x) ((((x)&0xFF)<<8) | (((x)>>8)&0xFF)) +# define XCHG_LONG(x) ((((x)&0xFF)<<24) | \ + (((x)&0xFF00)<<8) | \ + (((x)&0xFF0000)>>8) | \ + (((x)>>24)&0xFF)) + +#if SDL_BYTEORDER == SDL_LIL_ENDIAN +#define LE_SHORT(x) x +#define LE_LONG(x) x +#define BE_SHORT(x) XCHG_SHORT(x) +#define BE_LONG(x) XCHG_LONG(x) +#else +#define BE_SHORT(x) x +#define BE_LONG(x) x +#define LE_SHORT(x) XCHG_SHORT(x) +#define LE_LONG(x) XCHG_LONG(x) +#endif + +#define MAX_AMPLIFICATION 800 + +/* You could specify a complete path, e.g. "/etc/timidity.cfg", and + then specify the library directory in the configuration file. */ +#define CONFIG_FILE "/.rockbox/timidity/timidity.cfg" +#define CONFIG_FILE_ETC "/.rockbox/timidity/timidity.cfg" + +#if defined(__WIN32__) || defined(__OS2__) +#define DEFAULT_PATH "C:\\TIMIDITY" +#else +#define DEFAULT_PATH "/.rockbox/patchset" +#define DEFAULT_PATH1 "/.rockbox/duke3d" +#define DEFAULT_PATH2 "/.rockbox/timidity" +#define DEFAULT_PATH3 "/.rockbox/midi" +#endif + +/* These affect general volume */ +#define GUARD_BITS 3 +#define AMP_BITS (15-GUARD_BITS) + +#ifdef LOOKUP_HACK + typedef int8 sample_t; + typedef uint8 final_volume_t; +# define FINAL_VOLUME(v) (~_l2u[v]) +# define MIXUP_SHIFT 5 +# define MAX_AMP_VALUE 4095 +#else + typedef int16 sample_t; + typedef int32 final_volume_t; +# define FINAL_VOLUME(v) (v) +# define MAX_AMP_VALUE ((1<<(AMP_BITS+1))-1) +#endif + +typedef int16 resample_t; + +#ifdef USE_LDEXP +# define FSCALE(a,b) ldexp((a),(b)) +# define FSCALENEG(a,b) ldexp((a),-(b)) +#else +# define FSCALE(a,b) (float)((a) * (double)(1<<(b))) +# define FSCALENEG(a,b) (float)((a) * (1.0L / (double)(1<<(b)))) +#endif + +/* Vibrato and tremolo Choices of the Day */ +#define SWEEP_TUNING 38 +#define VIBRATO_AMPLITUDE_TUNING 1.0L +#define VIBRATO_RATE_TUNING 38 +#define TREMOLO_AMPLITUDE_TUNING 1.0L +#define TREMOLO_RATE_TUNING 38 + +#define SWEEP_SHIFT 16 +#define RATE_SHIFT 5 + +#define VIBRATO_SAMPLE_INCREMENTS 32 + +#ifndef PI + #define PI 3.14159265358979323846 +#endif + +/* The path separator (D.M.) */ +#if defined(__WIN32__) || defined(__OS2__) +# define PATH_SEP '\\' +# define PATH_STRING "\\" +#else +# define PATH_SEP '/' +# define PATH_STRING "/" +#endif + +#endif diff --git a/apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.c b/apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.c new file mode 100644 index 0000000..facaa0b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.c @@ -0,0 +1,26 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "ctrlmode.h" + +#ifdef SDL + extern ControlMode sdl_control_mode; +# ifndef DEFAULT_CONTROL_MODE +# define DEFAULT_CONTROL_MODE &sdl_control_mode +# endif +#endif + +ControlMode *ctl_list[]={ +#ifdef SDL + &sdl_control_mode, +#endif + 0 +}; + +ControlMode *ctl=DEFAULT_CONTROL_MODE; diff --git a/apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.h b/apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.h new file mode 100644 index 0000000..5a116bc --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/ctrlmode.h @@ -0,0 +1,74 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +/* Return values for ControlMode.read */ + +#define RC_ERROR -1 +#define RC_NONE 0 +#define RC_QUIT 1 +#define RC_NEXT 2 +#define RC_PREVIOUS 3 /* Restart this song at beginning, or the previous + song if we're less than a second into this one. */ +#define RC_FORWARD 4 +#define RC_BACK 5 +#define RC_JUMP 6 +#define RC_TOGGLE_PAUSE 7 /* Pause/continue */ +#define RC_RESTART 8 /* Restart song at beginning */ + +#define RC_PAUSE 9 /* Really pause playing */ +#define RC_CONTINUE 10 /* Continue if paused */ +#define RC_REALLY_PREVIOUS 11 /* Really go to the previous song */ +#define RC_CHANGE_VOLUME 12 +#define RC_LOAD_FILE 13 /* Load a new midifile */ +#define RC_TUNE_END 14 /* The tune is over, play it again sam? */ + +#define CMSG_INFO 0 +#define CMSG_WARNING 1 +#define CMSG_ERROR 2 +#define CMSG_FATAL 3 +#define CMSG_TRACE 4 +#define CMSG_TIME 5 +#define CMSG_TOTAL 6 +#define CMSG_FILE 7 +#define CMSG_TEXT 8 + +#define VERB_NORMAL 0 +#define VERB_VERBOSE 1 +#define VERB_NOISY 2 +#define VERB_DEBUG 3 +#define VERB_DEBUG_SILLY 4 + +typedef struct { + char *id_name, id_character; + int verbosity, trace_playing, opened; + + int (*open)(int using_stdin, int using_stdout); + void (*pass_playing_list)(int number_of_files, char *list_of_files[]); + void (*close)(void); + int (*read)(int32 *valp); + int (*cmsg)(int type, int verbosity_level, char *fmt, ...); + + void (*refresh)(void); + void (*reset)(void); + void (*file_name)(char *name); + void (*total_time)(int tt); + void (*current_time)(int ct); + + void (*note)(int v); + void (*master_volume)(int mv); + void (*program)(int channel, int val); /* val<0 means drum set -val */ + void (*volume)(int channel, int val); + void (*expression)(int channel, int val); + void (*panning)(int channel, int val); + void (*sustain)(int channel, int val); + void (*pitch_bend)(int channel, int val); + +} ControlMode; + +extern ControlMode *ctl_list[], *ctl; +extern char timidity_error[]; diff --git a/apps/plugins/sdl/SDL_mixer/timidity/filter.c b/apps/plugins/sdl/SDL_mixer/timidity/filter.c new file mode 100644 index 0000000..e93cc6b --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/filter.c @@ -0,0 +1,187 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + + filter.c: written by Vincent Pagel ( pagel@loria.fr ) + + implements fir antialiasing filter : should help when setting sample + rates as low as 8Khz. + + April 95 + - first draft + + 22/5/95 + - modify "filter" so that it simulate leading and trailing 0 in the buffer + */ + +#include "config.h" +#include "common.h" +#include "ctrlmode.h" +#include "instrum.h" +#include "filter.h" + +/* bessel function */ +static float ino(float x) +{ + float y, de, e, sde; + int i; + + y = x / 2; + e = 1.0; + de = 1.0; + i = 1; + do { + de = de * y / (float) i; + sde = de * de; + e += sde; + } while (!( (e * 1.0e-08 - sde > 0) || (i++ > 25) )); + return(e); +} + +/* Kaiser Window (symetric) */ +static void kaiser(float *w,int n,float beta) +{ + float xind, xi; + int i; + + xind = (float)((2*n - 1) * (2*n - 1)); + for (i =0; i apply the filter given by coef[] to the data buffer + * Note that we simulate leading and trailing 0 at the border of the + * data buffer + */ +static void filter(sample_t *result,sample_t *data, int32 length,float coef[]) +{ + int32 sample,i,sample_window; + int16 peak = 0; + float sum; + + /* Simulate leading 0 at the begining of the buffer */ + for (sample = 0; sample < ORDER2 ; sample++ ) + { + sum = 0.0; + sample_window= sample - ORDER2; + + for (i = 0; i < ORDER ;i++) + sum += (float)(coef[i] * + ((sample_window<0)? 0.0 : data[sample_window++])) ; + + /* Saturation ??? */ + if (sum> 32767.) { sum=32767.; peak++; } + if (sum< -32768.) { sum=-32768; peak++; } + result[sample] = (sample_t) sum; + } + + /* The core of the buffer */ + for (sample = ORDER2; sample < length - ORDER + ORDER2 ; sample++ ) + { + sum = 0.0; + sample_window= sample - ORDER2; + + for (i = 0; i < ORDER ;i++) + sum += data[sample_window++] * coef[i]; + + /* Saturation ??? */ + if (sum> 32767.) { sum=32767.; peak++; } + if (sum< -32768.) { sum=-32768; peak++; } + result[sample] = (sample_t) sum; + } + + /* Simulate 0 at the end of the buffer */ + for (sample = length - ORDER + ORDER2; sample < length ; sample++ ) + { + sum = 0.0; + sample_window= sample - ORDER2; + + for (i = 0; i < ORDER ;i++) + sum += (float)(coef[i] * + ((sample_window>=length)? 0.0 : data[sample_window++])) ; + + /* Saturation ??? */ + if (sum> 32767.) { sum=32767.; peak++; } + if (sum< -32768.) { sum=-32768; peak++; } + result[sample] = (sample_t) sum; + } + + if (peak) + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Saturation %2.3f %%.", 100.0*peak/ (float) length); +} + +/***********************************************************************/ +/* Prevent aliasing by filtering any freq above the output_rate */ +/* */ +/* I don't worry about looping point -> they will remain soft if they */ +/* were already */ +/***********************************************************************/ +void antialiasing(Sample *sp, int32 output_rate ) +{ + sample_t *temp; + int i; + float fir_symetric[ORDER]; + float fir_coef[ORDER2]; + float freq_cut; /* cutoff frequency [0..1.0] FREQ_CUT/SAMP_FREQ*/ + + + ctl->cmsg(CMSG_INFO, VERB_NOISY, "Antialiasing: Fsample=%iKHz", + sp->sample_rate); + + /* No oversampling */ + if (output_rate>=sp->sample_rate) + return; + + freq_cut= (float) output_rate / (float) sp->sample_rate; + ctl->cmsg(CMSG_INFO, VERB_NOISY, "Antialiasing: cutoff=%f%%", + freq_cut*100.); + + designfir(fir_coef,freq_cut); + + /* Make the filter symetric */ + for (i = 0 ; idata_length); + memcpy(temp,sp->data,sp->data_length); + + filter(sp->data,temp,sp->data_length/sizeof(sample_t),fir_symetric); + + free(temp); +} diff --git a/apps/plugins/sdl/SDL_mixer/timidity/filter.h b/apps/plugins/sdl/SDL_mixer/timidity/filter.h new file mode 100644 index 0000000..7913337 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/filter.h @@ -0,0 +1,23 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + + filter.h : written by Vincent Pagel ( pagel@loria.fr ) + + implements fir antialiasing filter : should help when setting sample + rates as low as 8Khz. + + */ + +/* Order of the FIR filter = 20 should be enough ! */ +#define ORDER 20 +#define ORDER2 ORDER/2 + +#ifndef PI +#define PI 3.14159265 +#endif + +extern void antialiasing(Sample *sp, int32 output_rate); diff --git a/apps/plugins/sdl/SDL_mixer/timidity/instrum.c b/apps/plugins/sdl/SDL_mixer/timidity/instrum.c new file mode 100644 index 0000000..c480ec1 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/instrum.c @@ -0,0 +1,1018 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "common.h" +#include "instrum.h" +#include "playmidi.h" +#include "output.h" +#include "ctrlmode.h" +#include "resample.h" +#include "tables.h" +#include "filter.h" + +/* Some functions get aggravated if not even the standard banks are + available. */ +static ToneBank standard_tonebank, standard_drumset; +ToneBank + *tonebank[MAXBANK]={&standard_tonebank}, + *drumset[MAXBANK]={&standard_drumset}; + +/* This is a special instrument, used for all melodic programs */ +InstrumentLayer *default_instrument=0; + +/* This is only used for tracks that don't specify a program */ +int default_program=DEFAULT_PROGRAM; + +int antialiasing_allowed=0; +#ifdef FAST_DECAY +int fast_decay=1; +#else +int fast_decay=0; +#endif + + +int current_tune_number = 0; +int last_tune_purged = 0; +int current_patch_memory = 0; +int max_patch_memory = 60000000; + +static void purge_as_required(void); + +static void free_instrument(Instrument *ip) +{ + Sample *sp; + int i; + if (!ip) return; + + if (!ip->contents) + for (i=0; isamples; i++) + { + sp=&(ip->sample[i]); + if (sp->data) free(sp->data); + } + free(ip->sample); + + if (!ip->contents) + for (i=0; iright_samples; i++) + { + sp=&(ip->right_sample[i]); + if (sp->data) free(sp->data); + } + if (ip->right_sample) + free(ip->right_sample); + free(ip); +} + + +static void free_layer(InstrumentLayer *lp) +{ + InstrumentLayer *next; + + current_patch_memory -= lp->size; + + for (; lp; lp = next) + { + next = lp->next; + free_instrument(lp->instrument); + free(lp); + } +} + +static void free_bank(int dr, int b) +{ + int i; + ToneBank *bank=((dr) ? drumset[b] : tonebank[b]); + for (i=0; itone[i].layer) + { + /* Not that this could ever happen, of course */ + if (bank->tone[i].layer != MAGIC_LOAD_INSTRUMENT) + { + free_layer(bank->tone[i].layer); + bank->tone[i].layer=NULL; + bank->tone[i].last_used=-1; + } + } + if (bank->tone[i].name) + { + free(bank->tone[i].name); + bank->tone[i].name = NULL; + } + } +} + + +static void free_old_bank(int dr, int b, int how_old) +{ + int i; + ToneBank *bank=((dr) ? drumset[b] : tonebank[b]); + for (i=0; itone[i].layer && bank->tone[i].last_used < how_old) + { + if (bank->tone[i].layer != MAGIC_LOAD_INSTRUMENT) + { + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + "Unloading %s %s[%d,%d] - last used %d.", + (dr)? "drum" : "inst", bank->tone[i].name, + i, b, bank->tone[i].last_used); + free_layer(bank->tone[i].layer); + bank->tone[i].layer=NULL; + bank->tone[i].last_used=-1; + } + } +} + + +int32 convert_envelope_rate_attack(uint8 rate, uint8 fastness) +{ + int32 r; + + r=3-((rate>>6) & 0x3); + r*=3; + r = (int32)(rate & 0x3f) << r; /* 6.9 fixed point */ + + /* 15.15 fixed point. */ + return (((r * 44100) / play_mode->rate) * control_ratio) + << 10; +} + +int32 convert_envelope_rate(uint8 rate) +{ + int32 r; + + r=3-((rate>>6) & 0x3); + r*=3; + r = (int32)(rate & 0x3f) << r; /* 6.9 fixed point */ + + /* 15.15 fixed point. */ + return (((r * 44100) / play_mode->rate) * control_ratio) + << ((fast_decay) ? 10 : 9); +} + +int32 convert_envelope_offset(uint8 offset) +{ + /* This is not too good... Can anyone tell me what these values mean? + Are they GUS-style "exponential" volumes? And what does that mean? */ + + /* 15.15 fixed point */ + return offset << (7+15); +} + +int32 convert_tremolo_sweep(uint8 sweep) +{ + if (!sweep) + return 0; + + return + ((control_ratio * SWEEP_TUNING) << SWEEP_SHIFT) / + (play_mode->rate * sweep); +} + +int32 convert_vibrato_sweep(uint8 sweep, int32 vib_control_ratio) +{ + if (!sweep) + return 0; + + return + (int32) (FSCALE((double) (vib_control_ratio) * SWEEP_TUNING, SWEEP_SHIFT) + / (double)(play_mode->rate * sweep)); + + /* this was overflowing with seashore.pat + + ((vib_control_ratio * SWEEP_TUNING) << SWEEP_SHIFT) / + (play_mode->rate * sweep); */ +} + +int32 convert_tremolo_rate(uint8 rate) +{ + return + ((SINE_CYCLE_LENGTH * control_ratio * rate) << RATE_SHIFT) / + (TREMOLO_RATE_TUNING * play_mode->rate); +} + +int32 convert_vibrato_rate(uint8 rate) +{ + /* Return a suitable vibrato_control_ratio value */ + return + (VIBRATO_RATE_TUNING * play_mode->rate) / + (rate * 2 * VIBRATO_SAMPLE_INCREMENTS); +} + +static void reverse_data(int16 *sp, int32 ls, int32 le) +{ + int16 s, *ep=sp+le; + sp+=ls; + le-=ls; + le/=2; + while (le--) + { + s=*sp; + *sp++=*ep; + *ep--=s; + } +} + +/* + If panning or note_to_use != -1, it will be used for all samples, + instead of the sample-specific values in the instrument file. + + For note_to_use, any value <0 or >127 will be forced to 0. + + For other parameters, 1 means yes, 0 means no, other values are + undefined. + + TODO: do reverse loops right */ +static InstrumentLayer *load_instrument(const char *name, int font_type, int percussion, + int panning, int amp, int cfg_tuning, int note_to_use, + int strip_loop, int strip_envelope, + int strip_tail, int bank, int gm_num, int sf_ix) +{ + InstrumentLayer *lp, *lastlp, *headlp = 0; + Instrument *ip; + FILE *fp; + uint8 tmp[1024]; + int i,j,noluck=0; +#ifdef PATCH_EXT_LIST + static char *patch_ext[] = PATCH_EXT_LIST; +#endif + int sf2flag = 0; + int right_samples = 0; + int stereo_channels = 1, stereo_layer; + int vlayer_list[19][4], vlayer, vlayer_count = 0; + + if (!name) return 0; + + /* Open patch file */ + if ((fp=open_file(name, 1, OF_NORMAL)) == NULL) + { + noluck=1; +#ifdef PATCH_EXT_LIST + /* Try with various extensions */ + for (i=0; patch_ext[i]; i++) + { + if (strlen(name)+strlen(patch_ext[i])cmsg(CMSG_ERROR, VERB_NORMAL, + "Instrument `%s' can't be found.", name); + fclose(fp); + return 0; + } + + /*ctl->cmsg(CMSG_INFO, VERB_NOISY, "Loading instrument %s", current_filename);*/ + + /* Read some headers and do cursory sanity checks. There are loads + of magic offsets. This could be rewritten... */ + + if ((239 != fread(tmp, 1, 239, fp)) || + (memcmp(tmp, "GF1PATCH110\0ID#000002", 22) && + memcmp(tmp, "GF1PATCH100\0ID#000002", 22))) /* don't know what the + differences are */ + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: not an instrument", name); + fclose(fp); + return 0; + } + +/* patch layout: + * bytes: info: starts at offset: + * 22 id (see above) 0 + * 60 copyright 22 + * 1 instruments 82 + * 1 voices 83 + * 1 channels 84 + * 2 number of waveforms 85 + * 2 master volume 87 + * 4 datasize 89 + * 36 reserved, but now: 93 + * 7 "SF2EXT\0" id 93 + * 1 right samples 100 + * 28 reserved 101 + * 2 instrument number 129 + * 16 instrument name 131 + * 4 instrument size 147 + * 1 number of layers 151 + * 40 reserved 152 + * 1 layer duplicate 192 + * 1 layer number 193 + * 4 layer size 194 + * 1 number of samples 198 + * 40 reserved 199 + * 239 + * THEN, for each sample, see below + */ + + if (!memcmp(tmp + 93, "SF2EXT", 6)) + { + sf2flag = 1; + vlayer_count = tmp[152]; + } + + if (tmp[82] != 1 && tmp[82] != 0) /* instruments. To some patch makers, + 0 means 1 */ + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Can't handle patches with %d instruments", tmp[82]); + fclose(fp); + return 0; + } + + if (tmp[151] != 1 && tmp[151] != 0) /* layers. What's a layer? */ + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Can't handle instruments with %d layers", tmp[151]); + fclose(fp); + return 0; + } + + + if (sf2flag && vlayer_count > 0) { + for (i = 0; i < 9; i++) + for (j = 0; j < 4; j++) + vlayer_list[i][j] = tmp[153+i*4+j]; + for (i = 9; i < 19; i++) + for (j = 0; j < 4; j++) + vlayer_list[i][j] = tmp[199+(i-9)*4+j]; + } + else { + for (i = 0; i < 19; i++) + for (j = 0; j < 4; j++) + vlayer_list[i][j] = 0; + vlayer_list[0][0] = 0; + vlayer_list[0][1] = 127; + vlayer_list[0][2] = tmp[198]; + vlayer_list[0][3] = 0; + vlayer_count = 1; + } + + lastlp = 0; + + for (vlayer = 0; vlayer < vlayer_count; vlayer++) { + + lp=(InstrumentLayer *)safe_malloc(sizeof(InstrumentLayer)); + lp->size = sizeof(InstrumentLayer); + lp->lo = vlayer_list[vlayer][0]; + lp->hi = vlayer_list[vlayer][1]; + ip=(Instrument *)safe_malloc(sizeof(Instrument)); + lp->size += sizeof(Instrument); + lp->instrument = ip; + lp->next = 0; + + if (lastlp) lastlp->next = lp; + else headlp = lp; + + lastlp = lp; + + if (sf2flag) ip->type = INST_SF2; + else ip->type = INST_GUS; + ip->samples = vlayer_list[vlayer][2]; + ip->sample = (Sample *)safe_malloc(sizeof(Sample) * ip->samples); + lp->size += sizeof(Sample) * ip->samples; + ip->left_samples = ip->samples; + ip->left_sample = ip->sample; + right_samples = vlayer_list[vlayer][3]; + ip->right_samples = right_samples; + if (right_samples) + { + ip->right_sample = (Sample *)safe_malloc(sizeof(Sample) * right_samples); + lp->size += sizeof(Sample) * right_samples; + stereo_channels = 2; + } + else ip->right_sample = 0; + ip->contents = 0; + + ctl->cmsg(CMSG_INFO, VERB_NOISY, "%s%s[%d,%d] %s(%d-%d layer %d of %d)", + (percussion)? " ":"", name, + (percussion)? note_to_use : gm_num, bank, + (right_samples)? "(2) " : "", + lp->lo, lp->hi, vlayer+1, vlayer_count); + + for (stereo_layer = 0; stereo_layer < stereo_channels; stereo_layer++) + { + int sample_count = 0; + + if (stereo_layer == 0) sample_count = ip->left_samples; + else if (stereo_layer == 1) sample_count = ip->right_samples; + + for (i=0; i < sample_count; i++) + { + uint8 fractions; + int32 tmplong; + uint16 tmpshort; + uint16 sample_volume = 0; + uint8 tmpchar; + Sample *sp = 0; + uint8 sf2delay = 0; + +#define READ_CHAR(thing) \ + if (1 != fread(&tmpchar, 1, 1, fp)) { \ + printf("error readc\n"); goto fail; } \ + thing = tmpchar; +#define READ_SHORT(thing) \ + if (1 != fread(&tmpshort, 2, 1, fp)) { \ + printf("error reads\n"); goto fail; } \ + thing = LE_SHORT(tmpshort); +#define READ_LONG(thing) \ + if (1 != fread(&tmplong, 4, 1, fp)) { \ + printf("error readl\n"); goto fail; } \ + thing = LE_LONG(tmplong); + +/* + * 7 sample name + * 1 fractions + * 4 length + * 4 loop start + * 4 loop end + * 2 sample rate + * 4 low frequency + * 4 high frequency + * 2 finetune + * 1 panning + * 6 envelope rates | + * 6 envelope offsets | 18 bytes + * 3 tremolo sweep, rate, depth | + * 3 vibrato sweep, rate, depth | + * 1 sample mode + * 2 scale frequency + * 2 scale factor + * 2 sample volume (??) + * 34 reserved + * Now: 1 delay + * 33 reserved + */ + skip(fp, 7); /* Skip the wave name */ + + if (1 != fread(&fractions, 1, 1, fp)) + { + printf("error 1\n"); + fail: + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "Error reading sample %d", i); + if (stereo_layer == 1) + { + for (j=0; jright_sample[j].data); + free(ip->right_sample); + i = ip->left_samples; + } + for (j=0; jleft_sample[j].data); + free(ip->left_sample); + free(ip); + free(lp); + fclose(fp); + return 0; + } + + if (stereo_layer == 0) sp=&(ip->left_sample[i]); + else if (stereo_layer == 1) sp=&(ip->right_sample[i]); + + READ_LONG(sp->data_length); + READ_LONG(sp->loop_start); + READ_LONG(sp->loop_end); + READ_SHORT(sp->sample_rate); + READ_LONG(sp->low_freq); + READ_LONG(sp->high_freq); + READ_LONG(sp->root_freq); + skip(fp, 2); /* Why have a "root frequency" and then "tuning"?? */ + + READ_CHAR(tmp[0]); + + if (panning==-1) + sp->panning = (tmp[0] * 8 + 4) & 0x7f; + else + sp->panning=(uint8)(panning & 0x7F); + + sp->resonance=0; + sp->cutoff_freq=0; + sp->reverberation=0; + sp->chorusdepth=0; + sp->exclusiveClass=0; + sp->keyToModEnvHold=0; + sp->keyToModEnvDecay=0; + sp->keyToVolEnvHold=0; + sp->keyToVolEnvDecay=0; + + if (cfg_tuning) + { + double tune_factor = (double)(cfg_tuning)/1200.0; + tune_factor = pow(2.0, tune_factor); + sp->root_freq = (uint32)( tune_factor * (double)sp->root_freq ); + } + + /* envelope, tremolo, and vibrato */ + if (18 != fread(tmp, 1, 18, fp)) { printf("error 2\n"); goto fail; } + + if (!tmp[13] || !tmp[14]) + { + sp->tremolo_sweep_increment= + sp->tremolo_phase_increment=sp->tremolo_depth=0; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, " * no tremolo"); + } + else + { + sp->tremolo_sweep_increment=convert_tremolo_sweep(tmp[12]); + sp->tremolo_phase_increment=convert_tremolo_rate(tmp[13]); + sp->tremolo_depth=tmp[14]; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + " * tremolo: sweep %d, phase %d, depth %d", + sp->tremolo_sweep_increment, sp->tremolo_phase_increment, + sp->tremolo_depth); + } + + if (!tmp[16] || !tmp[17]) + { + sp->vibrato_sweep_increment= + sp->vibrato_control_ratio=sp->vibrato_depth=0; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, " * no vibrato"); + } + else + { + sp->vibrato_control_ratio=convert_vibrato_rate(tmp[16]); + sp->vibrato_sweep_increment= + convert_vibrato_sweep(tmp[15], sp->vibrato_control_ratio); + sp->vibrato_depth=tmp[17]; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + " * vibrato: sweep %d, ctl %d, depth %d", + sp->vibrato_sweep_increment, sp->vibrato_control_ratio, + sp->vibrato_depth); + + } + + READ_CHAR(sp->modes); + READ_SHORT(sp->freq_center); + READ_SHORT(sp->freq_scale); + + if (sf2flag) + { + READ_SHORT(sample_volume); + READ_CHAR(sf2delay); + READ_CHAR(sp->exclusiveClass); + skip(fp, 32); + } + else + { + skip(fp, 36); + } + + /* Mark this as a fixed-pitch instrument if such a deed is desired. */ + if (note_to_use!=-1) + sp->note_to_use=(uint8)(note_to_use); + else + sp->note_to_use=0; + + /* seashore.pat in the Midia patch set has no Sustain. I don't + understand why, and fixing it by adding the Sustain flag to + all looped patches probably breaks something else. We do it + anyway. */ + + if (sp->modes & MODES_LOOPING) + sp->modes |= MODES_SUSTAIN; + + /* Strip any loops and envelopes we're permitted to */ + if ((strip_loop==1) && + (sp->modes & (MODES_SUSTAIN | MODES_LOOPING | + MODES_PINGPONG | MODES_REVERSE))) + { + ctl->cmsg(CMSG_INFO, VERB_DEBUG, " - Removing loop and/or sustain"); + sp->modes &=~(MODES_SUSTAIN | MODES_LOOPING | + MODES_PINGPONG | MODES_REVERSE); + } + + if (strip_envelope==1) + { + if (sp->modes & MODES_ENVELOPE) + ctl->cmsg(CMSG_INFO, VERB_DEBUG, " - Removing envelope"); + sp->modes &= ~MODES_ENVELOPE; + } + else if (strip_envelope != 0) + { + /* Have to make a guess. */ + if (!(sp->modes & (MODES_LOOPING | MODES_PINGPONG | MODES_REVERSE))) + { + /* No loop? Then what's there to sustain? No envelope needed + either... */ + sp->modes &= ~(MODES_SUSTAIN|MODES_ENVELOPE); + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + " - No loop, removing sustain and envelope"); + } + else if (!memcmp(tmp, "??????", 6) || tmp[11] >= 100) + { + /* Envelope rates all maxed out? Envelope end at a high "offset"? + That's a weird envelope. Take it out. */ + sp->modes &= ~MODES_ENVELOPE; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + " - Weirdness, removing envelope"); + } + else if (!(sp->modes & MODES_SUSTAIN)) + { + /* No sustain? Then no envelope. I don't know if this is + justified, but patches without sustain usually don't need the + envelope either... at least the Gravis ones. They're mostly + drums. I think. */ + sp->modes &= ~MODES_ENVELOPE; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + " - No sustain, removing envelope"); + } + } + + sp->attenuation = 0; + + for (j=ATTACK; jenvelope_rate[j]= + (j<3)? convert_envelope_rate_attack(tmp[j], 11) : convert_envelope_rate(tmp[j]); + sp->envelope_offset[j]= + convert_envelope_offset(tmp[6+j]); + } + if (sf2flag) + { + if (sf2delay > 5) sf2delay = 5; + sp->envelope_rate[DELAY] = (int32)( (sf2delay*play_mode->rate) / 1000 ); + } + else + { + sp->envelope_rate[DELAY]=0; + } + sp->envelope_offset[DELAY]=0; + + for (j=ATTACK; jmodulation_rate[j]=sp->envelope_rate[j]; + sp->modulation_offset[j]=sp->envelope_offset[j]; + } + sp->modulation_rate[DELAY] = sp->modulation_offset[DELAY] = 0; + sp->modEnvToFilterFc=0; + sp->modEnvToPitch=0; + sp->lfo_sweep_increment = 0; + sp->lfo_phase_increment = 0; + sp->modLfoToFilterFc = 0; + sp->vibrato_delay = 0; + + /* Then read the sample data */ + if (sp->data_length/2 > MAX_SAMPLE_SIZE) + { + printf("error 3\n"); + goto fail; + } + sp->data = safe_malloc(sp->data_length + 1); + lp->size += sp->data_length + 1; + + if (1 != fread(sp->data, sp->data_length, 1, fp)) + { + printf("error 4\n"); + goto fail; + } + + if (!(sp->modes & MODES_16BIT)) /* convert to 16-bit data */ + { + int32 i=sp->data_length; + uint8 *cp=(uint8 *)(sp->data); + uint16 *tmp,*newdta; + tmp=newdta=safe_malloc(sp->data_length*2 + 2); + while (i--) + *tmp++ = (uint16)(*cp++) << 8; + cp=(uint8 *)(sp->data); + sp->data = (sample_t *)newdta; + free(cp); + sp->data_length *= 2; + sp->loop_start *= 2; + sp->loop_end *= 2; + } +#if SDL_BYTEORDER == SDL_BIG_ENDIAN + else + /* convert to machine byte order */ + { + int32 i=sp->data_length/2; + int16 *tmp=(int16 *)sp->data,s; + while (i--) + { + s=LE_SHORT(*tmp); + *tmp++=s; + } + } +#endif + + if (sp->modes & MODES_UNSIGNED) /* convert to signed data */ + { + int32 i=sp->data_length/2; + int16 *tmp=(int16 *)sp->data; + while (i--) + *tmp++ ^= 0x8000; + } + + /* Reverse reverse loops and pass them off as normal loops */ + if (sp->modes & MODES_REVERSE) + { + int32 t; + /* The GUS apparently plays reverse loops by reversing the + whole sample. We do the same because the GUS does not SUCK. */ + + ctl->cmsg(CMSG_WARNING, VERB_NORMAL, "Reverse loop in %s", name); + reverse_data((int16 *)sp->data, 0, sp->data_length/2); + + t=sp->loop_start; + sp->loop_start=sp->data_length - sp->loop_end; + sp->loop_end=sp->data_length - t; + + sp->modes &= ~MODES_REVERSE; + sp->modes |= MODES_LOOPING; /* just in case */ + } + + /* If necessary do some anti-aliasing filtering */ + + if (antialiasing_allowed) + antialiasing(sp,play_mode->rate); + +#ifdef ADJUST_SAMPLE_VOLUMES + if (amp!=-1) + sp->volume=(FLOAT_T)((amp) / 100.0); + else if (sf2flag) + sp->volume=(FLOAT_T)((sample_volume) / 255.0); + else + { + /* Try to determine a volume scaling factor for the sample. + This is a very crude adjustment, but things sound more + balanced with it. Still, this should be a runtime option. */ + uint32 i, numsamps=sp->data_length/2; + uint32 higher=0, highcount=0; + int16 maxamp=0,a; + int16 *tmp=(int16 *)sp->data; + i = numsamps; + while (i--) + { + a=*tmp++; + if (a<0) a=-a; + if (a>maxamp) + maxamp=a; + } + tmp=(int16 *)sp->data; + i = numsamps; + while (i--) + { + a=*tmp++; + if (a<0) a=-a; + if (a > 3*maxamp/4) + { + higher += a; + highcount++; + } + } + if (highcount) higher /= highcount; + else higher = 10000; + sp->volume = (32768.0 * 0.875) / (double)higher ; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, " * volume comp: %f", sp->volume); + } +#else + if (amp!=-1) + sp->volume=(double)(amp) / 100.0; + else + sp->volume=1.0; +#endif + + sp->data_length /= 2; /* These are in bytes. Convert into samples. */ + + sp->loop_start /= 2; + sp->loop_end /= 2; + sp->data[sp->data_length] = sp->data[sp->data_length-1]; + + /* Then fractional samples */ + sp->data_length <<= FRACTION_BITS; + sp->loop_start <<= FRACTION_BITS; + sp->loop_end <<= FRACTION_BITS; + + /* trim off zero data at end */ + { + int ls = sp->loop_start>>FRACTION_BITS; + int le = sp->loop_end>>FRACTION_BITS; + int se = sp->data_length>>FRACTION_BITS; + while (se > 1 && !sp->data[se-1]) se--; + if (le > se) le = se; + if (ls >= le) sp->modes &= ~MODES_LOOPING; + sp->loop_end = le<data_length = se<loop_start |= + (fractions & 0x0F) << (FRACTION_BITS-4); + sp->loop_end |= + ((fractions>>4) & 0x0F) << (FRACTION_BITS-4); + + /* If this instrument will always be played on the same note, + and it's not looped, we can resample it now. */ + if (sp->note_to_use && !(sp->modes & MODES_LOOPING)) + pre_resample(sp); + +#ifdef LOOKUP_HACK + /* Squash the 16-bit data into 8 bits. */ + { + uint8 *gulp,*ulp; + int16 *swp; + int l=sp->data_length >> FRACTION_BITS; + gulp=ulp=safe_malloc(l+1); + swp=(int16 *)sp->data; + while(l--) + *ulp++ = (*swp++ >> 8) & 0xFF; + free(sp->data); + sp->data=(sample_t *)gulp; + } +#endif + + if (strip_tail==1) + { + /* Let's not really, just say we did. */ + ctl->cmsg(CMSG_INFO, VERB_DEBUG, " - Stripping tail"); + sp->data_length = sp->loop_end; + } + } /* end of sample loop */ + } /* end of stereo layer loop */ + } /* end of vlayer loop */ + + + close_file(fp); + return headlp; +} + +static int fill_bank(int dr, int b) +{ + int i, errors=0; + ToneBank *bank=((dr) ? drumset[b] : tonebank[b]); + if (!bank) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Huh. Tried to load instruments in non-existent %s %d", + (dr) ? "drumset" : "tone bank", b); + return 0; + } + for (i=0; itone[i].layer==MAGIC_LOAD_INSTRUMENT) + { + if (!(bank->tone[i].name)) + { + ctl->cmsg(CMSG_WARNING, (b!=0) ? VERB_VERBOSE : VERB_NORMAL, + "No instrument mapped to %s %d, program %d%s", + (dr)? "drum set" : "tone bank", b, i, + (b!=0) ? "" : " - this instrument will not be heard"); + if (b!=0) + { + /* Mark the corresponding instrument in the default + bank / drumset for loading (if it isn't already) */ + if (!dr) + { + if (!(standard_tonebank.tone[i].layer)) + standard_tonebank.tone[i].layer= + MAGIC_LOAD_INSTRUMENT; + } + else + { + if (!(standard_drumset.tone[i].layer)) + standard_drumset.tone[i].layer= + MAGIC_LOAD_INSTRUMENT; + } + } + bank->tone[i].layer=0; + errors++; + } + else if (!(bank->tone[i].layer= + load_instrument(bank->tone[i].name, + bank->tone[i].font_type, + (dr) ? 1 : 0, + bank->tone[i].pan, + bank->tone[i].amp, + bank->tone[i].tuning, + (bank->tone[i].note!=-1) ? + bank->tone[i].note : + ((dr) ? i : -1), + (bank->tone[i].strip_loop!=-1) ? + bank->tone[i].strip_loop : + ((dr) ? 1 : -1), + (bank->tone[i].strip_envelope != -1) ? + bank->tone[i].strip_envelope : + ((dr) ? 1 : -1), + bank->tone[i].strip_tail, + b, + ((dr) ? i + 128 : i), + bank->tone[i].sf_ix + ))) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Couldn't load instrument %s (%s %d, program %d)", + bank->tone[i].name, + (dr)? "drum set" : "tone bank", b, i); + errors++; + } + else + { /* it's loaded now */ + bank->tone[i].last_used = current_tune_number; + current_patch_memory += bank->tone[i].layer->size; + purge_as_required(); + if (current_patch_memory > max_patch_memory) { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Not enough memory to load instrument %s (%s %d, program %d)", + bank->tone[i].name, + (dr)? "drum set" : "tone bank", b, i); + errors++; + free_layer(bank->tone[i].layer); + bank->tone[i].layer=0; + bank->tone[i].last_used=-1; + } +#if 0 + if (check_for_rc()) { + free_layer(bank->tone[i].layer); + bank->tone[i].layer=0; + bank->tone[i].last_used=-1; + return 0; + } +#endif + } + } + } + return errors; +} + +static void free_old_instruments(int how_old) +{ + int i=MAXBANK; + while(i--) + { + if (tonebank[i]) + free_old_bank(0, i, how_old); + if (drumset[i]) + free_old_bank(1, i, how_old); + } +} + +static void purge_as_required(void) +{ + if (!max_patch_memory) return; + + while (last_tune_purged < current_tune_number + && current_patch_memory > max_patch_memory) + { + last_tune_purged++; + free_old_instruments(last_tune_purged); + } +} + + +int load_missing_instruments(void) +{ + int i=MAXBANK,errors=0; + while (i--) + { + if (tonebank[i]) + errors+=fill_bank(0,i); + if (drumset[i]) + errors+=fill_bank(1,i); + } + current_tune_number++; + return errors; +} + +void free_instruments(void) +{ + int i=128; + while(i--) + { + if (tonebank[i]) + free_bank(0,i); + if (drumset[i]) + free_bank(1,i); + } +} + +int set_default_instrument(const char *name) +{ + InstrumentLayer *lp; +/* if (!(lp=load_instrument(name, 0, -1, -1, -1, 0, 0, 0))) */ + if (!(lp=load_instrument(name, FONT_NORMAL, 0, -1, -1, 0, -1, -1, -1, -1, 0, -1, -1))) + return -1; + if (default_instrument) + free_layer(default_instrument); + default_instrument=lp; + default_program=SPECIAL_PROGRAM; + return 0; +} diff --git a/apps/plugins/sdl/SDL_mixer/timidity/instrum.h b/apps/plugins/sdl/SDL_mixer/timidity/instrum.h new file mode 100644 index 0000000..7ba0a99 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/instrum.h @@ -0,0 +1,168 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + + +typedef struct { + int32 + loop_start, loop_end, data_length, + sample_rate, low_freq, high_freq, root_freq; + uint8 + root_tune, fine_tune; + int32 + envelope_rate[7], envelope_offset[7], + modulation_rate[7], modulation_offset[7]; + FLOAT_T + volume, resonance, + modEnvToFilterFc, modEnvToPitch, modLfoToFilterFc; + sample_t *data; + int32 + tremolo_sweep_increment, tremolo_phase_increment, + lfo_sweep_increment, lfo_phase_increment, + vibrato_sweep_increment, vibrato_control_ratio, + cutoff_freq; + uint8 + reverberation, chorusdepth, + tremolo_depth, vibrato_depth, + modes; + uint8 + attenuation, freq_center; + int8 + panning, note_to_use, exclusiveClass; + int16 + scale_tuning, keyToModEnvHold, keyToModEnvDecay, + keyToVolEnvHold, keyToVolEnvDecay; + int32 + freq_scale, vibrato_delay; +} Sample; + +/* Bits in modes: */ +#define MODES_16BIT (1<<0) +#define MODES_UNSIGNED (1<<1) +#define MODES_LOOPING (1<<2) +#define MODES_PINGPONG (1<<3) +#define MODES_REVERSE (1<<4) +#define MODES_SUSTAIN (1<<5) +#define MODES_ENVELOPE (1<<6) +#define MODES_FAST_RELEASE (1<<7) + +#if 0 +typedef struct { + int samples; + Sample *sample; +} Instrument; +#endif + +#define INST_GUS 0 +#define INST_SF2 1 + +typedef struct { + int type; + int samples; + Sample *sample; + int left_samples; + Sample *left_sample; + int right_samples; + Sample *right_sample; + unsigned char *contents; +} Instrument; + + +typedef struct _InstrumentLayer { + uint8 lo, hi; + int size; + Instrument *instrument; + struct _InstrumentLayer *next; +} InstrumentLayer; + +struct cfg_type { + int font_code; + int num; + const char *name; +}; + +#define FONT_NORMAL 0 +#define FONT_FFF 1 +#define FONT_SBK 2 +#define FONT_TONESET 3 +#define FONT_DRUMSET 4 +#define FONT_PRESET 5 + + +typedef struct { + char *name; + InstrumentLayer *layer; + int font_type, sf_ix, last_used, tuning; + int note, amp, pan, strip_loop, strip_envelope, strip_tail; +} ToneBankElement; + +#if 0 +typedef struct { + char *name; + Instrument *instrument; + int note, amp, pan, strip_loop, strip_envelope, strip_tail; +} ToneBankElement; +#endif +/* A hack to delay instrument loading until after reading the + entire MIDI file. */ +#define MAGIC_LOAD_INSTRUMENT ((InstrumentLayer *)(-1)) + +#define MAXPROG 128 +#define MAXBANK 130 +#define SFXBANK (MAXBANK-1) +#define SFXDRUM1 (MAXBANK-2) +#define SFXDRUM2 (MAXBANK-1) +#define XGDRUM 1 + +#if 0 +typedef struct { + ToneBankElement tone[128]; +} ToneBank; +#endif + +typedef struct { + char *name; + ToneBankElement tone[MAXPROG]; +} ToneBank; + + +extern char *sf_file; + +extern ToneBank *tonebank[], *drumset[]; + +#if 0 +extern Instrument *default_instrument; +#endif +extern InstrumentLayer *default_instrument; +extern int default_program; +extern int antialiasing_allowed; +extern int fast_decay; +extern int free_instruments_afterwards; + +#define SPECIAL_PROGRAM -1 + +extern int load_missing_instruments(void); +extern void free_instruments(void); +extern void end_soundfont(void); +extern int set_default_instrument(const char *name); + + +extern int32 convert_tremolo_sweep(uint8 sweep); +extern int32 convert_vibrato_sweep(uint8 sweep, int32 vib_control_ratio); +extern int32 convert_tremolo_rate(uint8 rate); +extern int32 convert_vibrato_rate(uint8 rate); + +extern int init_soundfont(char *fname, int oldbank, int newbank, int level); +extern InstrumentLayer *load_sbk_patch(const char *name, int gm_num, int bank, int percussion, + int panning, int amp, int note_to_use, int sf_ix); +extern int current_tune_number; +extern int max_patch_memory; +extern int current_patch_memory; +#define XMAPMAX 800 +extern int xmap[XMAPMAX][5]; +extern void pcmap(int *b, int *v, int *p, int *drums); + diff --git a/apps/plugins/sdl/SDL_mixer/timidity/mix.c b/apps/plugins/sdl/SDL_mixer/timidity/mix.c new file mode 100644 index 0000000..79d4bfd --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/mix.c @@ -0,0 +1,847 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "common.h" +#include "instrum.h" +#include "playmidi.h" +#include "output.h" +#include "ctrlmode.h" +#include "tables.h" +#include "resample.h" +#include "mix.h" + +/* Returns 1 if envelope runs out */ +int recompute_envelope(int v) +{ + int stage; + + stage = voice[v].envelope_stage; + + if (stage>5) + { + /* Envelope ran out. */ + int tmp=(voice[v].status == VOICE_DIE); /* Already displayed as dead */ + voice[v].status = VOICE_FREE; + if(!tmp) + ctl->note(v); + return 1; + } + + if (voice[v].sample->modes & MODES_ENVELOPE) + { + if (voice[v].status==VOICE_ON || voice[v].status==VOICE_SUSTAINED) + { + if (stage>2) + { + /* Freeze envelope until note turns off. Trumpets want this. */ + voice[v].envelope_increment=0; + return 0; + } + } + } + voice[v].envelope_stage=stage+1; + + if (voice[v].envelope_volume==voice[v].sample->envelope_offset[stage]) + return recompute_envelope(v); + voice[v].envelope_target=voice[v].sample->envelope_offset[stage]; + voice[v].envelope_increment = voice[v].sample->envelope_rate[stage]; + if (voice[v].envelope_targetmodes & MODES_ENVELOPE) + { + FLOAT_T ev = (FLOAT_T)vol_table[voice[v].envelope_volume>>23]; + lramp *= ev; + lamp *= ev; + ceamp *= ev; + ramp *= ev; + rramp *= ev; + lfeamp *= ev; + } + + la = (int32)FSCALE(lamp,AMP_BITS); + ra = (int32)FSCALE(ramp,AMP_BITS); + lra = (int32)FSCALE(lramp,AMP_BITS); + rra = (int32)FSCALE(rramp,AMP_BITS); + cea = (int32)FSCALE(ceamp,AMP_BITS); + lfea = (int32)FSCALE(lfeamp,AMP_BITS); + + if (la>MAX_AMP_VALUE) la=MAX_AMP_VALUE; + if (ra>MAX_AMP_VALUE) ra=MAX_AMP_VALUE; + if (lra>MAX_AMP_VALUE) lra=MAX_AMP_VALUE; + if (rra>MAX_AMP_VALUE) rra=MAX_AMP_VALUE; + if (cea>MAX_AMP_VALUE) cea=MAX_AMP_VALUE; + if (lfea>MAX_AMP_VALUE) lfea=MAX_AMP_VALUE; + + voice[v].lr_mix=FINAL_VOLUME(lra); + voice[v].left_mix=FINAL_VOLUME(la); + voice[v].ce_mix=FINAL_VOLUME(cea); + voice[v].right_mix=FINAL_VOLUME(ra); + voice[v].rr_mix=FINAL_VOLUME(rra); + voice[v].lfe_mix=FINAL_VOLUME(lfea); + } + else + { + if (voice[v].tremolo_phase_increment) + lamp *= voice[v].tremolo_volume; + if (voice[v].sample->modes & MODES_ENVELOPE) + lamp *= (FLOAT_T)vol_table[voice[v].envelope_volume>>23]; + + la = (int32)FSCALE(lamp,AMP_BITS); + + if (la>MAX_AMP_VALUE) + la=MAX_AMP_VALUE; + + voice[v].left_mix=FINAL_VOLUME(la); + } +} + +static int update_envelope(int v) +{ + voice[v].envelope_volume += voice[v].envelope_increment; + /* Why is there no ^^ operator?? */ + if (((voice[v].envelope_increment < 0) && + (voice[v].envelope_volume <= voice[v].envelope_target)) || + ((voice[v].envelope_increment > 0) && + (voice[v].envelope_volume >= voice[v].envelope_target))) + { + voice[v].envelope_volume = voice[v].envelope_target; + if (recompute_envelope(v)) + return 1; + } + return 0; +} + +static void update_tremolo(int v) +{ + int32 depth=voice[v].sample->tremolo_depth<<7; + + if (voice[v].tremolo_sweep) + { + /* Update sweep position */ + + voice[v].tremolo_sweep_position += voice[v].tremolo_sweep; + if (voice[v].tremolo_sweep_position>=(1<>= SWEEP_SHIFT; + } + } + + voice[v].tremolo_phase += voice[v].tremolo_phase_increment; + + /* if (voice[v].tremolo_phase >= (SINE_CYCLE_LENGTH<> RATE_SHIFT) + 1.0) + * depth * TREMOLO_AMPLITUDE_TUNING, + 17)); + + /* I'm not sure about the +1.0 there -- it makes tremoloed voices' + volumes on average the lower the higher the tremolo amplitude. */ +} + +/* Returns 1 if the note died */ +static int update_signal(int v) +{ + if (voice[v].envelope_increment && update_envelope(v)) + return 1; + + if (voice[v].tremolo_phase_increment) + update_tremolo(v); + + apply_envelope_to_amp(v); + return 0; +} + +#ifdef LOOKUP_HACK +# define MIXATION(a) *lp++ += mixup[(a<<8) | (uint8)s]; +#else +# define MIXATION(a) *lp++ += (a)*s; +#endif + +#define MIXSKIP lp++ +#define MIXMAX(a,b) *lp++ += ((a>b)?a:b) * s +#define MIXCENT(a,b) *lp++ += (a/2+b/2) * s +#define MIXHALF(a) *lp++ += (a>>1)*s; + +static void mix_mystery_signal(resample_t *sp, int32 *lp, int v, int count) +{ + Voice *vp = voice + v; + final_volume_t + left_rear=vp->lr_mix, + left=vp->left_mix, + center=vp->ce_mix, + right=vp->right_mix, + right_rear=vp->rr_mix, + lfe=vp->lfe_mix; + int cc; + resample_t s; + + if (!(cc = vp->control_counter)) + { + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + + left_rear = vp->lr_mix; + left = vp->left_mix; + center = vp->ce_mix; + right = vp->right_mix; + right_rear = vp->rr_mix; + lfe = vp->lfe_mix; + } + + while (count) + if (cc < count) + { + count -= cc; + while (cc--) + { + s = *sp++; + MIXATION(left); + MIXATION(right); + if (num_ochannels >= 4) { + MIXATION(left_rear); + MIXATION(right_rear); + } + if (num_ochannels == 6) { + MIXATION(center); + MIXATION(lfe); + } + } + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left_rear = vp->lr_mix; + left = vp->left_mix; + center = vp->ce_mix; + right = vp->right_mix; + right_rear = vp->rr_mix; + lfe = vp->lfe_mix; + } + else + { + vp->control_counter = cc - count; + while (count--) + { + s = *sp++; + MIXATION(left); + MIXATION(right); + if (num_ochannels >= 4) { + MIXATION(left_rear); + MIXATION(right_rear); + } + if (num_ochannels == 6) { + MIXATION(center); + MIXATION(lfe); + } + } + return; + } +} + +static void mix_center_signal(resample_t *sp, int32 *lp, int v, int count) +{ + Voice *vp = voice + v; + final_volume_t + left=vp->left_mix; + int cc; + resample_t s; + + if (!(cc = vp->control_counter)) + { + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + + while (count) + if (cc < count) + { + count -= cc; + while (cc--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXATION(left); + } + else if (num_ochannels == 4) { + MIXATION(left); + MIXSKIP; + MIXATION(left); + MIXSKIP; + } + else if (num_ochannels == 6) { + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXATION(left); + MIXATION(left); + } + } + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + else + { + vp->control_counter = cc - count; + while (count--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXATION(left); + } + else if (num_ochannels == 4) { + MIXATION(left); + MIXSKIP; + MIXATION(left); + MIXSKIP; + } + else if (num_ochannels == 6) { + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXATION(left); + MIXATION(left); + } + } + return; + } +} + +static void mix_single_left_signal(resample_t *sp, int32 *lp, int v, int count) +{ + Voice *vp = voice + v; + final_volume_t + left=vp->left_mix; + int cc; + resample_t s; + + if (!(cc = vp->control_counter)) + { + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + + while (count) + if (cc < count) + { + count -= cc; + while (cc--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXSKIP; + } + if (num_ochannels >= 4) { + MIXHALF(left); + MIXSKIP; + MIXATION(left); + MIXSKIP; + } + if (num_ochannels == 6) { + MIXSKIP; + MIXATION(left); + } + } + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + else + { + vp->control_counter = cc - count; + while (count--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXSKIP; + } + if (num_ochannels >= 4) { + MIXHALF(left); + MIXSKIP; + MIXATION(left); + MIXSKIP; + } + if (num_ochannels == 6) { + MIXSKIP; + MIXATION(left); + } + } + return; + } +} + +static void mix_single_right_signal(resample_t *sp, int32 *lp, int v, int count) +{ + Voice *vp = voice + v; + final_volume_t + left=vp->left_mix; + int cc; + resample_t s; + + if (!(cc = vp->control_counter)) + { + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + + while (count) + if (cc < count) + { + count -= cc; + while (cc--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXSKIP; + MIXATION(left); + } + if (num_ochannels >= 4) { + MIXSKIP; + MIXHALF(left); + MIXSKIP; + MIXATION(left); + } if (num_ochannels == 6) { + MIXSKIP; + MIXATION(left); + } + } + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + else + { + vp->control_counter = cc - count; + while (count--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXSKIP; + MIXATION(left); + } + if (num_ochannels >= 4) { + MIXSKIP; + MIXHALF(left); + MIXSKIP; + MIXATION(left); + } if (num_ochannels == 6) { + MIXSKIP; + MIXATION(left); + } + } + return; + } +} + +static void mix_mono_signal(resample_t *sp, int32 *lp, int v, int count) +{ + Voice *vp = voice + v; + final_volume_t + left=vp->left_mix; + int cc; + resample_t s; + + if (!(cc = vp->control_counter)) + { + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + + while (count) + if (cc < count) + { + count -= cc; + while (cc--) + { + s = *sp++; + MIXATION(left); + } + cc = control_ratio; + if (update_signal(v)) + return; /* Envelope ran out */ + left = vp->left_mix; + } + else + { + vp->control_counter = cc - count; + while (count--) + { + s = *sp++; + MIXATION(left); + } + return; + } +} + +static void mix_mystery(resample_t *sp, int32 *lp, int v, int count) +{ + final_volume_t + left_rear=voice[v].lr_mix, + left=voice[v].left_mix, + center=voice[v].ce_mix, + right=voice[v].right_mix, + right_rear=voice[v].rr_mix, + lfe=voice[v].lfe_mix; + resample_t s; + + while (count--) + { + s = *sp++; + MIXATION(left); + MIXATION(right); + if (num_ochannels >= 4) { + MIXATION(left_rear); + MIXATION(right_rear); + } + if (num_ochannels == 6) { + MIXATION(center); + MIXATION(lfe); + } + } +} + +static void mix_center(resample_t *sp, int32 *lp, int v, int count) +{ + final_volume_t + left=voice[v].left_mix; + resample_t s; + + while (count--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXATION(left); + } + else if (num_ochannels == 4) { + MIXATION(left); + MIXATION(left); + MIXSKIP; + MIXSKIP; + } + else if (num_ochannels == 6) { + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXATION(left); + MIXATION(left); + } + } +} + +static void mix_single_left(resample_t *sp, int32 *lp, int v, int count) +{ + final_volume_t + left=voice[v].left_mix; + resample_t s; + + while (count--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXSKIP; + } + if (num_ochannels >= 4) { + MIXHALF(left); + MIXSKIP; + MIXATION(left); + MIXSKIP; + } + if (num_ochannels == 6) { + MIXSKIP; + MIXATION(left); + } + } +} +static void mix_single_right(resample_t *sp, int32 *lp, int v, int count) +{ + final_volume_t + left=voice[v].left_mix; + resample_t s; + + while (count--) + { + s = *sp++; + if (num_ochannels == 2) { + MIXSKIP; + MIXATION(left); + } + if (num_ochannels >= 4) { + MIXSKIP; + MIXHALF(left); + MIXSKIP; + MIXATION(left); + } + if (num_ochannels == 6) { + MIXSKIP; + MIXATION(left); + } + } +} + +static void mix_mono(resample_t *sp, int32 *lp, int v, int count) +{ + final_volume_t + left=voice[v].left_mix; + resample_t s; + + while (count--) + { + s = *sp++; + MIXATION(left); + } +} + +/* Ramp a note out in c samples */ +static void ramp_out(resample_t *sp, int32 *lp, int v, int32 c) +{ + + /* should be final_volume_t, but uint8 gives trouble. */ + int32 left_rear, left, center, right, right_rear, lfe, li, ri; + + resample_t s = 0; /* silly warning about uninitialized s */ + + /* Fix by James Caldwell */ + if ( c == 0 ) c = 1; + + left = voice[v].left_mix; + li = -(left/c); + if (!li) li = -1; + + /* printf("Ramping out: left=%d, c=%d, li=%d\n", left, c, li); */ + + if (!(play_mode->encoding & PE_MONO)) + { + if (voice[v].panned==PANNED_MYSTERY) + { + left_rear = voice[v].lr_mix; + center=voice[v].ce_mix; + right=voice[v].right_mix; + right_rear = voice[v].rr_mix; + lfe = voice[v].lfe_mix; + + ri=-(right/c); + while (c--) + { + left_rear += li; if (left_rear<0) left_rear=0; + left += li; if (left<0) left=0; + center += li; if (center<0) center=0; + right += ri; if (right<0) right=0; + right_rear += ri; if (right_rear<0) right_rear=0; + lfe += li; if (lfe<0) lfe=0; + s=*sp++; + MIXATION(left); + MIXATION(right); + if (num_ochannels >= 4) { + MIXATION(left_rear); + MIXATION(right_rear); + } + if (num_ochannels == 6) { + MIXATION(center); + MIXATION(lfe); + } + } + } + else if (voice[v].panned==PANNED_CENTER) + { + while (c--) + { + left += li; + if (left<0) + return; + s=*sp++; + if (num_ochannels == 2) { + MIXATION(left); + MIXATION(left); + } + else if (num_ochannels == 4) { + MIXATION(left); + MIXATION(left); + MIXSKIP; + MIXSKIP; + } + else if (num_ochannels == 6) { + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXSKIP; + MIXATION(left); + MIXATION(left); + } + } + } + else if (voice[v].panned==PANNED_LEFT) + { + while (c--) + { + left += li; + if (left<0) + return; + s=*sp++; + MIXATION(left); + MIXSKIP; + if (num_ochannels >= 4) { + MIXATION(left); + MIXSKIP; + } if (num_ochannels == 6) { + MIXATION(left); + MIXATION(left); + } + } + } + else if (voice[v].panned==PANNED_RIGHT) + { + while (c--) + { + left += li; + if (left<0) + return; + s=*sp++; + MIXSKIP; + MIXATION(left); + if (num_ochannels >= 4) { + MIXSKIP; + MIXATION(left); + } if (num_ochannels == 6) { + MIXATION(left); + MIXATION(left); + } + } + } + } + else + { + /* Mono output. */ + while (c--) + { + left += li; + if (left<0) + return; + s=*sp++; + MIXATION(left); + } + } +} + + +/**************** interface function ******************/ + +void mix_voice(int32 *buf, int v, int32 c) +{ + Voice *vp=voice+v; + int32 count=c; + resample_t *sp; + if (c<0) return; + if (vp->status==VOICE_DIE) + { + if (count>=MAX_DIE_TIME) + count=MAX_DIE_TIME; + sp=resample_voice(v, &count); + ramp_out(sp, buf, v, count); + vp->status=VOICE_FREE; + } + else + { + sp=resample_voice(v, &count); + if (count<0) return; + if (play_mode->encoding & PE_MONO) + { + /* Mono output. */ + if (vp->envelope_increment || vp->tremolo_phase_increment) + mix_mono_signal(sp, buf, v, count); + else + mix_mono(sp, buf, v, count); + } + else + { + if (vp->panned == PANNED_MYSTERY) + { + if (vp->envelope_increment || vp->tremolo_phase_increment) + mix_mystery_signal(sp, buf, v, count); + else + mix_mystery(sp, buf, v, count); + } + else if (vp->panned == PANNED_CENTER) + { + if (vp->envelope_increment || vp->tremolo_phase_increment) + mix_center_signal(sp, buf, v, count); + else + mix_center(sp, buf, v, count); + } + else + { + /* It's either full left or full right. In either case, + every other sample is 0. Just get the offset right: */ + + if (vp->envelope_increment || vp->tremolo_phase_increment) + { + if (vp->panned == PANNED_RIGHT) + mix_single_right_signal(sp, buf, v, count); + else mix_single_left_signal(sp, buf, v, count); + } + else + { + if (vp->panned == PANNED_RIGHT) + mix_single_right(sp, buf, v, count); + else mix_single_left(sp, buf, v, count); + } + } + } + } +} diff --git a/apps/plugins/sdl/SDL_mixer/timidity/mix.h b/apps/plugins/sdl/SDL_mixer/timidity/mix.h new file mode 100644 index 0000000..2f582b8 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/mix.h @@ -0,0 +1,11 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +extern void mix_voice(int32 *buf, int v, int32 c); +extern int recompute_envelope(int v); +extern void apply_envelope_to_amp(int v); diff --git a/apps/plugins/sdl/SDL_mixer/timidity/output.c b/apps/plugins/sdl/SDL_mixer/timidity/output.c new file mode 100644 index 0000000..5dab01f --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/output.c @@ -0,0 +1,122 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "output.h" +#include "tables.h" + + +#ifdef SDL +extern PlayMode sdl_play_mode; +#define DEFAULT_PLAY_MODE &sdl_play_mode +#endif + +PlayMode *play_mode_list[] = { +#ifdef DEFAULT_PLAY_MODE + DEFAULT_PLAY_MODE, +#endif + 0 +}; + +#ifdef DEFAULT_PLAY_MODE + PlayMode *play_mode=DEFAULT_PLAY_MODE; +#endif + +/*****************************************************************/ +/* Some functions to convert signed 32-bit data to other formats */ + +void s32tos8(void *dp, int32 *lp, int32 c) +{ + int8 *cp=(int8 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-8-GUARD_BITS); + if (l>127) l=127; + else if (l<-128) l=-128; + *cp++ = (int8) (l); + } +} + +void s32tou8(void *dp, int32 *lp, int32 c) +{ + uint8 *cp=(uint8 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-8-GUARD_BITS); + if (l>127) l=127; + else if (l<-128) l=-128; + *cp++ = 0x80 ^ ((uint8) l); + } +} + +void s32tos16(void *dp, int32 *lp, int32 c) +{ + int16 *sp=(int16 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-16-GUARD_BITS); + if (l > 32767) l=32767; + else if (l<-32768) l=-32768; + *sp++ = (int16)(l); + } +} + +void s32tou16(void *dp, int32 *lp, int32 c) +{ + uint16 *sp=(uint16 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-16-GUARD_BITS); + if (l > 32767) l=32767; + else if (l<-32768) l=-32768; + *sp++ = 0x8000 ^ (uint16)(l); + } +} + +void s32tos16x(void *dp, int32 *lp, int32 c) +{ + int16 *sp=(int16 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-16-GUARD_BITS); + if (l > 32767) l=32767; + else if (l<-32768) l=-32768; + *sp++ = XCHG_SHORT((int16)(l)); + } +} + +void s32tou16x(void *dp, int32 *lp, int32 c) +{ + uint16 *sp=(uint16 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-16-GUARD_BITS); + if (l > 32767) l=32767; + else if (l<-32768) l=-32768; + *sp++ = XCHG_SHORT(0x8000 ^ (uint16)(l)); + } +} + +void s32toulaw(void *dp, int32 *lp, int32 c) +{ + uint8 *up=(uint8 *)(dp); + int32 l; + while (c--) + { + l=(*lp++)>>(32-13-GUARD_BITS); + if (l > 4095) l=4095; + else if (l<-4096) l=-4096; + *up++ = _l2u[l]; + } +} diff --git a/apps/plugins/sdl/SDL_mixer/timidity/output.h b/apps/plugins/sdl/SDL_mixer/timidity/output.h new file mode 100644 index 0000000..598792d --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/output.h @@ -0,0 +1,60 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +/* Data format encoding bits */ + +#define PE_MONO 0x01 /* versus stereo */ +#define PE_SIGNED 0x02 /* versus unsigned */ +#define PE_16BIT 0x04 /* versus 8-bit */ +#define PE_ULAW 0x08 /* versus linear */ +#define PE_BYTESWAP 0x10 /* versus the other way */ + +typedef struct { + int32 rate, encoding; + char *id_name; +} PlayMode; + +extern PlayMode *play_mode_list[], *play_mode; +extern int init_buffers(int kbytes); + +/* Conversion functions -- These overwrite the int32 data in *lp with + data in another format */ + +/* The size of the output buffers */ +extern int AUDIO_BUFFER_SIZE; + +/* Actual copy function */ +extern void (*s32tobuf)(void *dp, int32 *lp, int32 c); + +/* 8-bit signed and unsigned*/ +extern void s32tos8(void *dp, int32 *lp, int32 c); +extern void s32tou8(void *dp, int32 *lp, int32 c); + +/* 16-bit */ +extern void s32tos16(void *dp, int32 *lp, int32 c); +extern void s32tou16(void *dp, int32 *lp, int32 c); + +/* byte-exchanged 16-bit */ +extern void s32tos16x(void *dp, int32 *lp, int32 c); +extern void s32tou16x(void *dp, int32 *lp, int32 c); + +/* uLaw (8 bits) */ +extern void s32toulaw(void *dp, int32 *lp, int32 c); + +/* little-endian and big-endian specific */ +#if SDL_BYTEORDER == SDL_LIL_ENDIAN +#define s32tou16l s32tou16 +#define s32tou16b s32tou16x +#define s32tos16l s32tos16 +#define s32tos16b s32tos16x +#else +#define s32tou16l s32tou16x +#define s32tou16b s32tou16 +#define s32tos16l s32tos16x +#define s32tos16b s32tos16 +#endif diff --git a/apps/plugins/sdl/SDL_mixer/timidity/playmidi.c b/apps/plugins/sdl/SDL_mixer/timidity/playmidi.c new file mode 100644 index 0000000..84b18cf --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/playmidi.c @@ -0,0 +1,1746 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include + +#include "config.h" +#include "common.h" +#include "instrum.h" +#include "playmidi.h" +#include "readmidi.h" +#include "output.h" +#include "mix.h" +#include "ctrlmode.h" +#include "timidity.h" + +#include "tables.h" + + +static int opt_expression_curve = 2; +static int opt_volume_curve = 2; +static int opt_stereo_surround = 0; + + +Channel channel[MAXCHAN]; +Voice voice[MAX_VOICES]; +signed char drumvolume[MAXCHAN][MAXNOTE]; +signed char drumpanpot[MAXCHAN][MAXNOTE]; +signed char drumreverberation[MAXCHAN][MAXNOTE]; +signed char drumchorusdepth[MAXCHAN][MAXNOTE]; + +int + voices=DEFAULT_VOICES; + +int32 + control_ratio=0, + amplification=DEFAULT_AMPLIFICATION; + +FLOAT_T + master_volume; + +int32 drumchannels=DEFAULT_DRUMCHANNELS; +int adjust_panning_immediately=0; + +struct _MidiSong { + int32 samples; + MidiEvent *events; +}; +static int midi_playing = 0; +static int32 lost_notes, cut_notes; +static int32 *buffer_pointer; +static int32 buffered_count; +extern int32 *common_buffer; +extern resample_t *resample_buffer; /* to free it on Timidity_Close */ + +static MidiEvent *event_list, *current_event; +static int32 sample_count, current_sample; + +int GM_System_On=0; +int XG_System_On=0; +int GS_System_On=0; +int XG_System_reverb_type; +int XG_System_chorus_type; +int XG_System_variation_type; + + +static void adjust_amplification(void) +{ + master_volume = (FLOAT_T)(amplification) / (FLOAT_T)100.0; + master_volume /= 2; +} + + +static void adjust_master_volume(int32 vol) +{ + master_volume = (double)(vol*amplification) / 1638400.0L; + master_volume /= 2; +} + + +static void reset_voices(void) +{ + int i; + for (i=0; ivolume(c, channel[c].volume); + ctl->expression(c, channel[c].expression); + ctl->sustain(c, channel[c].sustain); + ctl->pitch_bend(c, channel[c].pitchbend); +} + +static void reset_midi(void) +{ + int i; + for (i=0; isamples; + sp=ip->sample; + + if (s==1) + { + voice[v].sample=sp; + return; + } + + f=voice[v].orig_frequency; + /* + No suitable sample found! We'll select the sample whose root + frequency is closest to the one we want. (Actually we should + probably convert the low, high, and root frequencies to MIDI note + values and compare those.) */ + + cdiff=0x7FFFFFFF; + closest=sp=ip->sample; + midfreq = (sp->low_freq + sp->high_freq) / 2; + for(i=0; iroot_freq - f; + /* But the root freq. can perfectly well lie outside the keyrange + * frequencies, so let's try: + */ + /* diff=midfreq - f; */ + if (diff<0) diff=-diff; + if (diffnext) { + midvel = (nlp->hi + nlp->lo)/2; + if (!midvel) diffvel = 127; + else if (voice[v].velocity < nlp->lo || voice[v].velocity > nlp->hi) + diffvel = 200; + else diffvel = voice[v].velocity - midvel; + if (diffvel < 0) diffvel = -diffvel; + if (diffvel < mindiff) { + mindiff = diffvel; + bestvel = nlp; + } + } + ip = bestvel->instrument; + + if (ip->right_sample) { + ip->sample = ip->right_sample; + ip->samples = ip->right_samples; + select_sample(v, ip); + voice[v].right_sample = voice[v].sample; + } + else voice[v].right_sample = 0; + ip->sample = ip->left_sample; + ip->samples = ip->left_samples; + select_sample(v, ip); +} + + +static void recompute_freq(int v) +{ + int + sign=(voice[v].sample_increment < 0), /* for bidirectional loops */ + pb=channel[voice[v].channel].pitchbend; + double a; + + if (!voice[v].sample->sample_rate) + return; + + if (voice[v].vibrato_control_ratio) + { + /* This instrument has vibrato. Invalidate any precomputed + sample_increments. */ + + int i=VIBRATO_SAMPLE_INCREMENTS; + while (i--) + voice[v].vibrato_sample_increment[i]=0; + } + + if (pb==0x2000 || pb<0 || pb>0x3FFF) + voice[v].frequency=voice[v].orig_frequency; + else + { + pb-=0x2000; + if (!(channel[voice[v].channel].pitchfactor)) + { + /* Damn. Somebody bent the pitch. */ + int32 i=pb*channel[voice[v].channel].pitchsens; + if (pb<0) + i=-i; + channel[voice[v].channel].pitchfactor= + (FLOAT_T)(bend_fine[(i>>5) & 0xFF] * bend_coarse[i>>13]); + } + if (pb>0) + voice[v].frequency= + (int32)(channel[voice[v].channel].pitchfactor * + (double)(voice[v].orig_frequency)); + else + voice[v].frequency= + (int32)((double)(voice[v].orig_frequency) / + channel[voice[v].channel].pitchfactor); + } + + a = FSCALE(((double)(voice[v].sample->sample_rate) * + (double)(voice[v].frequency)) / + ((double)(voice[v].sample->root_freq) * + (double)(play_mode->rate)), + FRACTION_BITS); + + if (sign) + a = -a; /* need to preserve the loop direction */ + + voice[v].sample_increment = (int32)(a); +} + +static int expr_curve[128] = { + 7, 8, 8, 8, 8, 8, 9, 9, 9, 9, 9, 10, 10, 10, 10, 11, + 11, 11, 11, 12, 12, 12, 12, 13, 13, 13, 14, 14, 14, 14, 15, 15, + 15, 16, 16, 17, 17, 17, 18, 18, 19, 19, 19, 20, 20, 21, 21, 22, + 22, 23, 23, 24, 24, 25, 25, 26, 26, 27, 28, 28, 29, 30, 30, 31, + 32, 32, 33, 34, 35, 35, 36, 37, 38, 39, 39, 40, 41, 42, 43, 44, + 45, 46, 47, 48, 49, 50, 51, 53, 54, 55, 56, 57, 59, 60, 61, 63, + 64, 65, 67, 68, 70, 71, 73, 75, 76, 78, 80, 82, 83, 85, 87, 89, + 91, 93, 95, 97, 99, 102, 104, 106, 109, 111, 113, 116, 118, 121, + 124, 127 +}; + +static int panf(int pan, int speaker, int separation) +{ + int val; + val = abs(pan - speaker); + val = (val * 127) / separation; + val = 127 - val; + if (val < 0) val = 0; + if (val > 127) val = 127; + return expr_curve[val]; +} + + +static int vcurve[128] = { +0,0,18,29,36,42,47,51,55,58, +60,63,65,67,69,71,73,74,76,77, +79,80,81,82,83,84,85,86,87,88, +89,90,91,92,92,93,94,95,95,96, +97,97,98,99,99,100,100,101,101,102, +103,103,104,104,105,105,106,106,106,107, +107,108,108,109,109,109,110,110,111,111, +111,112,112,112,113,113,114,114,114,115, +115,115,116,116,116,116,117,117,117,118, +118,118,119,119,119,119,120,120,120,120, +121,121,121,122,122,122,122,123,123,123, +123,123,124,124,124,124,125,125,125,125, +126,126,126,126,126,127,127,127 +}; + +static void recompute_amp(int v) +{ + int32 tempamp; + int chan = voice[v].channel; + int panning = voice[v].panning; + int vol = channel[chan].volume; + int expr = channel[chan].expression; + int vel = vcurve[voice[v].velocity]; + FLOAT_T curved_expression, curved_volume; + + if (channel[chan].kit) + { + int note = voice[v].sample->note_to_use; + if (note>0 && drumvolume[chan][note]>=0) vol = drumvolume[chan][note]; + if (note>0 && drumpanpot[chan][note]>=0) panning = drumvolume[chan][note]; + } + + if (opt_expression_curve == 2) curved_expression = 127.0 * vol_table[expr]; + else if (opt_expression_curve == 1) curved_expression = 127.0 * expr_table[expr]; + else curved_expression = (FLOAT_T)expr; + + if (opt_volume_curve == 2) curved_volume = 127.0 * vol_table[vol]; + else if (opt_volume_curve == 1) curved_volume = 127.0 * expr_table[vol]; + else curved_volume = (FLOAT_T)vol; + + tempamp= (int32)((FLOAT_T)vel * curved_volume * curved_expression); /* 21 bits */ + + /* TODO: use fscale */ + + if (num_ochannels > 1) + { + if (panning > 60 && panning < 68) + { + voice[v].panned=PANNED_CENTER; + + if (num_ochannels == 6) voice[v].left_amp = + FSCALENEG((double) (tempamp) * voice[v].sample->volume * + master_volume, 20); + else voice[v].left_amp= + FSCALENEG((double)(tempamp) * voice[v].sample->volume * + master_volume, 21); + } + else if (panning<5) + { + voice[v].panned = PANNED_LEFT; + + voice[v].left_amp= + FSCALENEG((double)(tempamp) * voice[v].sample->volume * master_volume, + 20); + } + else if (panning>123) + { + voice[v].panned = PANNED_RIGHT; + + voice[v].left_amp= /* left_amp will be used */ + FSCALENEG((double)(tempamp) * voice[v].sample->volume * master_volume, + 20); + } + else + { + FLOAT_T refv = (double)(tempamp) * voice[v].sample->volume * master_volume; + int wide_panning = 64; + + if (num_ochannels == 4) wide_panning = 95; + + voice[v].panned = PANNED_MYSTERY; + voice[v].lfe_amp = FSCALENEG(refv * 64, 27); + + switch (num_ochannels) + { + case 2: + voice[v].lr_amp = 0; + voice[v].left_amp = FSCALENEG(refv * (128-panning), 27); + voice[v].ce_amp = 0; + voice[v].right_amp = FSCALENEG(refv * panning, 27); + voice[v].rr_amp = 0; + break; + case 4: + voice[v].lr_amp = FSCALENEG(refv * panf(panning, 0, wide_panning), 27); + voice[v].left_amp = FSCALENEG(refv * panf(panning, 32, wide_panning), 27); + voice[v].ce_amp = 0; + voice[v].right_amp = FSCALENEG(refv * panf(panning, 95, wide_panning), 27); + voice[v].rr_amp = FSCALENEG(refv * panf(panning, 128, wide_panning), 27); + break; + case 6: + voice[v].lr_amp = FSCALENEG(refv * panf(panning, 0, wide_panning), 27); + voice[v].left_amp = FSCALENEG(refv * panf(panning, 32, wide_panning), 27); + voice[v].ce_amp = FSCALENEG(refv * panf(panning, 64, wide_panning), 27); + voice[v].right_amp = FSCALENEG(refv * panf(panning, 95, wide_panning), 27); + voice[v].rr_amp = FSCALENEG(refv * panf(panning, 128, wide_panning), 27); + break; + } + + } + } + else + { + voice[v].panned=PANNED_CENTER; + + voice[v].left_amp= + FSCALENEG((double)(tempamp) * voice[v].sample->volume * master_volume, + 21); + } +} + + +#define NOT_CLONE 0 +#define STEREO_CLONE 1 +#define REVERB_CLONE 2 +#define CHORUS_CLONE 3 + + +/* just a variant of note_on() */ +static int vc_alloc(int j) +{ + int i=voices; + + while (i--) + { + if (i == j) continue; + if (voice[i].status & VOICE_FREE) { + return i; + } + } + return -1; +} + +static void kill_note(int i); + +static void kill_others(int i) +{ + int j=voices; + + if (!voice[i].sample->exclusiveClass) return; + + while (j--) + { + if (voice[j].status & (VOICE_FREE|VOICE_OFF|VOICE_DIE)) continue; + if (i == j) continue; + if (voice[i].channel != voice[j].channel) continue; + if (voice[j].sample->note_to_use) + { + if (voice[j].sample->exclusiveClass != voice[i].sample->exclusiveClass) continue; + kill_note(j); + } + } +} + + +static void clone_voice(Instrument *ip, int v, MidiEvent *e, int clone_type, int variationbank) +{ + int w, played_note, chorus=0, reverb=0, milli; + int chan = voice[v].channel; + + if (clone_type == STEREO_CLONE) { + if (!voice[v].right_sample && variationbank != 3) return; + if (variationbank == 6) return; + } + + if (channel[chan].kit) { + reverb = drumreverberation[chan][voice[v].note]; + chorus = drumchorusdepth[chan][voice[v].note]; + } + else { + reverb = channel[chan].reverberation; + chorus = channel[chan].chorusdepth; + } + + if (clone_type == REVERB_CLONE) chorus = 0; + else if (clone_type == CHORUS_CLONE) reverb = 0; + else if (clone_type == STEREO_CLONE) reverb = chorus = 0; + + if (reverb > 127) reverb = 127; + if (chorus > 127) chorus = 127; + + if (clone_type == CHORUS_CLONE) { + if (variationbank == 32) chorus = 30; + else if (variationbank == 33) chorus = 60; + else if (variationbank == 34) chorus = 90; + } + + chorus /= 2; /* This is an ad hoc adjustment. */ + + if (!reverb && !chorus && clone_type != STEREO_CLONE) return; + + if ( (w = vc_alloc(v)) < 0 ) return; + + voice[w] = voice[v]; + if (clone_type==STEREO_CLONE) voice[v].clone_voice = w; + voice[w].clone_voice = v; + voice[w].clone_type = clone_type; + + voice[w].sample = voice[v].right_sample; + voice[w].velocity= e->b; + + milli = play_mode->rate/1000; + + if (clone_type == STEREO_CLONE) { + int left, right, leftpan, rightpan; + int panrequest = voice[v].panning; + if (variationbank == 3) { + voice[v].panning = 0; + voice[w].panning = 127; + } + else { + if (voice[v].sample->panning > voice[w].sample->panning) { + left = w; + right = v; + } + else { + left = v; + right = w; + } +#define INSTRUMENT_SEPARATION 12 + leftpan = panrequest - INSTRUMENT_SEPARATION / 2; + rightpan = leftpan + INSTRUMENT_SEPARATION; + if (leftpan < 0) { + leftpan = 0; + rightpan = leftpan + INSTRUMENT_SEPARATION; + } + if (rightpan > 127) { + rightpan = 127; + leftpan = rightpan - INSTRUMENT_SEPARATION; + } + voice[left].panning = leftpan; + voice[right].panning = rightpan; + voice[right].echo_delay = 20 * milli; + } + } + + voice[w].volume = voice[w].sample->volume; + + if (reverb) { + if (opt_stereo_surround) { + if (voice[w].panning > 64) voice[w].panning = 127; + else voice[w].panning = 0; + } + else { + if (voice[v].panning < 64) voice[w].panning = 64 + reverb/2; + else voice[w].panning = 64 - reverb/2; + } + +/* try 98->99 for melodic instruments ? (bit much for percussion) */ + voice[w].volume *= vol_table[(127-reverb)/8 + 98]; + + voice[w].echo_delay += reverb * milli; + voice[w].envelope_rate[DECAY] *= 2; + voice[w].envelope_rate[RELEASE] /= 2; + + if (XG_System_reverb_type >= 0) { + int subtype = XG_System_reverb_type & 0x07; + int rtype = XG_System_reverb_type >>3; + switch (rtype) { + case 0: /* no effect */ + break; + case 1: /* hall */ + if (subtype) voice[w].echo_delay += 100 * milli; + break; + case 2: /* room */ + voice[w].echo_delay /= 2; + break; + case 3: /* stage */ + voice[w].velocity = voice[v].velocity; + break; + case 4: /* plate */ + voice[w].panning = voice[v].panning; + break; + case 16: /* white room */ + voice[w].echo_delay = 0; + break; + case 17: /* tunnel */ + voice[w].echo_delay *= 2; + voice[w].velocity /= 2; + break; + case 18: /* canyon */ + voice[w].echo_delay *= 2; + break; + case 19: /* basement */ + voice[w].velocity /= 2; + break; + default: break; + } + } + } + played_note = voice[w].sample->note_to_use; + if (!played_note) { + played_note = e->a & 0x7f; + if (variationbank == 35) played_note += 12; + else if (variationbank == 36) played_note -= 12; + else if (variationbank == 37) played_note += 7; + else if (variationbank == 36) played_note -= 7; + } +#if 0 + played_note = ( (played_note - voice[w].sample->freq_center) * voice[w].sample->freq_scale ) / 1024 + + voice[w].sample->freq_center; +#endif + voice[w].note = played_note; + voice[w].orig_frequency = freq_table[played_note]; + + if (chorus) { + if (opt_stereo_surround) { + if (voice[v].panning < 64) voice[w].panning = voice[v].panning + 32; + else voice[w].panning = voice[v].panning - 32; + } + + if (!voice[w].vibrato_control_ratio) { + voice[w].vibrato_control_ratio = 100; + voice[w].vibrato_depth = 6; + voice[w].vibrato_sweep = 74; + } + voice[w].volume *= 0.40; + voice[v].volume = voice[w].volume; + recompute_amp(v); + apply_envelope_to_amp(v); + voice[w].vibrato_sweep = chorus/2; + voice[w].vibrato_depth /= 2; + if (!voice[w].vibrato_depth) voice[w].vibrato_depth = 2; + voice[w].vibrato_control_ratio /= 2; + voice[w].echo_delay += 30 * milli; + + if (XG_System_chorus_type >= 0) { + int subtype = XG_System_chorus_type & 0x07; + int chtype = 0x0f & (XG_System_chorus_type >> 3); + switch (chtype) { + case 0: /* no effect */ + break; + case 1: /* chorus */ + chorus /= 3; + if(channel[ voice[w].channel ].pitchbend + chorus < 0x2000) + voice[w].orig_frequency = + (uint32)( (FLOAT_T)voice[w].orig_frequency * bend_fine[chorus] ); + else voice[w].orig_frequency = + (uint32)( (FLOAT_T)voice[w].orig_frequency / bend_fine[chorus] ); + if (subtype) voice[w].vibrato_depth *= 2; + break; + case 2: /* celeste */ + voice[w].orig_frequency += (voice[w].orig_frequency/128) * chorus; + break; + case 3: /* flanger */ + voice[w].vibrato_control_ratio = 10; + voice[w].vibrato_depth = 100; + voice[w].vibrato_sweep = 8; + voice[w].echo_delay += 200 * milli; + break; + case 4: /* symphonic : cf Children of the Night /128 bad, /1024 ok */ + voice[w].orig_frequency += (voice[w].orig_frequency/512) * chorus; + voice[v].orig_frequency -= (voice[v].orig_frequency/512) * chorus; + recompute_freq(v); + break; + case 8: /* phaser */ + break; + default: + break; + } + } + else { + chorus /= 3; + if(channel[ voice[w].channel ].pitchbend + chorus < 0x2000) + voice[w].orig_frequency = + (uint32)( (FLOAT_T)voice[w].orig_frequency * bend_fine[chorus] ); + else voice[w].orig_frequency = + (uint32)( (FLOAT_T)voice[w].orig_frequency / bend_fine[chorus] ); + } + } +#if 0 + voice[w].loop_start = voice[w].sample->loop_start; + voice[w].loop_end = voice[w].sample->loop_end; +#endif + voice[w].echo_delay_count = voice[w].echo_delay; + if (reverb) voice[w].echo_delay *= 2; + + recompute_freq(w); + recompute_amp(w); + if (voice[w].sample->modes & MODES_ENVELOPE) + { + /* Ramp up from 0 */ + voice[w].envelope_stage=ATTACK; + voice[w].modulation_stage=ATTACK; + voice[w].envelope_volume=0; + voice[w].modulation_volume=0; + voice[w].control_counter=0; + voice[w].modulation_counter=0; + recompute_envelope(w); + /*recompute_modulation(w);*/ + } + else + { + voice[w].envelope_increment=0; + voice[w].modulation_increment=0; + } + apply_envelope_to_amp(w); +} + + +static void xremap(int *banknumpt, int *this_notept, int this_kit) { + int i, newmap; + int banknum = *banknumpt; + int this_note = *this_notept; + int newbank, newnote; + + if (!this_kit) { + if (banknum == SFXBANK && tonebank[SFXBANK]) return; + if (banknum == SFXBANK && tonebank[120]) *banknumpt = 120; + return; + } + + if (this_kit != 127 && this_kit != 126) return; + + for (i = 0; i < XMAPMAX; i++) { + newmap = xmap[i][0]; + if (!newmap) return; + if (this_kit == 127 && newmap != XGDRUM) continue; + if (this_kit == 126 && newmap != SFXDRUM1) continue; + if (xmap[i][1] != banknum) continue; + if (xmap[i][3] != this_note) continue; + newbank = xmap[i][2]; + newnote = xmap[i][4]; + if (newbank == banknum && newnote == this_note) return; + if (!drumset[newbank]) return; + if (!drumset[newbank]->tone[newnote].layer) return; + if (drumset[newbank]->tone[newnote].layer == MAGIC_LOAD_INSTRUMENT) return; + *banknumpt = newbank; + *this_notept = newnote; + return; + } +} + + +static void start_note(MidiEvent *e, int i) +{ + InstrumentLayer *lp; + Instrument *ip; + int j, banknum, ch=e->channel; + int played_note, drumpan=NO_PANNING; + int32 rt; + int attacktime, releasetime, decaytime, variationbank; + int brightness = channel[ch].brightness; + int harmoniccontent = channel[ch].harmoniccontent; + int this_note = e->a; + int this_velocity = e->b; + int drumsflag = channel[ch].kit; + int this_prog = channel[ch].program; + + if (channel[ch].sfx) banknum=channel[ch].sfx; + else banknum=channel[ch].bank; + + voice[i].velocity=this_velocity; + + if (XG_System_On) xremap(&banknum, &this_note, drumsflag); + /* if (current_config_pc42b) pcmap(&banknum, &this_note, &this_prog, &drumsflag); */ + + if (drumsflag) + { + if (!(lp=drumset[banknum]->tone[this_note].layer)) + { + if (!(lp=drumset[0]->tone[this_note].layer)) + return; /* No instrument? Then we can't play. */ + } + ip = lp->instrument; + if (ip->type == INST_GUS && ip->samples != 1) + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "Strange: percussion instrument with %d samples!", ip->samples); + } + + if (ip->sample->note_to_use) /* Do we have a fixed pitch? */ + { + voice[i].orig_frequency=freq_table[(int)(ip->sample->note_to_use)]; + drumpan=drumpanpot[ch][(int)ip->sample->note_to_use]; + } + else + voice[i].orig_frequency=freq_table[this_note & 0x7F]; + + } + else + { + if (channel[ch].program==SPECIAL_PROGRAM) + lp=default_instrument; + else if (!(lp=tonebank[channel[ch].bank]-> + tone[channel[ch].program].layer)) + { + if (!(lp=tonebank[0]->tone[this_prog].layer)) + return; /* No instrument? Then we can't play. */ + } + ip = lp->instrument; + if (ip->sample->note_to_use) /* Fixed-pitch instrument? */ + voice[i].orig_frequency=freq_table[(int)(ip->sample->note_to_use)]; + else + voice[i].orig_frequency=freq_table[this_note & 0x7F]; + } + + select_stereo_samples(i, lp); + + voice[i].starttime = e->time; + played_note = voice[i].sample->note_to_use; + + if (!played_note || !drumsflag) played_note = this_note & 0x7f; +#if 0 + played_note = ( (played_note - voice[i].sample->freq_center) * voice[i].sample->freq_scale ) / 1024 + + voice[i].sample->freq_center; +#endif + voice[i].status=VOICE_ON; + voice[i].channel=ch; + voice[i].note=played_note; + voice[i].velocity=this_velocity; + voice[i].sample_offset=0; + voice[i].sample_increment=0; /* make sure it isn't negative */ + + voice[i].tremolo_phase=0; + voice[i].tremolo_phase_increment=voice[i].sample->tremolo_phase_increment; + voice[i].tremolo_sweep=voice[i].sample->tremolo_sweep_increment; + voice[i].tremolo_sweep_position=0; + + voice[i].vibrato_sweep=voice[i].sample->vibrato_sweep_increment; + voice[i].vibrato_sweep_position=0; + voice[i].vibrato_depth=voice[i].sample->vibrato_depth; + voice[i].vibrato_control_ratio=voice[i].sample->vibrato_control_ratio; + voice[i].vibrato_control_counter=voice[i].vibrato_phase=0; + voice[i].vibrato_delay = voice[i].sample->vibrato_delay; + + kill_others(i); + + for (j=0; jcutoff_freq = 800; + break; + case 25: + voice[i].modEnvToFilterFc=-2.0; + voice[i].sample->cutoff_freq = 800; + break; + case 27: + voice[i].modLfoToFilterFc=2.0; + voice[i].lfo_phase_increment=109; + voice[i].lfo_sweep=122; + voice[i].sample->cutoff_freq = 800; + break; + case 28: + voice[i].modLfoToFilterFc=-2.0; + voice[i].lfo_phase_increment=109; + voice[i].lfo_sweep=122; + voice[i].sample->cutoff_freq = 800; + break; +#endif + default: + break; + } + + + for (j=ATTACK; jenvelope_rate[j]; + voice[i].envelope_offset[j]=voice[i].sample->envelope_offset[j]; + } + + voice[i].echo_delay=voice[i].envelope_rate[DELAY]; + voice[i].echo_delay_count = voice[i].echo_delay; + + if (attacktime!=64) + { + rt = voice[i].envelope_rate[ATTACK]; + rt = rt + ( (64-attacktime)*rt ) / 100; + if (rt > 1000) voice[i].envelope_rate[ATTACK] = rt; + } + if (releasetime!=64) + { + rt = voice[i].envelope_rate[RELEASE]; + rt = rt + ( (64-releasetime)*rt ) / 100; + if (rt > 1000) voice[i].envelope_rate[RELEASE] = rt; + } + if (decaytime!=64) + { + rt = voice[i].envelope_rate[DECAY]; + rt = rt + ( (64-decaytime)*rt ) / 100; + if (rt > 1000) voice[i].envelope_rate[DECAY] = rt; + } + + if (channel[ch].panning != NO_PANNING) + voice[i].panning=channel[ch].panning; + else + voice[i].panning=voice[i].sample->panning; + if (drumpan != NO_PANNING) + voice[i].panning=drumpan; + + if (variationbank == 1) { + int pan = voice[i].panning; + int disturb = 0; + /* If they're close up (no reverb) and you are behind the pianist, + * high notes come from the right, so we'll spread piano etc. notes + * out horizontally according to their pitches. + */ + if (this_prog < 21) { + int n = voice[i].velocity - 32; + if (n < 0) n = 0; + if (n > 64) n = 64; + pan = pan/2 + n; + } + /* For other types of instruments, the music sounds more alive if + * notes come from slightly different directions. However, instruments + * do drift around in a sometimes disconcerting way, so the following + * might not be such a good idea. + */ + else disturb = (voice[i].velocity/32 % 8) + + (voice[i].note % 8); /* /16? */ + + if (pan < 64) pan += disturb; + else pan -= disturb; + if (pan < 0) pan = 0; + else if (pan > 127) pan = 127; + voice[i].panning = pan; + } + + recompute_freq(i); + recompute_amp(i); + if (voice[i].sample->modes & MODES_ENVELOPE) + { + /* Ramp up from 0 */ + voice[i].envelope_stage=ATTACK; + voice[i].envelope_volume=0; + voice[i].control_counter=0; + recompute_envelope(i); + } + else + { + voice[i].envelope_increment=0; + } + apply_envelope_to_amp(i); + + voice[i].clone_voice = -1; + voice[i].clone_type = NOT_CLONE; + + clone_voice(ip, i, e, STEREO_CLONE, variationbank); + clone_voice(ip, i, e, CHORUS_CLONE, variationbank); + clone_voice(ip, i, e, REVERB_CLONE, variationbank); + + ctl->note(i); +} + +static void kill_note(int i) +{ + voice[i].status=VOICE_DIE; + if (voice[i].clone_voice >= 0) + voice[ voice[i].clone_voice ].status=VOICE_DIE; + ctl->note(i); +} + + +/* Only one instance of a note can be playing on a single channel. */ +static void note_on(MidiEvent *e) +{ + int i=voices, lowest=-1; + int32 lv=0x7FFFFFFF, v; + + while (i--) + { + if (voice[i].status == VOICE_FREE) + lowest=i; /* Can't get a lower volume than silence */ + else if (voice[i].channel==e->channel && + (voice[i].note==e->a || channel[voice[i].channel].mono)) + kill_note(i); + } + + if (lowest != -1) + { + /* Found a free voice. */ + start_note(e,lowest); + return; + } + +#if 0 + /* Look for the decaying note with the lowest volume */ + i=voices; + while (i--) + { + if (voice[i].status & ~(VOICE_ON | VOICE_DIE | VOICE_FREE)) + { + v=voice[i].left_mix; + if ((voice[i].panned==PANNED_MYSTERY) && (voice[i].right_mix>v)) + v=voice[i].right_mix; + if (vv)) + v=voice[i].right_mix; + if (v= 0) { + if (voice[cl].clone_type==STEREO_CLONE || + (!voice[cl].clone_type && voice[lowest].clone_type==STEREO_CLONE)) + voice[cl].status=VOICE_FREE; + else if (voice[cl].clone_voice==lowest) voice[cl].clone_voice=-1; + } + + cut_notes++; + voice[lowest].status=VOICE_FREE; + ctl->note(lowest); + start_note(e,lowest); + } + else + lost_notes++; +} + +static void finish_note(int i) +{ + if (voice[i].sample->modes & MODES_ENVELOPE) + { + /* We need to get the envelope out of Sustain stage */ + voice[i].envelope_stage=3; + voice[i].status=VOICE_OFF; + recompute_envelope(i); + apply_envelope_to_amp(i); + ctl->note(i); + } + else + { + /* Set status to OFF so resample_voice() will let this voice out + of its loop, if any. In any case, this voice dies when it + hits the end of its data (ofs>=data_length). */ + voice[i].status=VOICE_OFF; + } + + { int v; + if ( (v=voice[i].clone_voice) >= 0) + { + voice[i].clone_voice = -1; + finish_note(v); + } + } +} + +static void note_off(MidiEvent *e) +{ + int i=voices, v; + while (i--) + if (voice[i].status==VOICE_ON && + voice[i].channel==e->channel && + voice[i].note==e->a) + { + if (channel[e->channel].sustain) + { + voice[i].status=VOICE_SUSTAINED; + + if ( (v=voice[i].clone_voice) >= 0) + { + if (voice[v].status == VOICE_ON) + voice[v].status=VOICE_SUSTAINED; + } + + ctl->note(i); + } + else + finish_note(i); + return; + } +} + +/* Process the All Notes Off event */ +static void all_notes_off(int c) +{ + int i=voices; + ctl->cmsg(CMSG_INFO, VERB_DEBUG, "All notes off on channel %d", c); + while (i--) + if (voice[i].status==VOICE_ON && + voice[i].channel==c) + { + if (channel[c].sustain) + { + voice[i].status=VOICE_SUSTAINED; + ctl->note(i); + } + else + finish_note(i); + } +} + +/* Process the All Sounds Off event */ +static void all_sounds_off(int c) +{ + int i=voices; + while (i--) + if (voice[i].channel==c && + voice[i].status != VOICE_FREE && + voice[i].status != VOICE_DIE) + { + kill_note(i); + } +} + +static void adjust_pressure(MidiEvent *e) +{ + int i=voices; + while (i--) + if (voice[i].status==VOICE_ON && + voice[i].channel==e->channel && + voice[i].note==e->a) + { + voice[i].velocity=e->b; + recompute_amp(i); + apply_envelope_to_amp(i); + return; + } +} + +static void adjust_panning(int c) +{ + int i=voices; + while (i--) + if ((voice[i].channel==c) && + (voice[i].status==VOICE_ON || voice[i].status==VOICE_SUSTAINED)) + { + if (voice[i].clone_type != NOT_CLONE) continue; + voice[i].panning=channel[c].panning; + recompute_amp(i); + apply_envelope_to_amp(i); + } +} + +static void drop_sustain(int c) +{ + int i=voices; + while (i--) + if (voice[i].status==VOICE_SUSTAINED && voice[i].channel==c) + finish_note(i); +} + +static void adjust_pitchbend(int c) +{ + int i=voices; + while (i--) + if (voice[i].status!=VOICE_FREE && voice[i].channel==c) + { + recompute_freq(i); + } +} + +static void adjust_volume(int c) +{ + int i=voices; + while (i--) + if (voice[i].channel==c && + (voice[i].status==VOICE_ON || voice[i].status==VOICE_SUSTAINED)) + { + recompute_amp(i); + apply_envelope_to_amp(i); + } +} + +static void seek_forward(int32 until_time) +{ + reset_voices(); + while (current_event->time < until_time) + { + switch(current_event->type) + { + /* All notes stay off. Just handle the parameter changes. */ + + case ME_PITCH_SENS: + channel[current_event->channel].pitchsens= + current_event->a; + channel[current_event->channel].pitchfactor=0; + break; + + case ME_PITCHWHEEL: + channel[current_event->channel].pitchbend= + current_event->a + current_event->b * 128; + channel[current_event->channel].pitchfactor=0; + break; + + case ME_MAINVOLUME: + channel[current_event->channel].volume=current_event->a; + break; + + case ME_MASTERVOLUME: + adjust_master_volume(current_event->a + (current_event->b <<7)); + break; + + case ME_PAN: + channel[current_event->channel].panning=current_event->a; + break; + + case ME_EXPRESSION: + channel[current_event->channel].expression=current_event->a; + break; + + case ME_PROGRAM: + /* if (ISDRUMCHANNEL(current_event->channel)) */ + if (channel[current_event->channel].kit) + /* Change drum set */ + channel[current_event->channel].bank=current_event->a; + else + channel[current_event->channel].program=current_event->a; + break; + + case ME_SUSTAIN: + channel[current_event->channel].sustain=current_event->a; + break; + + + case ME_REVERBERATION: + channel[current_event->channel].reverberation=current_event->a; + break; + + case ME_CHORUSDEPTH: + channel[current_event->channel].chorusdepth=current_event->a; + break; + + case ME_HARMONICCONTENT: + channel[current_event->channel].harmoniccontent=current_event->a; + break; + + case ME_RELEASETIME: + channel[current_event->channel].releasetime=current_event->a; + break; + + case ME_ATTACKTIME: + channel[current_event->channel].attacktime=current_event->a; + break; + + case ME_BRIGHTNESS: + channel[current_event->channel].brightness=current_event->a; + break; + + case ME_TONE_KIT: + if (current_event->a==SFX_BANKTYPE) + { + channel[current_event->channel].sfx=SFXBANK; + channel[current_event->channel].kit=0; + } + else + { + channel[current_event->channel].sfx=0; + channel[current_event->channel].kit=current_event->a; + } + break; + + + case ME_RESET_CONTROLLERS: + reset_controllers(current_event->channel); + break; + + case ME_TONE_BANK: + channel[current_event->channel].bank=current_event->a; + break; + + case ME_EOT: + current_sample=current_event->time; + return; + } + current_event++; + } + /*current_sample=current_event->time;*/ + if (current_event != event_list) + current_event--; + current_sample=until_time; +} + +static void skip_to(int32 until_time) +{ + if (current_sample > until_time) + current_sample=0; + + reset_midi(); + buffered_count=0; + buffer_pointer=common_buffer; + current_event=event_list; + + if (until_time) + seek_forward(until_time); + ctl->reset(); +} + +static int apply_controls(void) +{ + int rc, i, did_skip=0; + int32 val; + /* ASCII renditions of CD player pictograms indicate approximate effect */ + do + switch(rc=ctl->read(&val)) + { + case RC_QUIT: /* [] */ + case RC_LOAD_FILE: + case RC_NEXT: /* >>| */ + case RC_REALLY_PREVIOUS: /* |<< */ + return rc; + + case RC_CHANGE_VOLUME: + if (val>0 || amplification > -val) + amplification += val; + else + amplification=0; + if (amplification > MAX_AMPLIFICATION) + amplification=MAX_AMPLIFICATION; + adjust_amplification(); + for (i=0; imaster_volume(amplification); + break; + + case RC_PREVIOUS: /* |<< */ + if (current_sample < 2*play_mode->rate) + return RC_REALLY_PREVIOUS; + return RC_RESTART; + + case RC_RESTART: /* |<< */ + skip_to(0); + did_skip=1; + break; + + case RC_JUMP: + if (val >= sample_count) + return RC_NEXT; + skip_to(val); + return rc; + + case RC_FORWARD: /* >> */ + if (val+current_sample >= sample_count) + return RC_NEXT; + skip_to(val+current_sample); + did_skip=1; + break; + + case RC_BACK: /* << */ + if (current_sample > val) + skip_to(current_sample-val); + else + skip_to(0); /* We can't seek to end of previous song. */ + did_skip=1; + break; + } + while (rc!= RC_NONE); + + /* Advertise the skip so that we stop computing the audio buffer */ + if (did_skip) + return RC_JUMP; + else + return rc; +} + +static void do_compute_data(uint32 count) +{ + int i; + if (!count) return; /* (gl) */ + memset(buffer_pointer, 0, count * num_ochannels * 4); + for (i=0; i= count) voice[i].echo_delay_count -= count; + else + { + mix_voice(buffer_pointer+voice[i].echo_delay_count, i, count-voice[i].echo_delay_count); + voice[i].echo_delay_count = 0; + } + } + else mix_voice(buffer_pointer, i, count); + } + } + current_sample += count; +} + + +/* count=0 means flush remaining buffered data to output device, then + flush the device itself */ +static int compute_data(void *stream, int32 count) +{ + int rc, channels; + + if ( play_mode->encoding & PE_MONO ) + channels = 1; + else + channels = num_ochannels; + + if (!count) + { + if (buffered_count) + s32tobuf(stream, common_buffer, channels*buffered_count); + buffer_pointer=common_buffer; + buffered_count=0; + return RC_NONE; + } + + while ((count+buffered_count) >= AUDIO_BUFFER_SIZE) + { + do_compute_data(AUDIO_BUFFER_SIZE-buffered_count); + count -= AUDIO_BUFFER_SIZE-buffered_count; + s32tobuf(stream, common_buffer, channels*AUDIO_BUFFER_SIZE); + buffer_pointer=common_buffer; + buffered_count=0; + + ctl->current_time(current_sample); + if ((rc=apply_controls())!=RC_NONE) + return rc; + } + if (count>0) + { + do_compute_data(count); + buffered_count += count; + buffer_pointer += count * channels; + } + return RC_NONE; +} + +int Timidity_PlaySome(void *stream, int samples) +{ + //printf("Timidity_PlaySome()\n"); + int rc = RC_NONE; + int32 end_sample; + + if ( ! midi_playing ) { + return RC_NONE; + } + end_sample = current_sample+samples; + while ( current_sample < end_sample ) { + /* Handle all events that should happen at this time */ + while (current_event->time <= current_sample) { + switch(current_event->type) { + + /* Effects affecting a single note */ + + case ME_NOTEON: + current_event->a += channel[current_event->channel].transpose; + if (!(current_event->b)) /* Velocity 0? */ + note_off(current_event); + else + note_on(current_event); + break; + + case ME_NOTEOFF: + current_event->a += channel[current_event->channel].transpose; + note_off(current_event); + break; + + case ME_KEYPRESSURE: + adjust_pressure(current_event); + break; + + /* Effects affecting a single channel */ + + case ME_PITCH_SENS: + channel[current_event->channel].pitchsens=current_event->a; + channel[current_event->channel].pitchfactor=0; + break; + + case ME_PITCHWHEEL: + channel[current_event->channel].pitchbend= + current_event->a + current_event->b * 128; + channel[current_event->channel].pitchfactor=0; + /* Adjust pitch for notes already playing */ + adjust_pitchbend(current_event->channel); + ctl->pitch_bend(current_event->channel, + channel[current_event->channel].pitchbend); + break; + + case ME_MAINVOLUME: + channel[current_event->channel].volume=current_event->a; + adjust_volume(current_event->channel); + ctl->volume(current_event->channel, current_event->a); + break; + + case ME_MASTERVOLUME: + adjust_master_volume(current_event->a + (current_event->b <<7)); + break; + + case ME_REVERBERATION: + channel[current_event->channel].reverberation=current_event->a; + break; + + case ME_CHORUSDEPTH: + channel[current_event->channel].chorusdepth=current_event->a; + break; + + case ME_PAN: + channel[current_event->channel].panning=current_event->a; + if (adjust_panning_immediately) + adjust_panning(current_event->channel); + ctl->panning(current_event->channel, current_event->a); + break; + + case ME_EXPRESSION: + channel[current_event->channel].expression=current_event->a; + adjust_volume(current_event->channel); + ctl->expression(current_event->channel, current_event->a); + break; + + case ME_PROGRAM: + /* if (ISDRUMCHANNEL(current_event->channel)) { */ + if (channel[current_event->channel].kit) { + /* Change drum set */ + channel[current_event->channel].bank=current_event->a; + } + else + { + channel[current_event->channel].program=current_event->a; + } + ctl->program(current_event->channel, current_event->a); + break; + + case ME_SUSTAIN: + channel[current_event->channel].sustain=current_event->a; + if (!current_event->a) + drop_sustain(current_event->channel); + ctl->sustain(current_event->channel, current_event->a); + break; + + case ME_RESET_CONTROLLERS: + reset_controllers(current_event->channel); + redraw_controllers(current_event->channel); + break; + + case ME_ALL_NOTES_OFF: + all_notes_off(current_event->channel); + break; + + case ME_ALL_SOUNDS_OFF: + all_sounds_off(current_event->channel); + break; + + case ME_HARMONICCONTENT: + channel[current_event->channel].harmoniccontent=current_event->a; + break; + + case ME_RELEASETIME: + channel[current_event->channel].releasetime=current_event->a; + break; + + case ME_ATTACKTIME: + channel[current_event->channel].attacktime=current_event->a; + break; + + case ME_BRIGHTNESS: + channel[current_event->channel].brightness=current_event->a; + break; + + case ME_TONE_BANK: + channel[current_event->channel].bank=current_event->a; + break; + + + case ME_TONE_KIT: + if (current_event->a==SFX_BANKTYPE) + { + channel[current_event->channel].sfx=SFXBANK; + channel[current_event->channel].kit=0; + } + else + { + channel[current_event->channel].sfx=0; + channel[current_event->channel].kit=current_event->a; + } + break; + + case ME_EOT: + /* Give the last notes a couple of seconds to decay */ + ctl->cmsg(CMSG_INFO, VERB_VERBOSE, + "Playing time: ~%d seconds", current_sample/play_mode->rate+2); + ctl->cmsg(CMSG_INFO, VERB_VERBOSE, + "Notes cut: %d", cut_notes); + ctl->cmsg(CMSG_INFO, VERB_VERBOSE, + "Notes lost totally: %d", lost_notes); + midi_playing = 0; + return RC_TUNE_END; + } + current_event++; + } + if (current_event->time > end_sample) + rc=compute_data(stream, end_sample-current_sample); + else + rc=compute_data(stream, current_event->time-current_sample); + ctl->refresh(); + if ( (rc!=RC_NONE) && (rc!=RC_JUMP)) + break; + } + return rc; +} + + +void Timidity_SetVolume(int volume) +{ + int i; + if (volume > MAX_AMPLIFICATION) + amplification=MAX_AMPLIFICATION; + else + if (volume < 0) + amplification=0; + else + amplification=volume; + adjust_amplification(); + for (i=0; imaster_volume(amplification); +} + +MidiSong *Timidity_LoadSong_RW(SDL_RWops *rw, int freerw) +{ + MidiSong *song; + int32 events; + + /* Allocate memory for the song */ + song = (MidiSong *)safe_malloc(sizeof(*song)); + memset(song, 0, sizeof(*song)); + + strcpy(midi_name, "SDLrwops source"); + + song->events = read_midi_file(rw, &events, &song->samples); + if (freerw) { + SDL_RWclose(rw); + } + + /* Make sure everything is okay */ + if (!song->events) { + free(song); + song = NULL; + } + return(song); +} + +void Timidity_Start(MidiSong *song) +{ + load_missing_instruments(); + adjust_amplification(); + sample_count = song->samples; + event_list = song->events; + lost_notes=cut_notes=0; + //printf("Timidity: playing song with %d samples\n", sample_count); + + skip_to(0); + midi_playing = 1; +} + +int Timidity_Active(void) +{ + return(midi_playing); +} + +void Timidity_Stop(void) +{ + midi_playing = 0; +} + +void Timidity_FreeSong(MidiSong *song) +{ + if (free_instruments_afterwards) + free_instruments(); + + free(song->events); + free(song); +} + +void Timidity_Close(void) +{ + if (resample_buffer) { + free(resample_buffer); + resample_buffer=NULL; + } + if (common_buffer) { + free(common_buffer); + common_buffer=NULL; + } + free_instruments(); + free_pathlist(); +} + diff --git a/apps/plugins/sdl/SDL_mixer/timidity/playmidi.h b/apps/plugins/sdl/SDL_mixer/timidity/playmidi.h new file mode 100644 index 0000000..2a32d7e --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/playmidi.h @@ -0,0 +1,160 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +typedef struct { + int32 time; + uint8 channel, type, a, b; +} MidiEvent; + +/* Midi events */ +#define ME_NONE 0 +#define ME_NOTEON 1 +#define ME_NOTEOFF 2 +#define ME_KEYPRESSURE 3 +#define ME_MAINVOLUME 4 +#define ME_PAN 5 +#define ME_SUSTAIN 6 +#define ME_EXPRESSION 7 +#define ME_PITCHWHEEL 8 +#define ME_PROGRAM 9 +#define ME_TEMPO 10 +#define ME_PITCH_SENS 11 + +#define ME_ALL_SOUNDS_OFF 12 +#define ME_RESET_CONTROLLERS 13 +#define ME_ALL_NOTES_OFF 14 +#define ME_TONE_BANK 15 + +#define ME_LYRIC 16 +#define ME_TONE_KIT 17 +#define ME_MASTERVOLUME 18 +#define ME_CHANNEL_PRESSURE 19 + +#define ME_HARMONICCONTENT 71 +#define ME_RELEASETIME 72 +#define ME_ATTACKTIME 73 +#define ME_BRIGHTNESS 74 + +#define ME_REVERBERATION 91 +#define ME_CHORUSDEPTH 93 + +#define ME_EOT 99 + + +#define SFX_BANKTYPE 64 + +typedef struct { + int + bank, program, volume, sustain, panning, pitchbend, expression, + mono, /* one note only on this channel -- not implemented yet */ + /* new stuff */ + variationbank, reverberation, chorusdepth, harmoniccontent, + releasetime, attacktime, brightness, kit, sfx, + /* end new */ + pitchsens; + FLOAT_T + pitchfactor; /* precomputed pitch bend factor to save some fdiv's */ + char transpose; + char *name; +} Channel; + +/* Causes the instrument's default panning to be used. */ +#define NO_PANNING -1 +/* envelope points */ +#define MAXPOINT 7 + +typedef struct { + uint8 + status, channel, note, velocity, clone_type; + Sample *sample; + Sample *left_sample; + Sample *right_sample; + int32 clone_voice; + int32 + orig_frequency, frequency, + sample_offset, loop_start, loop_end; + int32 + envelope_volume, modulation_volume; + int32 + envelope_target, modulation_target; + int32 + tremolo_sweep, tremolo_sweep_position, tremolo_phase, + lfo_sweep, lfo_sweep_position, lfo_phase, + vibrato_sweep, vibrato_sweep_position, vibrato_depth, vibrato_delay, + starttime, echo_delay_count; + int32 + echo_delay, + sample_increment, + envelope_increment, + modulation_increment, + tremolo_phase_increment, + lfo_phase_increment; + + final_volume_t left_mix, right_mix, lr_mix, rr_mix, ce_mix, lfe_mix; + + FLOAT_T + left_amp, right_amp, lr_amp, rr_amp, ce_amp, lfe_amp, + volume, tremolo_volume, lfo_volume; + int32 + vibrato_sample_increment[VIBRATO_SAMPLE_INCREMENTS]; + int32 + envelope_rate[MAXPOINT], envelope_offset[MAXPOINT]; + int32 + vibrato_phase, vibrato_control_ratio, vibrato_control_counter, + envelope_stage, modulation_stage, control_counter, + modulation_delay, modulation_counter, panning, panned; +} Voice; + +/* Voice status options: */ +#define VOICE_FREE 0 +#define VOICE_ON 1 +#define VOICE_SUSTAINED 2 +#define VOICE_OFF 3 +#define VOICE_DIE 4 + +/* Voice panned options: */ +#define PANNED_MYSTERY 0 +#define PANNED_LEFT 1 +#define PANNED_RIGHT 2 +#define PANNED_CENTER 3 +/* Anything but PANNED_MYSTERY only uses the left volume */ + +/* Envelope stages: */ +#define ATTACK 0 +#define HOLD 1 +#define DECAY 2 +#define RELEASE 3 +#define RELEASEB 4 +#define RELEASEC 5 +#define DELAY 6 + +extern Channel channel[16]; +extern Voice voice[MAX_VOICES]; +extern signed char drumvolume[MAXCHAN][MAXNOTE]; +extern signed char drumpanpot[MAXCHAN][MAXNOTE]; +extern signed char drumreverberation[MAXCHAN][MAXNOTE]; +extern signed char drumchorusdepth[MAXCHAN][MAXNOTE]; + +extern int32 control_ratio, amp_with_poly, amplification; +extern int32 drumchannels; +extern int adjust_panning_immediately; +extern int voices; + +#define ISDRUMCHANNEL(c) ((drumchannels & (1<<(c)))) + +extern int GM_System_On; +extern int XG_System_On; +extern int GS_System_On; + +extern int XG_System_reverb_type; +extern int XG_System_chorus_type; +extern int XG_System_variation_type; + +extern int play_midi(MidiEvent *el, int32 events, int32 samples); +extern int play_midi_file(const char *fn); +extern void dumb_pass_playing_list(int number_of_files, char *list_of_files[]); diff --git a/apps/plugins/sdl/SDL_mixer/timidity/readmidi.c b/apps/plugins/sdl/SDL_mixer/timidity/readmidi.c new file mode 100644 index 0000000..afd3f9f --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/readmidi.c @@ -0,0 +1,1065 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include + +#include "config.h" +#include "common.h" +#include "instrum.h" +#include "playmidi.h" +#include "readmidi.h" +#include "output.h" +#include "ctrlmode.h" + +int32 quietchannels=0; + +static int midi_port_number; +char midi_name[FILENAME_MAX+1]; + +static int track_info, curr_track, curr_title_track; +static char title[128]; + +#if MAXCHAN <= 16 +#define MERGE_CHANNEL_PORT(ch) ((int)(ch)) +#else +#define MERGE_CHANNEL_PORT(ch) ((int)(ch) | (midi_port_number << 4)) +#endif + +/* to avoid some unnecessary parameter passing */ +static MidiEventList *evlist; +static int32 event_count; +static SDL_RWops *rw; +static int32 at; + +/* These would both fit into 32 bits, but they are often added in + large multiples, so it's simpler to have two roomy ints */ +static int32 sample_increment, sample_correction; /*samples per MIDI delta-t*/ + +/* Computes how many (fractional) samples one MIDI delta-time unit contains */ +static void compute_sample_increment(int32 tempo, int32 divisions) +{ + double a; + a = (double) (tempo) * (double) (play_mode->rate) * (65536.0/1000000.0) / + (double)(divisions); + + sample_correction = (int32)(a) & 0xFFFF; + sample_increment = (int32)(a) >> 16; + + ctl->cmsg(CMSG_INFO, VERB_DEBUG, "Samples per delta-t: %d (correction %d)", + sample_increment, sample_correction); +} + +/* Read variable-length number (7 bits per byte, MSB first) */ +static int32 getvl(void) +{ + int32 l=0; + uint8 c; + for (;;) + { + SDL_RWread(rw,&c,1,1); + l += (c & 0x7f); + if (!(c & 0x80)) return l; + l<<=7; + } +} + + +static int sysex(uint32 len, uint8 *syschan, uint8 *sysa, uint8 *sysb, SDL_RWops *rw) +{ + unsigned char *s=(unsigned char *)safe_malloc(len); + int id, model, ch, port, adhi, adlo, cd, dta, dtb, dtc; + if (len != (uint32)SDL_RWread(rw, s, 1, len)) + { + free(s); + return 0; + } + if (len<5) { free(s); return 0; } + if (curr_track == curr_title_track && track_info > 1) title[0] = '\0'; + id=s[0]; port=s[1]; model=s[2]; adhi=s[3]; adlo=s[4]; + if (id==0x7e && port==0x7f && model==0x09 && adhi==0x01) + { + ctl->cmsg(CMSG_TEXT, VERB_VERBOSE, "GM System On", len); + GM_System_On=1; + free(s); + return 0; + } + ch = adlo & 0x0f; + *syschan=(uint8)ch; + if (id==0x7f && len==7 && port==0x7f && model==0x04 && adhi==0x01) + { + ctl->cmsg(CMSG_TEXT, VERB_DEBUG, "Master Volume %d", s[4]+(s[5]<<7)); + *sysa = s[4]; + *sysb = s[5]; + free(s); + return ME_MASTERVOLUME; + /** return s[4]+(s[5]<<7); **/ + } + if (len<8) { free(s); return 0; } + port &=0x0f; + ch = (adlo & 0x0f) | ((port & 0x03) << 4); + *syschan=(uint8)ch; + cd=s[5]; dta=s[6]; + if (len >= 8) dtb=s[7]; + else dtb=-1; + if (len >= 9) dtc=s[8]; + else dtc=-1; + free(s); + if (id==0x43 && model==0x4c) + { + if (!adhi && !adlo && cd==0x7e && !dta) + { + ctl->cmsg(CMSG_TEXT, VERB_VERBOSE, "XG System On", len); + XG_System_On=1; + #ifdef tplus + vol_table = xg_vol_table; + #endif + } + else if (adhi == 2 && adlo == 1) + { + if (dtb==8) dtb=3; + switch (cd) + { + case 0x00: + XG_System_reverb_type=(dta<<3)+dtb; + break; + case 0x20: + XG_System_chorus_type=((dta-64)<<3)+dtb; + break; + case 0x40: + XG_System_variation_type=dta; + break; + case 0x5a: + /* dta==0 Insertion; dta==1 System */ + break; + default: break; + } + } + else if (adhi == 8 && cd <= 40) + { + *sysa = dta & 0x7f; + switch (cd) + { + case 0x01: /* bank select MSB */ + return ME_TONE_KIT; + break; + case 0x02: /* bank select LSB */ + return ME_TONE_BANK; + break; + case 0x03: /* program number */ + /** MIDIEVENT(d->at, ME_PROGRAM, lastchan, a, 0); **/ + return ME_PROGRAM; + break; + case 0x08: /* */ + /* d->channel[adlo&0x0f].transpose = (char)(dta-64); */ + channel[ch].transpose = (char)(dta-64); + ctl->cmsg(CMSG_TEXT, VERB_DEBUG, "transpose channel %d by %d", + (adlo&0x0f)+1, dta-64); + break; + case 0x0b: /* volume */ + return ME_MAINVOLUME; + break; + case 0x0e: /* pan */ + return ME_PAN; + break; + case 0x12: /* chorus send */ + return ME_CHORUSDEPTH; + break; + case 0x13: /* reverb send */ + return ME_REVERBERATION; + break; + case 0x14: /* variation send */ + break; + case 0x18: /* filter cutoff */ + return ME_BRIGHTNESS; + break; + case 0x19: /* filter resonance */ + return ME_HARMONICCONTENT; + break; + default: break; + } + } + return 0; + } + else if (id==0x41 && model==0x42 && adhi==0x12 && adlo==0x40) + { + if (dtc<0) return 0; + if (!cd && dta==0x7f && !dtb && dtc==0x41) + { + ctl->cmsg(CMSG_TEXT, VERB_VERBOSE, "GS System On", len); + GS_System_On=1; + #ifdef tplus + vol_table = gs_vol_table; + #endif + } + else if (dta==0x15 && (cd&0xf0)==0x10) + { + int chan=cd&0x0f; + if (!chan) chan=9; + else if (chan<10) chan--; + chan = MERGE_CHANNEL_PORT(chan); + channel[chan].kit=dtb; + } + else if (cd==0x01) switch(dta) + { + case 0x30: + switch(dtb) + { + case 0: XG_System_reverb_type=16+0; break; + case 1: XG_System_reverb_type=16+1; break; + case 2: XG_System_reverb_type=16+2; break; + case 3: XG_System_reverb_type= 8+0; break; + case 4: XG_System_reverb_type= 8+1; break; + case 5: XG_System_reverb_type=32+0; break; + case 6: XG_System_reverb_type=8*17; break; + case 7: XG_System_reverb_type=8*18; break; + } + break; + case 0x38: + switch(dtb) + { + case 0: XG_System_chorus_type= 8+0; break; + case 1: XG_System_chorus_type= 8+1; break; + case 2: XG_System_chorus_type= 8+2; break; + case 3: XG_System_chorus_type= 8+4; break; + case 4: XG_System_chorus_type= -1; break; + case 5: XG_System_chorus_type= 8*3; break; + case 6: XG_System_chorus_type= -1; break; + case 7: XG_System_chorus_type= -1; break; + } + break; + } + return 0; + } + return 0; +} + +/* Print a string from the file, followed by a newline. Any non-ASCII + or unprintable characters will be converted to periods. */ +static int dumpstring(int32 len, const char *label) +{ + signed char *s=safe_malloc(len+1); + if (len != (int32)SDL_RWread(rw, s, 1, len)) + { + free(s); + return -1; + } + s[len]='\0'; + while (len--) + { + if (s[len]<32) + s[len]='.'; + } + ctl->cmsg(CMSG_TEXT, VERB_VERBOSE, "%s%s", label, s); + free(s); + return 0; +} + +#define MIDIEVENT(at,t,ch,pa,pb) \ + new=safe_malloc(sizeof(MidiEventList)); \ + new->event.time=at; new->event.type=t; new->event.channel=ch; \ + new->event.a=pa; new->event.b=pb; new->next=0;\ + return new; + +#define MAGIC_EOT ((MidiEventList *)(-1)) + +/* Read a MIDI event, returning a freshly allocated element that can + be linked to the event list */ +static MidiEventList *read_midi_event(void) +{ + static uint8 laststatus, lastchan; + static uint8 nrpn=0, rpn_msb[16], rpn_lsb[16]; /* one per channel */ + uint8 me, type, a,b,c; + int32 len; + MidiEventList *new; + + for (;;) + { + at+=getvl(); + if (SDL_RWread(rw,&me,1,1)!=1) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: read_midi_event: %s", + current_filename, strerror(errno)); + return 0; + } + + if(me==0xF0 || me == 0xF7) /* SysEx event */ + { + int32 sret; + uint8 sysa=0, sysb=0, syschan=0; + + len=getvl(); + sret=sysex(len, &syschan, &sysa, &sysb, rw); + if (sret) + { + MIDIEVENT(at, sret, syschan, sysa, sysb); + } + } + else if(me==0xFF) /* Meta event */ + { + SDL_RWread(rw,&type,1,1); + len=getvl(); + if (type>0 && type<16) + { + static char *label[]={ + "Text event: ", "Text: ", "Copyright: ", "Track name: ", + "Instrument: ", "Lyric: ", "Marker: ", "Cue point: "}; + dumpstring(len, label[(type>7) ? 0 : type]); + } + else + switch(type) + { + + case 0x21: /* MIDI port number */ + if(len == 1) + { + SDL_RWread(rw,&midi_port_number,1,1); + if(midi_port_number == EOF) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Warning: \"%s\": Short midi file.", + midi_name); + return 0; + } + midi_port_number &= 0x0f; + if (midi_port_number) + ctl->cmsg(CMSG_INFO, VERB_VERBOSE, + "(MIDI port number %d)", midi_port_number); + midi_port_number &= 0x03; + } + else SDL_RWseek(rw, len, RW_SEEK_CUR); + break; + + case 0x2F: /* End of Track */ + return MAGIC_EOT; + + case 0x51: /* Tempo */ + SDL_RWread(rw,&a,1,1); SDL_RWread(rw,&b,1,1); SDL_RWread(rw,&c,1,1); + MIDIEVENT(at, ME_TEMPO, c, a, b); + + default: + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + "(Meta event type 0x%02x, length %ld)", type, len); + SDL_RWseek(rw, len, RW_SEEK_CUR); + break; + } + } + else + { + a=me; + if (a & 0x80) /* status byte */ + { + lastchan=a & 0x0F; + laststatus=(a>>4) & 0x07; + SDL_RWread(rw,&a, 1,1); + a &= 0x7F; + } + switch(laststatus) + { + case 0: /* Note off */ + SDL_RWread(rw,&b, 1,1); + b &= 0x7F; + MIDIEVENT(at, ME_NOTEOFF, lastchan, a,b); + + case 1: /* Note on */ + SDL_RWread(rw,&b, 1,1); + b &= 0x7F; + if (curr_track == curr_title_track && track_info > 1) title[0] = '\0'; + MIDIEVENT(at, ME_NOTEON, lastchan, a,b); + + + case 2: /* Key Pressure */ + SDL_RWread(rw,&b, 1,1); + b &= 0x7F; + MIDIEVENT(at, ME_KEYPRESSURE, lastchan, a, b); + + case 3: /* Control change */ + SDL_RWread(rw,&b, 1,1); + b &= 0x7F; + { + int control=255; + switch(a) + { + case 7: control=ME_MAINVOLUME; break; + case 10: control=ME_PAN; break; + case 11: control=ME_EXPRESSION; break; + case 64: control=ME_SUSTAIN; break; + + case 71: control=ME_HARMONICCONTENT; break; + case 72: control=ME_RELEASETIME; break; + case 73: control=ME_ATTACKTIME; break; + case 74: control=ME_BRIGHTNESS; break; + case 91: control=ME_REVERBERATION; break; + case 93: control=ME_CHORUSDEPTH; break; + + case 120: control=ME_ALL_SOUNDS_OFF; break; + case 121: control=ME_RESET_CONTROLLERS; break; + case 123: control=ME_ALL_NOTES_OFF; break; + + /* These should be the SCC-1 tone bank switch + commands. I don't know why there are two, or + why the latter only allows switching to bank 0. + Also, some MIDI files use 0 as some sort of + continuous controller. This will cause lots of + warnings about undefined tone banks. */ + case 0: if (XG_System_On) control = ME_TONE_KIT; else control=ME_TONE_BANK; break; + + case 32: if (XG_System_On) control = ME_TONE_BANK; break; + + case 100: nrpn=0; rpn_msb[lastchan]=b; break; + case 101: nrpn=0; rpn_lsb[lastchan]=b; break; + case 99: nrpn=1; rpn_msb[lastchan]=b; break; + case 98: nrpn=1; rpn_lsb[lastchan]=b; break; + + case 6: + if (nrpn) + { + if (rpn_msb[lastchan]==1) switch (rpn_lsb[lastchan]) + { +#ifdef tplus + case 0x08: control=ME_VIBRATO_RATE; break; + case 0x09: control=ME_VIBRATO_DEPTH; break; + case 0x0a: control=ME_VIBRATO_DELAY; break; +#endif + case 0x20: control=ME_BRIGHTNESS; break; + case 0x21: control=ME_HARMONICCONTENT; break; + /* + case 0x63: envelope attack rate + case 0x64: envelope decay rate + case 0x66: envelope release rate + */ + } + else switch (rpn_msb[lastchan]) + { + /* + case 0x14: filter cutoff frequency + case 0x15: filter resonance + case 0x16: envelope attack rate + case 0x17: envelope decay rate + case 0x18: pitch coarse + case 0x19: pitch fine + */ + case 0x1a: drumvolume[lastchan][0x7f & rpn_lsb[lastchan]] = b; break; + case 0x1c: + if (!b) b=(int) (127.0*rand()/(RAND_MAX)); + drumpanpot[lastchan][0x7f & rpn_lsb[lastchan]] = b; + break; + case 0x1d: drumreverberation[lastchan][0x7f & rpn_lsb[lastchan]] = b; break; + case 0x1e: drumchorusdepth[lastchan][0x7f & rpn_lsb[lastchan]] = b; break; + /* + case 0x1f: variation send level + */ + } + + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + "(Data entry (MSB) for NRPN %02x,%02x: %ld)", + rpn_msb[lastchan], rpn_lsb[lastchan], + b); + break; + } + + switch((rpn_msb[lastchan]<<8) | rpn_lsb[lastchan]) + { + case 0x0000: /* Pitch bend sensitivity */ + control=ME_PITCH_SENS; + break; + + case 0x7F7F: /* RPN reset */ + /* reset pitch bend sensitivity to 2 */ + MIDIEVENT(at, ME_PITCH_SENS, lastchan, 2, 0); + + default: + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + "(Data entry (MSB) for RPN %02x,%02x: %ld)", + rpn_msb[lastchan], rpn_lsb[lastchan], + b); + break; + } + break; + + default: + ctl->cmsg(CMSG_INFO, VERB_DEBUG, + "(Control %d: %d)", a, b); + break; + } + if (control != 255) + { + MIDIEVENT(at, control, lastchan, b, 0); + } + } + break; + + case 4: /* Program change */ + a &= 0x7f; + MIDIEVENT(at, ME_PROGRAM, lastchan, a, 0); + + case 5: /* Channel pressure - NOT IMPLEMENTED */ + break; + + case 6: /* Pitch wheel */ + SDL_RWread(rw,&b, 1,1); + b &= 0x7F; + MIDIEVENT(at, ME_PITCHWHEEL, lastchan, a, b); + + default: + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "*** Can't happen: status 0x%02X, channel 0x%02X", + laststatus, lastchan); + break; + } + } + } + + return new; +} + +#undef MIDIEVENT + +/* Read a midi track into the linked list, either merging with any previous + tracks or appending to them. */ +static int read_track(int append) +{ + MidiEventList *meep; + MidiEventList *next, *new; + int32 len, next_pos, pos; + char tmp[4]; + + meep=evlist; + if (append && meep) + { + /* find the last event in the list */ + for (; meep->next; meep=meep->next) + ; + at=meep->event.time; + } + else + at=0; + + /* Check the formalities */ + if ((SDL_RWread(rw,tmp,1,4) != 4) || (SDL_RWread(rw,&len,4,1) != 1)) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: Can't read track header.", current_filename); + return -1; + } + len=BE_LONG(len); + next_pos = SDL_RWtell(rw) + len; + if (memcmp(tmp, "MTrk", 4)) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: Corrupt MIDI file.", current_filename); + return -2; + } + + for (;;) + { + if (!(new=read_midi_event())) /* Some kind of error */ + return -2; + + if (new==MAGIC_EOT) /* End-of-track Hack. */ + { + pos = SDL_RWtell(rw); + if (pos < next_pos) + SDL_RWseek(rw, next_pos - pos, RW_SEEK_CUR); + return 0; + } + + next=meep->next; + while (next && (next->event.time < new->event.time)) + { + meep=next; + next=meep->next; + } + + new->next=next; + meep->next=new; + + event_count++; /* Count the event. (About one?) */ + meep=new; + } +} + +/* Free the linked event list from memory. */ +static void free_midi_list(void) +{ + MidiEventList *meep, *next; + if (!(meep=evlist)) return; + while (meep) + { + next=meep->next; + free(meep); + meep=next; + } + evlist=0; +} + + +static void xremap_percussion(int *banknumpt, int *this_notept, int this_kit) { + int i, newmap; + int banknum = *banknumpt; + int this_note = *this_notept; + int newbank, newnote; + + if (this_kit != 127 && this_kit != 126) return; + + for (i = 0; i < XMAPMAX; i++) { + newmap = xmap[i][0]; + if (!newmap) return; + if (this_kit == 127 && newmap != XGDRUM) continue; + if (this_kit == 126 && newmap != SFXDRUM1) continue; + if (xmap[i][1] != banknum) continue; + if (xmap[i][3] != this_note) continue; + newbank = xmap[i][2]; + newnote = xmap[i][4]; + if (newbank == banknum && newnote == this_note) return; + if (!drumset[newbank]) return; + *banknumpt = newbank; + *this_notept = newnote; + return; + } +} + +/* Allocate an array of MidiEvents and fill it from the linked list of + events, marking used instruments for loading. Convert event times to + samples: handle tempo changes. Strip unnecessary events from the list. + Free the linked list. */ +static MidiEvent *groom_list(int32 divisions,int32 *eventsp,int32 *samplesp) +{ + MidiEvent *groomed_list, *lp; + MidiEventList *meep; + int32 i, our_event_count, tempo, skip_this_event, new_value; + int32 sample_cum, samples_to_do, at, st, dt, counting_time; + + int current_bank[MAXCHAN], current_banktype[MAXCHAN], current_set[MAXCHAN], + current_kit[MAXCHAN], current_program[MAXCHAN]; + /* Or should each bank have its own current program? */ + int dset, dnote, drumsflag, mprog; + + for (i=0; icmsg(CMSG_INFO, VERB_DEBUG_SILLY, + "%6d: ch %2d: event %d (%d,%d)", + meep->event.time, meep->event.channel + 1, + meep->event.type, meep->event.a, meep->event.b); + + if (meep->event.type==ME_TEMPO) + { + tempo= + meep->event.channel + meep->event.b * 256 + meep->event.a * 65536; + compute_sample_increment(tempo, divisions); + skip_this_event=1; + } + else if ((quietchannels & (1<event.channel))) + skip_this_event=1; + else switch (meep->event.type) + { + case ME_PROGRAM: + + if (current_kit[meep->event.channel]) + { + if (current_kit[meep->event.channel]==126) + { + /* note request for 2nd sfx rhythm kit */ + if (meep->event.a && drumset[SFXDRUM2]) + { + current_kit[meep->event.channel]=125; + current_set[meep->event.channel]=SFXDRUM2; + new_value=SFXDRUM2; + } + else if (!meep->event.a && drumset[SFXDRUM1]) + { + current_set[meep->event.channel]=SFXDRUM1; + new_value=SFXDRUM1; + } + else + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "XG SFX drum set is undefined"); + skip_this_event=1; + break; + } + } + if (drumset[meep->event.a]) /* Is this a defined drumset? */ + new_value=meep->event.a; + else + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "Drum set %d is undefined", meep->event.a); + if (drumset[0]) + new_value=meep->event.a=0; + else + { + skip_this_event=1; + break; + } + } + if (current_set[meep->event.channel] != new_value) + current_set[meep->event.channel]=new_value; + else + skip_this_event=1; + } + else + { + new_value=meep->event.a; + if ((current_program[meep->event.channel] != SPECIAL_PROGRAM) + && (current_program[meep->event.channel] != new_value)) + current_program[meep->event.channel] = new_value; + else + skip_this_event=1; + } + break; + + case ME_NOTEON: + if (counting_time) + counting_time=1; + + drumsflag = current_kit[meep->event.channel]; + + if (drumsflag) /* percussion channel? */ + { + dset = current_set[meep->event.channel]; + dnote=meep->event.a; + if (XG_System_On) xremap_percussion(&dset, &dnote, drumsflag); + + /*if (current_config_pc42b) pcmap(&dset, &dnote, &mprog, &drumsflag);*/ + + if (drumsflag) + { + /* Mark this instrument to be loaded */ + if (!(drumset[dset]->tone[dnote].layer)) + { + drumset[dset]->tone[dnote].layer= + MAGIC_LOAD_INSTRUMENT; + } + else drumset[dset]->tone[dnote].last_used + = current_tune_number; + if (!channel[meep->event.channel].name) channel[meep->event.channel].name= + drumset[dset]->name; + } + } + + if (!drumsflag) /* not percussion */ + { + int chan=meep->event.channel; + int banknum; + + if (current_banktype[chan]) banknum=SFXBANK; + else banknum=current_bank[chan]; + + mprog = current_program[chan]; + + if (mprog==SPECIAL_PROGRAM) + break; + + if (XG_System_On && banknum==SFXBANK && !tonebank[SFXBANK] && tonebank[120]) + banknum = 120; + + /*if (current_config_pc42b) pcmap(&banknum, &dnote, &mprog, &drumsflag);*/ + + if (drumsflag) + { + /* Mark this instrument to be loaded */ + if (!(drumset[dset]->tone[dnote].layer)) + { + drumset[dset]->tone[dnote].layer=MAGIC_LOAD_INSTRUMENT; + } + else drumset[dset]->tone[dnote].last_used = current_tune_number; + if (!channel[meep->event.channel].name) channel[meep->event.channel].name= + drumset[dset]->name; + } + if (!drumsflag) + { + /* Mark this instrument to be loaded */ + if (!(tonebank[banknum]->tone[mprog].layer)) + { + tonebank[banknum]->tone[mprog].layer=MAGIC_LOAD_INSTRUMENT; + } + else tonebank[banknum]->tone[mprog].last_used = current_tune_number; + if (!channel[meep->event.channel].name) channel[meep->event.channel].name= + tonebank[banknum]->tone[mprog].name; + } + } + break; + + case ME_TONE_KIT: + if (!meep->event.a || meep->event.a == 127) + { + new_value=meep->event.a; + if (current_kit[meep->event.channel] != new_value) + current_kit[meep->event.channel]=new_value; + else + skip_this_event=1; + break; + } + else if (meep->event.a == 126) + { + if (drumset[SFXDRUM1]) /* Is this a defined tone bank? */ + new_value=meep->event.a; + else + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "XG rhythm kit %d is undefined", meep->event.a); + skip_this_event=1; + break; + } + current_set[meep->event.channel]=SFXDRUM1; + current_kit[meep->event.channel]=new_value; + break; + } + else if (meep->event.a != SFX_BANKTYPE) + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "XG kit %d is impossible", meep->event.a); + skip_this_event=1; + break; + } + + if (current_kit[meep->event.channel]) + { + skip_this_event=1; + break; + } + if (tonebank[SFXBANK] || tonebank[120]) /* Is this a defined tone bank? */ + new_value=SFX_BANKTYPE; + else + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "XG Sfx bank is undefined"); + skip_this_event=1; + break; + } + if (current_banktype[meep->event.channel]!=new_value) + current_banktype[meep->event.channel]=new_value; + else + skip_this_event=1; + break; + + case ME_TONE_BANK: + if (current_kit[meep->event.channel]) + { + skip_this_event=1; + break; + } + if (XG_System_On && meep->event.a > 0 && meep->event.a < 48) { + channel[meep->event.channel].variationbank=meep->event.a; + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "XG variation bank %d", meep->event.a); + new_value=meep->event.a=0; + } + else if (tonebank[meep->event.a]) /* Is this a defined tone bank? */ + new_value=meep->event.a; + else + { + ctl->cmsg(CMSG_WARNING, VERB_VERBOSE, + "Tone bank %d is undefined", meep->event.a); + new_value=meep->event.a=0; + } + + if (current_bank[meep->event.channel]!=new_value) + current_bank[meep->event.channel]=new_value; + else + skip_this_event=1; + break; + + case ME_HARMONICCONTENT: + channel[meep->event.channel].harmoniccontent=meep->event.a; + break; + case ME_BRIGHTNESS: + channel[meep->event.channel].brightness=meep->event.a; + break; + + } + + /* Recompute time in samples*/ + if ((dt=meep->event.time - at) && !counting_time) + { + samples_to_do=sample_increment * dt; + sample_cum += sample_correction * dt; + if (sample_cum & 0xFFFF0000) + { + samples_to_do += ((sample_cum >> 16) & 0xFFFF); + sample_cum &= 0x0000FFFF; + } + st += samples_to_do; + } + else if (counting_time==1) counting_time=0; + if (!skip_this_event) + { + /* Add the event to the list */ + *lp=meep->event; + lp->time=st; + lp++; + our_event_count++; + } + at=meep->event.time; + meep=meep->next; + } + /* Add an End-of-Track event */ + lp->time=st; + lp->type=ME_EOT; + our_event_count++; + free_midi_list(); + + *eventsp=our_event_count; + *samplesp=st; + return groomed_list; +} + +MidiEvent *read_midi_file(SDL_RWops *mrw, int32 *count, int32 *sp) +{ + int32 len, divisions; + int16 format, tracks, divisions_tmp; + int i; + char tmp[4]; + + rw = mrw; + event_count=0; + at=0; + evlist=0; + + GM_System_On=GS_System_On=XG_System_On=0; + /* vol_table = def_vol_table; */ + XG_System_reverb_type=XG_System_chorus_type=XG_System_variation_type=0; + memset(&drumvolume,-1,sizeof(drumvolume)); + memset(&drumchorusdepth,-1,sizeof(drumchorusdepth)); + memset(&drumreverberation,-1,sizeof(drumreverberation)); + memset(&drumpanpot,NO_PANNING,sizeof(drumpanpot)); + + for (i=0; icmsg(CMSG_ERROR, VERB_NORMAL, "%s: %s", current_filename, + strerror(errno)); + } + else*/ + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: Not a MIDI file!", current_filename); + return 0; + } + len=BE_LONG(len); + + if (!memcmp(tmp, "RIFF", 4)) + { + SDL_RWread(rw,tmp,1,12); + goto past_riff; + } + if (memcmp(tmp, "MThd", 4) || len < 6) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: Not a MIDI file!", current_filename); + return 0; + } + + SDL_RWread(rw,&format, 2, 1); + SDL_RWread(rw,&tracks, 2, 1); + SDL_RWread(rw,&divisions_tmp, 2, 1); + format=BE_SHORT(format); + tracks=BE_SHORT(tracks); + track_info = tracks; + curr_track = 0; + curr_title_track = -1; + divisions_tmp=BE_SHORT(divisions_tmp); + + if (divisions_tmp<0) + { + /* SMPTE time -- totally untested. Got a MIDI file that uses this? */ + divisions= + (int32)(-(divisions_tmp/256)) * (int32)(divisions_tmp & 0xFF); + } + else divisions=(int32)(divisions_tmp); + + if (len > 6) + { + ctl->cmsg(CMSG_WARNING, VERB_NORMAL, + "%s: MIDI file header size %ld bytes", + current_filename, len); + SDL_RWseek(rw, len-6, RW_SEEK_CUR); /* skip the excess */ + } + if (format<0 || format >2) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: Unknown MIDI file format %d", current_filename, format); + return 0; + } + ctl->cmsg(CMSG_INFO, VERB_VERBOSE, + "Format: %d Tracks: %d Divisions: %d", format, tracks, divisions); + + /* Put a do-nothing event first in the list for easier processing */ + evlist=safe_malloc(sizeof(MidiEventList)); + evlist->event.time=0; + evlist->event.type=ME_NONE; + evlist->next=0; + event_count++; + + switch(format) + { + case 0: + if (read_track(0)) + { + free_midi_list(); + return 0; + } + else curr_track++; + break; + + case 1: + for (i=0; i + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +typedef struct { + MidiEvent event; + void *next; +} MidiEventList; + +extern int32 quietchannels; + +extern MidiEvent *read_midi_file(SDL_RWops *mrw, int32 *count, int32 *sp); + +extern char midi_name[FILENAME_MAX+1]; diff --git a/apps/plugins/sdl/SDL_mixer/timidity/resample.c b/apps/plugins/sdl/SDL_mixer/timidity/resample.c new file mode 100644 index 0000000..959e2c6 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/resample.c @@ -0,0 +1,730 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "common.h" +#include "instrum.h" +#include "playmidi.h" +#include "output.h" +#include "ctrlmode.h" +#include "tables.h" +#include "resample.h" + +#ifdef LINEAR_INTERPOLATION +# if defined(LOOKUP_HACK) && defined(LOOKUP_INTERPOLATION) +# define RESAMPLATION \ + v1=src[ofs>>FRACTION_BITS];\ + v2=src[(ofs>>FRACTION_BITS)+1];\ + *dest++ = (resample_t)(v1 + (iplookup[(((v2-v1)<<5) & 0x03FE0) | \ + ((ofs & FRACTION_MASK) >> (FRACTION_BITS-5))])); +# else +# define RESAMPLATION \ + v1=src[ofs>>FRACTION_BITS];\ + v2=src[(ofs>>FRACTION_BITS)+1];\ + *dest++ = (resample_t)(v1 + (((v2-v1) * (ofs & FRACTION_MASK)) >> FRACTION_BITS)); +# endif +# define INTERPVARS sample_t v1, v2 +#else +/* Earplugs recommended for maximum listening enjoyment */ +# define RESAMPLATION *dest++ = src[ofs>>FRACTION_BITS]; +# define INTERPVARS +#endif + +#define FINALINTERP if (ofs == le) *dest++=src[ofs>>FRACTION_BITS]; +/* So it isn't interpolation. At least it's final. */ + +extern resample_t *resample_buffer; + +/*************** resampling with fixed increment *****************/ + +static resample_t *rs_plain(int v, int32 *countptr) +{ + + /* Play sample until end, then free the voice. */ + + INTERPVARS; + Voice + *vp=&voice[v]; + resample_t + *dest=resample_buffer; + sample_t + *src=vp->sample->data; + int32 + ofs=vp->sample_offset, + incr=vp->sample_increment, + le=vp->sample->data_length, + count=*countptr; + +#ifdef PRECALC_LOOPS + int32 i, j; + + if (incr<0) incr = -incr; /* In case we're coming out of a bidir loop */ + + /* Precalc how many times we should go through the loop. + NOTE: Assumes that incr > 0 and that ofs <= le */ + i = (le - ofs) / incr + 1; + + if (i > count) + { + i = count; + count = 0; + } + else count -= i; + + for(j = 0; j < i; j++) + { + RESAMPLATION; + ofs += incr; + } + + if (ofs >= le) + { + FINALINTERP; + vp->status=VOICE_FREE; + ctl->note(v); + *countptr-=count+1; + } + +#else /* PRECALC_LOOPS */ + while (count--) + { + RESAMPLATION; + ofs += incr; + if (ofs >= le) + { + FINALINTERP; + vp->status=VOICE_FREE; + ctl->note(v); + *countptr-=count+1; + break; + } + } +#endif /* PRECALC_LOOPS */ + + vp->sample_offset=ofs; /* Update offset */ + return resample_buffer; +} + +static resample_t *rs_loop(Voice *vp, int32 count) +{ + + /* Play sample until end-of-loop, skip back and continue. */ + + INTERPVARS; + int32 + ofs=vp->sample_offset, + incr=vp->sample_increment, + le=vp->sample->loop_end, + ll=le - vp->sample->loop_start; + resample_t + *dest=resample_buffer; + sample_t + *src=vp->sample->data; + +#ifdef PRECALC_LOOPS + int32 i; + + if (ofs < 0 || le < 0) return resample_buffer; + + while (count) + { + if (ofs >= le) + /* NOTE: Assumes that ll > incr and that incr > 0. */ + ofs -= ll; + /* Precalc how many times we should go through the loop */ + i = (le - ofs) / incr + 1; + if (i > count) + { + i = count; + count = 0; + } + else count -= i; + if (i > 0) + while (i--) + { + RESAMPLATION; + ofs += incr; + } + } +#else + while (count--) + { + RESAMPLATION; + ofs += incr; + if (ofs>=le) + ofs -= ll; /* Hopefully the loop is longer than an increment. */ + } +#endif + + vp->sample_offset=ofs; /* Update offset */ + return resample_buffer; +} + +static resample_t *rs_bidir(Voice *vp, int32 count) +{ + INTERPVARS; + int32 + ofs=vp->sample_offset, + incr=vp->sample_increment, + le=vp->sample->loop_end, + ls=vp->sample->loop_start; + resample_t + *dest=resample_buffer; + sample_t + *src=vp->sample->data; + +#ifdef PRECALC_LOOPS + int32 + le2 = le<<1, + ls2 = ls<<1, + i; + /* Play normally until inside the loop region */ + + if (ofs <= ls) + { + /* NOTE: Assumes that incr > 0, which is NOT always the case + when doing bidirectional looping. I have yet to see a case + where both ofs <= ls AND incr < 0, however. */ + i = (ls - ofs) / incr + 1; + if (i > count) + { + i = count; + count = 0; + } + else count -= i; + while (i--) + { + RESAMPLATION; + ofs += incr; + } + } + + /* Then do the bidirectional looping */ + + while(count) + { + /* Precalc how many times we should go through the loop */ + i = ((incr > 0 ? le : ls) - ofs) / incr + 1; + if (i > count) + { + i = count; + count = 0; + } + else count -= i; + while (i--) + { + RESAMPLATION; + ofs += incr; + } + if (ofs>=le) + { + /* fold the overshoot back in */ + ofs = le2 - ofs; + incr *= -1; + } + else if (ofs <= ls) + { + ofs = ls2 - ofs; + incr *= -1; + } + } + +#else /* PRECALC_LOOPS */ + /* Play normally until inside the loop region */ + + if (ofs < ls) + { + while (count--) + { + RESAMPLATION; + ofs += incr; + if (ofs>=ls) + break; + } + } + + /* Then do the bidirectional looping */ + + if (count>0) + while (count--) + { + RESAMPLATION; + ofs += incr; + if (ofs>=le) + { + /* fold the overshoot back in */ + ofs = le - (ofs - le); + incr = -incr; + } + else if (ofs <= ls) + { + ofs = ls + (ls - ofs); + incr = -incr; + } + } +#endif /* PRECALC_LOOPS */ + vp->sample_increment=incr; + vp->sample_offset=ofs; /* Update offset */ + return resample_buffer; +} + +/*********************** vibrato versions ***************************/ + +/* We only need to compute one half of the vibrato sine cycle */ +static int vib_phase_to_inc_ptr(int phase) +{ + if (phase < VIBRATO_SAMPLE_INCREMENTS/2) + return VIBRATO_SAMPLE_INCREMENTS/2-1-phase; + else if (phase >= 3*VIBRATO_SAMPLE_INCREMENTS/2) + return 5*VIBRATO_SAMPLE_INCREMENTS/2-1-phase; + else + return phase-VIBRATO_SAMPLE_INCREMENTS/2; +} + +static int32 update_vibrato(Voice *vp, int sign) +{ + int32 depth; + int phase, pb; + double a; + + if (vp->vibrato_phase++ >= 2*VIBRATO_SAMPLE_INCREMENTS-1) + vp->vibrato_phase=0; + phase=vib_phase_to_inc_ptr(vp->vibrato_phase); + + if (vp->vibrato_sample_increment[phase]) + { + if (sign) + return -vp->vibrato_sample_increment[phase]; + else + return vp->vibrato_sample_increment[phase]; + } + + /* Need to compute this sample increment. */ + + depth=vp->sample->vibrato_depth<<7; + + if (vp->vibrato_sweep) + { + /* Need to update sweep */ + vp->vibrato_sweep_position += vp->vibrato_sweep; + if (vp->vibrato_sweep_position >= (1<vibrato_sweep=0; + else + { + /* Adjust depth */ + depth *= vp->vibrato_sweep_position; + depth >>= SWEEP_SHIFT; + } + } + + a = FSCALE(((double)(vp->sample->sample_rate) * + (double)(vp->frequency)) / + ((double)(vp->sample->root_freq) * + (double)(play_mode->rate)), + FRACTION_BITS); + + pb=(int)((sine(vp->vibrato_phase * + (SINE_CYCLE_LENGTH/(2*VIBRATO_SAMPLE_INCREMENTS))) + * (double)(depth) * VIBRATO_AMPLITUDE_TUNING)); + + if (pb<0) + { + pb=-pb; + a /= bend_fine[(pb>>5) & 0xFF] * bend_coarse[pb>>13]; + } + else + a *= bend_fine[(pb>>5) & 0xFF] * bend_coarse[pb>>13]; + + /* If the sweep's over, we can store the newly computed sample_increment */ + if (!vp->vibrato_sweep) + vp->vibrato_sample_increment[phase]=(int32) a; + + if (sign) + a = -a; /* need to preserve the loop direction */ + + return (int32) a; +} + +static resample_t *rs_vib_plain(int v, int32 *countptr) +{ + + /* Play sample until end, then free the voice. */ + + INTERPVARS; + Voice *vp=&voice[v]; + resample_t + *dest=resample_buffer; + sample_t + *src=vp->sample->data; + int32 + le=vp->sample->data_length, + ofs=vp->sample_offset, + incr=vp->sample_increment, + count=*countptr; + int + cc=vp->vibrato_control_counter; + + /* This has never been tested */ + + if (incr<0) incr = -incr; /* In case we're coming out of a bidir loop */ + + while (count--) + { + if (!cc--) + { + cc=vp->vibrato_control_ratio; + incr=update_vibrato(vp, 0); + } + RESAMPLATION; + ofs += incr; + if (ofs >= le) + { + FINALINTERP; + vp->status=VOICE_FREE; + ctl->note(v); + *countptr-=count+1; + break; + } + } + + vp->vibrato_control_counter=cc; + vp->sample_increment=incr; + vp->sample_offset=ofs; /* Update offset */ + return resample_buffer; +} + +static resample_t *rs_vib_loop(Voice *vp, int32 count) +{ + + /* Play sample until end-of-loop, skip back and continue. */ + + INTERPVARS; + int32 + ofs=vp->sample_offset, + incr=vp->sample_increment, + le=vp->sample->loop_end, + ll=le - vp->sample->loop_start; + resample_t + *dest=resample_buffer; + sample_t + *src=vp->sample->data; + int + cc=vp->vibrato_control_counter; + +#ifdef PRECALC_LOOPS + int32 i; + int + vibflag=0; + + while (count) + { + /* Hopefully the loop is longer than an increment */ + if(ofs >= le) + ofs -= ll; + /* Precalc how many times to go through the loop, taking + the vibrato control ratio into account this time. */ + i = (le - ofs) / incr + 1; + if(i > count) i = count; + if(i > cc) + { + i = cc; + vibflag = 1; + } + else cc -= i; + count -= i; + while(i--) + { + RESAMPLATION; + ofs += incr; + } + if(vibflag) + { + cc = vp->vibrato_control_ratio; + incr = update_vibrato(vp, 0); + vibflag = 0; + } + } + +#else /* PRECALC_LOOPS */ + while (count--) + { + if (!cc--) + { + cc=vp->vibrato_control_ratio; + incr=update_vibrato(vp, 0); + } + RESAMPLATION; + ofs += incr; + if (ofs>=le) + ofs -= ll; /* Hopefully the loop is longer than an increment. */ + } +#endif /* PRECALC_LOOPS */ + + vp->vibrato_control_counter=cc; + vp->sample_increment=incr; + vp->sample_offset=ofs; /* Update offset */ + return resample_buffer; +} + +static resample_t *rs_vib_bidir(Voice *vp, int32 count) +{ + INTERPVARS; + int32 + ofs=vp->sample_offset, + incr=vp->sample_increment, + le=vp->sample->loop_end, + ls=vp->sample->loop_start; + resample_t + *dest=resample_buffer; + sample_t + *src=vp->sample->data; + int + cc=vp->vibrato_control_counter; + +#ifdef PRECALC_LOOPS + int32 + le2=le<<1, + ls2=ls<<1, + i; + int + vibflag = 0; + + /* Play normally until inside the loop region */ + while (count && (ofs <= ls)) + { + i = (ls - ofs) / incr + 1; + if (i > count) i = count; + if (i > cc) + { + i = cc; + vibflag = 1; + } + else cc -= i; + count -= i; + while (i--) + { + RESAMPLATION; + ofs += incr; + } + if (vibflag) + { + cc = vp->vibrato_control_ratio; + incr = update_vibrato(vp, 0); + vibflag = 0; + } + } + + /* Then do the bidirectional looping */ + + while (count) + { + /* Precalc how many times we should go through the loop */ + i = ((incr > 0 ? le : ls) - ofs) / incr + 1; + if(i > count) i = count; + if(i > cc) + { + i = cc; + vibflag = 1; + } + else cc -= i; + count -= i; + while (i--) + { + RESAMPLATION; + ofs += incr; + } + if (vibflag) + { + cc = vp->vibrato_control_ratio; + incr = update_vibrato(vp, (incr < 0)); + vibflag = 0; + } + if (ofs >= le) + { + /* fold the overshoot back in */ + ofs = le2 - ofs; + incr *= -1; + } + else if (ofs <= ls) + { + ofs = ls2 - ofs; + incr *= -1; + } + } + +#else /* PRECALC_LOOPS */ + /* Play normally until inside the loop region */ + + if (ofs < ls) + { + while (count--) + { + if (!cc--) + { + cc=vp->vibrato_control_ratio; + incr=update_vibrato(vp, 0); + } + RESAMPLATION; + ofs += incr; + if (ofs>=ls) + break; + } + } + + /* Then do the bidirectional looping */ + + if (count>0) + while (count--) + { + if (!cc--) + { + cc=vp->vibrato_control_ratio; + incr=update_vibrato(vp, (incr < 0)); + } + RESAMPLATION; + ofs += incr; + if (ofs>=le) + { + /* fold the overshoot back in */ + ofs = le - (ofs - le); + incr = -incr; + } + else if (ofs <= ls) + { + ofs = ls + (ls - ofs); + incr = -incr; + } + } +#endif /* PRECALC_LOOPS */ + + vp->vibrato_control_counter=cc; + vp->sample_increment=incr; + vp->sample_offset=ofs; /* Update offset */ + return resample_buffer; +} + +resample_t *resample_voice(int v, int32 *countptr) +{ + int32 ofs; + uint8 modes; + Voice *vp=&voice[v]; + + if (!(vp->sample->sample_rate)) + { + /* Pre-resampled data -- just update the offset and check if + we're out of data. */ + ofs=vp->sample_offset >> FRACTION_BITS; /* Kind of silly to use + FRACTION_BITS here... */ + if (*countptr >= (vp->sample->data_length>>FRACTION_BITS) - ofs) + { + /* Note finished. Free the voice. */ + vp->status = VOICE_FREE; + ctl->note(v); + + /* Let the caller know how much data we had left */ + *countptr = (vp->sample->data_length>>FRACTION_BITS) - ofs; + } + else + vp->sample_offset += *countptr << FRACTION_BITS; + + return (resample_t *)vp->sample->data+ofs; + } + + /* Need to resample. Use the proper function. */ + modes=vp->sample->modes; + + if (vp->vibrato_control_ratio) + { + if ((modes & MODES_LOOPING) && + ((modes & MODES_ENVELOPE) || + (vp->status==VOICE_ON || vp->status==VOICE_SUSTAINED))) + { + if (modes & MODES_PINGPONG) + return rs_vib_bidir(vp, *countptr); + else + return rs_vib_loop(vp, *countptr); + } + else + return rs_vib_plain(v, countptr); + } + else + { + if ((modes & MODES_LOOPING) && + ((modes & MODES_ENVELOPE) || + (vp->status==VOICE_ON || vp->status==VOICE_SUSTAINED))) + { + if (modes & MODES_PINGPONG) + return rs_bidir(vp, *countptr); + else + return rs_loop(vp, *countptr); + } + else + return rs_plain(v, countptr); + } +} + +void pre_resample(Sample * sp) +{ + double a, xdiff; + int32 incr, ofs, newlen, count; + int16 *src = (int16 *) sp->data; + resample_t *newdata, *dest; + int16 v1, v2, v3, v4, *vptr; + static const char note_name[12][3] = + { + "C", "C#", "D", "D#", "E", "F", "F#", "G", "G#", "A", "A#", "B" + }; + + ctl->cmsg(CMSG_INFO, VERB_NOISY, " * pre-resampling for note %d (%s%d)", + sp->note_to_use, + note_name[sp->note_to_use % 12], (sp->note_to_use & 0x7F) / 12); + + a = ((double) (sp->sample_rate) * freq_table[(int) (sp->note_to_use)]) / + ((double) (sp->root_freq) * play_mode->rate); + if (a <= 0) return; + newlen = (int32)(sp->data_length / a); + if (newlen < 0 || (newlen >> FRACTION_BITS) > MAX_SAMPLE_SIZE) return; + dest = newdata = safe_malloc(newlen >> (FRACTION_BITS - 1)); + + count = (newlen >> FRACTION_BITS) - 1; + ofs = incr = (sp->data_length - (1 << FRACTION_BITS)) / count; + + if (--count) + *dest++ = src[0]; + + /* Since we're pre-processing and this doesn't have to be done in + real-time, we go ahead and do the full sliding cubic interpolation. */ + while (--count) + { + vptr = src + (ofs >> FRACTION_BITS); + v1 = (vptr == src) ? *vptr : *(vptr - 1); + v2 = *vptr; + v3 = *(vptr + 1); + v4 = *(vptr + 2); + xdiff = FSCALENEG(ofs & FRACTION_MASK, FRACTION_BITS); + *dest++ = (int16)(v2 + (xdiff / 6.0) * (-2 * v1 - 3 * v2 + 6 * v3 - v4 + + xdiff * (3 * (v1 - 2 * v2 + v3) + xdiff * (-v1 + 3 * (v2 - v3) + v4)))); + ofs += incr; + } + + if (ofs & FRACTION_MASK) + { + v1 = src[ofs >> FRACTION_BITS]; + v2 = src[(ofs >> FRACTION_BITS) + 1]; + *dest++ = (resample_t)(v1 + (((v2 - v1) * (ofs & FRACTION_MASK)) >> FRACTION_BITS)); + } + else + *dest++ = src[ofs >> FRACTION_BITS]; + + sp->data_length = newlen; + sp->loop_start = (int32)(sp->loop_start / a); + sp->loop_end = (int32)(sp->loop_end / a); + free(sp->data); + sp->data = (sample_t *) newdata; + sp->sample_rate = 0; +} diff --git a/apps/plugins/sdl/SDL_mixer/timidity/resample.h b/apps/plugins/sdl/SDL_mixer/timidity/resample.h new file mode 100644 index 0000000..ee24289 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/resample.h @@ -0,0 +1,10 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +extern resample_t *resample_voice(int v, int32 *countptr); +extern void pre_resample(Sample *sp); diff --git a/apps/plugins/sdl/SDL_mixer/timidity/sdl_a.c b/apps/plugins/sdl/SDL_mixer/timidity/sdl_a.c new file mode 100644 index 0000000..6ea0f4c --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/sdl_a.c @@ -0,0 +1,19 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "output.h" + +/* export the playback mode */ + +#define dpm sdl_play_mode + +PlayMode dpm = { + DEFAULT_RATE, PE_16BIT|PE_SIGNED, + "SDL audio" +}; diff --git a/apps/plugins/sdl/SDL_mixer/timidity/sdl_c.c b/apps/plugins/sdl/SDL_mixer/timidity/sdl_c.c new file mode 100644 index 0000000..aeb802a --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/sdl_c.c @@ -0,0 +1,136 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include +#include +#include + +#include "config.h" +#include "common.h" +#include "output.h" +#include "ctrlmode.h" +#include "instrum.h" +#include "playmidi.h" + +static void ctl_refresh(void); +static void ctl_total_time(int tt); +static void ctl_master_volume(int mv); +static void ctl_file_name(char *name); +static void ctl_current_time(int ct); +static void ctl_note(int v); +static void ctl_program(int ch, int val); +static void ctl_volume(int channel, int val); +static void ctl_expression(int channel, int val); +static void ctl_panning(int channel, int val); +static void ctl_sustain(int channel, int val); +static void ctl_pitch_bend(int channel, int val); +static void ctl_reset(void); +static int ctl_open(int using_stdin, int using_stdout); +static void ctl_close(void); +static int ctl_read(int32 *valp); +static int cmsg(int type, int verbosity_level, char *fmt, ...); + +/**********************************/ +/* export the interface functions */ + +#define ctl sdl_control_mode + +ControlMode ctl= +{ + "SDL interface", 's', + 1,0,0, + ctl_open,NULL, ctl_close, ctl_read, cmsg, + ctl_refresh, ctl_reset, ctl_file_name, ctl_total_time, ctl_current_time, + ctl_note, + ctl_master_volume, ctl_program, ctl_volume, + ctl_expression, ctl_panning, ctl_sustain, ctl_pitch_bend +}; + +static int ctl_open(int using_stdin, int using_stdout) +{ + ctl.opened=1; + return 0; +} + +static void ctl_close(void) +{ + ctl.opened=0; +} + +static int ctl_read(int32 *valp) +{ + return RC_NONE; +} + +static int cmsg(int type, int verbosity_level, char *fmt, ...) +{ +#ifdef GREGS_DEBUG + va_list ap; + int flag_newline = 1; + if ((type==CMSG_TEXT || type==CMSG_INFO || type==CMSG_WARNING) && + ctl.verbosity + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "config.h" +#include "common.h" +#include "tables.h" +#include "instrum.h" + +int32 freq_table[128]= +{ + 8176, 8662, 9177, 9723, + 10301, 10913, 11562, 12250, + 12978, 13750, 14568, 15434, + + 16352, 17324, 18354, 19445, + 20602, 21827, 23125, 24500, + 25957, 27500, 29135, 30868, + + 32703, 34648, 36708, 38891, + 41203, 43654, 46249, 48999, + 51913, 55000, 58270, 61735, + + 65406, 69296, 73416, 77782, + 82407, 87307, 92499, 97999, + 103826, 110000, 116541, 123471, + + 130813, 138591, 146832, 155563, + 164814, 174614, 184997, 195998, + 207652, 220000, 233082, 246942, + + 261626, 277183, 293665, 311127, + 329628, 349228, 369994, 391995, + 415305, 440000, 466164, 493883, + + 523251, 554365, 587330, 622254, + 659255, 698456, 739989, 783991, + 830609, 880000, 932328, 987767, + + 1046502, 1108731, 1174659, 1244508, + 1318510, 1396913, 1479978, 1567982, + 1661219, 1760000, 1864655, 1975533, + + 2093005, 2217461, 2349318, 2489016, + 2637020, 2793826, 2959955, 3135963, + 3322438, 3520000, 3729310, 3951066, + + 4186009, 4434922, 4698636, 4978032, + 5274041, 5587652, 5919911, 6271927, + 6644875, 7040000, 7458620, 7902133, + + 8372018, 8869844, 9397273, 9956063, + 10548082, 11175303, 11839822, 12543854 +}; + +/* v=2.^((x/127-1) * 6) */ +double vol_table[128] = +{ + 0.015625, 0.016145143728351113, 0.016682602624583379, 0.017237953096759438, + 0.017811790741104401, 0.01840473098076444, 0.019017409725829021, 0.019650484055324921, + 0.020304632921913132, 0.020980557880044631, 0.021678983838355849, 0.02240065983711079, + 0.023146359851523596, 0.023916883621822989, 0.024713057510949051, 0.025535735390801884, + 0.026385799557992876, 0.027264161680080529, 0.028171763773305786, 0.029109579212875332, + 0.030078613776876421, 0.031079906724942836, 0.032114531912828696, 0.033183598944085631, + 0.034288254360078256, 0.035429682869614412, 0.036609108619508737, 0.037827796507442342, + 0.039087053538526394, 0.040388230227024875, 0.041732722044739302, 0.043121970917609151, + 0.044557466772132896, 0.046040749133268132, 0.047573408775524545, 0.049157089429020417, + 0.050793489542332405, 0.05248436410402918, 0.054231526524842463, 0.056036850582493913, + 0.057902272431264008, 0.059829792678457581, 0.061821478529993396, 0.063879466007418645, + 0.066005962238725971, 0.068203247825430205, 0.070473679288442961, 0.072819691595368496, + 0.075243800771931268, 0.077748606600335793, 0.080336795407452768, 0.083011142945821612, + 0.085774517370559328, 0.088629882315368294, 0.091580300070941839, 0.094628934869176312, + 0.097779056276712184, 0.10103404270144323, 0.1043973850157546, 0.1078726903003755, + 0.11146368571286204, 0.11517422248485852, 0.11900828005242428, 0.12296997032385605, + 0.12706354208958254, 0.13129338557886089, 0.13566403716816194, 0.14018018424629392, + 0.14484667024148207, 0.14966849981579558, 0.15465084423249356, 0.15979904690204472, + 0.16511862911277009, 0.17061529595225433, 0.17629494242587571, 0.18216365977901747, + 0.18822774202974024, 0.19449369271892172, 0.20096823188510385, 0.20765830327152621, + 0.21457108177307616, 0.22171398113114205, 0.2290946618846218, 0.23672103958561411, + 0.2446012932886038, 0.25274387432224471, 0.26115751535314891, 0.26985123975140174, + 0.27883437126784744, 0.28811654403352405, 0.29770771289197112, 0.30761816407549192, + 0.31785852623682015, 0.32843978184802081, 0.33937327897885317, 0.3506707434672246, + 0.36234429149478936, 0.37440644258117928, 0.38687013301080181, 0.39974872970660535, + 0.41305604456569134, 0.42680634927214656, 0.44101439060298442, 0.45569540624360722, + 0.47086514112975281, 0.48653986433345225, 0.50273638651110641, 0.51947207793239625, + 0.53676488710936021, 0.55463336004561792, 0.57309666012638816, 0.59217458867062556, + 0.61188760616732485, 0.63225685421876243, 0.65330417821421161, 0.67505215075844849, + 0.69752409588017272, 0.72074411404630734, 0.74473710800900605, 0.76952880951308478, + 0.79514580689252357, 0.82161557358563286, 0.84896649759946774, 0.87722791195508854, + 0.90643012614631979, 0.93660445864574493, 0.96778327049280244, 1 +}; + + +/* v=2.^((x/127-1) * 4) */ +FLOAT_T expr_table[128] = { +0.062500000000000000, 0.063879466007418617, 0.065289378838287213, 0.066730410498333517, +0.068203247825430205, 0.069708592816961873, 0.071247162964417632, 0.072819691595368496, +0.074426928222992794, 0.076069638903316056, 0.077748606600335793, 0.079464631559205010, +0.081218531687652529, 0.083011142945821639, 0.084843319744713291, 0.086715935353423396, +0.088629882315368322, 0.090586072873697340, 0.092585439406094330, 0.094628934869176312, +0.096717533252700480, 0.098852230043796174, 0.101034042701443255, 0.103264011141422821, +0.105543198231971461, 0.107872690300375454, 0.110253597650746091, 0.112687055093223104, +0.115174222484858521, 0.117716285282438229, 0.120314455107505686, 0.122969970323856051, +0.125684096627776631, 0.128458127651314785, 0.131293385578860888, 0.134191221777339997, +0.137153017440313080, 0.140180184246293943, 0.143274165031597039, 0.146436434478035005, +0.149668499815795553, 0.152971901541831212, 0.156348214154105547, 0.159799046902044661, +0.163326044553552957, 0.166930888178957210, 0.170615295952254331, 0.174381023970043153, +0.178229867088531585, 0.182163659779017467, 0.186184277002251486, 0.190293635102098180, +0.194493692718921724, 0.198786451723130919, 0.203173958169329677, 0.207658303271526207, +0.212241624399866963, 0.216926106099369798, 0.221713981131142046, 0.226607531536579865, +0.231609089725056033, 0.236721039585614190, 0.241945817623200610, 0.247285914119973582, +0.252743874322244710, 0.258322299653617804, 0.264023848954903828, 0.269851239751401739, +0.275807249548151001, 0.281894717153771790, 0.288116544033524102, 0.294475695692230921, +0.300975203087725074, 0.307618164075491973, 0.314407744885198681, 0.321347181629811129, +0.328439781848020751, 0.335688926080714045, 0.343098069482237422, 0.350670743467224599, +0.358410557393772644, 0.366321200283767356, 0.374406442581179333, 0.382670137949167655, +0.391116225106848792, 0.399748729706605410, 0.408571766252830038, 0.417589540063018294, +0.426806349272146446, 0.436226586881288292, 0.445854742851448105, 0.455695406243607215, +0.465753267406005200, 0.476033120209697069, 0.486539864333452310, 0.497278507599085373, +0.508254168358330150, 0.519472077932396359, 0.530937583105370092, 0.542656148672647887, +0.554633360045617918, 0.566874925913830707, 0.579386680965928047, 0.592174588670625557, +0.605244744119077360, 0.618603376929974136, 0.632256854218762432, 0.646211683632397893, +0.660474516451080240, 0.675052150758448599, 0.689951534681746304, 0.705179769703502823, +0.720744114046307338, 0.736651986132290215, 0.752910968118960744, 0.769528809513084777, +0.786513430864326790, 0.803872927540415394, 0.821615573585632974, 0.839749825664467098, +0.858284327092304622, 0.877227911955088646, 0.896589609319902503, 0.916378647538487301, +0.936604458645744820, 0.957276682855321193, 0.978405173154415220, 1.000000000000000000 +}; + +double bend_fine[256] = { + 1, 1.0002256593050698, 1.0004513695322617, 1.0006771306930664, + 1.0009029427989777, 1.0011288058614922, 1.0013547198921082, 1.0015806849023274, + 1.0018067009036538, 1.002032767907594, 1.0022588859256572, 1.0024850549693551, + 1.0027112750502025, 1.0029375461797159, 1.0031638683694153, 1.0033902416308227, + 1.0036166659754628, 1.0038431414148634, 1.0040696679605541, 1.0042962456240678, + 1.0045228744169397, 1.0047495543507072, 1.0049762854369111, 1.0052030676870944, + 1.0054299011128027, 1.0056567857255843, 1.00588372153699, 1.006110708558573, + 1.0063377468018897, 1.0065648362784985, 1.0067919769999607, 1.0070191689778405, + 1.0072464122237039, 1.0074737067491204, 1.0077010525656616, 1.0079284496849015, + 1.0081558981184175, 1.008383397877789, 1.008610948974598, 1.0088385514204294, + 1.0090662052268706, 1.0092939104055114, 1.0095216669679448, 1.0097494749257656, + 1.009977334290572, 1.0102052450739643, 1.0104332072875455, 1.0106612209429215, + 1.0108892860517005, 1.0111174026254934, 1.0113455706759138, 1.0115737902145781, + 1.0118020612531047, 1.0120303838031153, 1.0122587578762337, 1.012487183484087, + 1.0127156606383041, 1.0129441893505169, 1.0131727696323602, 1.0134014014954713, + 1.0136300849514894, 1.0138588200120575, 1.0140876066888203, 1.0143164449934257, + 1.0145453349375237, 1.0147742765327674, 1.0150032697908125, 1.0152323147233171, + 1.015461411341942, 1.0156905596583505, 1.0159197596842091, 1.0161490114311862, + 1.0163783149109531, 1.0166076701351838, 1.0168370771155553, 1.0170665358637463, + 1.0172960463914391, 1.0175256087103179, 1.0177552228320703, 1.0179848887683858, + 1.0182146065309567, 1.0184443761314785, 1.0186741975816487, 1.0189040708931674, + 1.0191339960777379, 1.0193639731470658, 1.0195940021128593, 1.0198240829868295, + 1.0200542157806898, 1.0202844005061564, 1.0205146371749483, 1.0207449257987866, + 1.0209752663893958, 1.0212056589585028, 1.0214361035178368, 1.0216666000791297, + 1.0218971486541166, 1.0221277492545349, 1.0223584018921241, 1.0225891065786274, + 1.0228198633257899, 1.0230506721453596, 1.023281533049087, 1.0235124460487257, + 1.0237434111560313, 1.0239744283827625, 1.0242054977406807, 1.0244366192415495, + 1.0246677928971357, 1.0248990187192082, 1.025130296719539, 1.0253616269099028, + 1.0255930093020766, 1.0258244439078401, 1.0260559307389761, 1.0262874698072693, + 1.0265190611245079, 1.0267507047024822, 1.0269824005529853, 1.027214148687813, + 1.0274459491187637, 1.0276778018576387, 1.0279097069162415, 1.0281416643063788, + 1.0283736740398595, 1.0286057361284953, 1.0288378505841009, 1.0290700174184932, + 1.0293022366434921, 1.0295345082709197, 1.0297668323126017, 1.0299992087803651, + 1.030231637686041, 1.0304641190414621, 1.0306966528584645, 1.0309292391488862, + 1.0311618779245688, 1.0313945691973556, 1.0316273129790936, 1.0318601092816313, + 1.0320929581168212, 1.0323258594965172, 1.0325588134325767, 1.0327918199368598, + 1.0330248790212284, 1.0332579906975481, 1.0334911549776868, 1.033724371873515, + 1.0339576413969056, 1.0341909635597348, 1.0344243383738811, 1.0346577658512259, + 1.034891246003653, 1.0351247788430489, 1.0353583643813031, 1.0355920026303078, + 1.0358256936019572, 1.0360594373081489, 1.0362932337607829, 1.0365270829717617, + 1.0367609849529913, 1.0369949397163791, 1.0372289472738365, 1.0374630076372766, + 1.0376971208186156, 1.0379312868297725, 1.0381655056826686, 1.0383997773892284, + 1.0386341019613787, 1.0388684794110492, 1.0391029097501721, 1.0393373929906822, + 1.0395719291445176, 1.0398065182236185, 1.0400411602399278, 1.0402758552053915, + 1.0405106031319582, 1.0407454040315787, 1.0409802579162071, 1.0412151647977996, + 1.0414501246883161, 1.0416851375997183, 1.0419202035439705, 1.0421553225330404, + 1.042390494578898, 1.042625719693516, 1.0428609978888699, 1.043096329176938, + 1.0433317135697009, 1.0435671510791424, 1.0438026417172486, 1.0440381854960086, + 1.0442737824274138, 1.044509432523459, 1.044745135796141, 1.0449808922574599, + 1.0452167019194181, 1.0454525647940205, 1.0456884808932754, 1.0459244502291931, + 1.0461604728137874, 1.0463965486590741, 1.046632677777072, 1.0468688601798024, + 1.0471050958792898, 1.047341384887561, 1.0475777272166455, 1.047814122878576, + 1.048050571885387, 1.0482870742491166, 1.0485236299818055, 1.0487602390954964, + 1.0489969016022356, 1.0492336175140715, 1.0494703868430555, 1.0497072096012419, + 1.0499440858006872, 1.0501810154534512, 1.050417998571596, 1.0506550351671864, + 1.0508921252522903, 1.0511292688389782, 1.0513664659393229, 1.0516037165654004, + 1.0518410207292894, 1.0520783784430709, 1.0523157897188296, 1.0525532545686513, + 1.0527907730046264, 1.0530283450388465, 1.0532659706834067, 1.0535036499504049, + 1.0537413828519411, 1.0539791694001188, 1.0542170096070436, 1.0544549034848243, + 1.0546928510455722, 1.0549308523014012, 1.0551689072644284, 1.0554070159467728, + 1.0556451783605572, 1.0558833945179062, 1.0561216644309479, 1.0563599881118126, + 1.0565983655726334, 1.0568367968255465, 1.0570752818826903, 1.0573138207562065, + 1.057552413458239, 1.0577910600009348, 1.0580297603964437, 1.058268514656918, + 1.0585073227945128, 1.0587461848213857, 1.058985100749698, 1.0592240705916123 +}; + +double bend_coarse[128] = { + 1, 1.0594630943592953, 1.122462048309373, 1.189207115002721, + 1.2599210498948732, 1.3348398541700344, 1.4142135623730951, 1.4983070768766815, + 1.5874010519681994, 1.681792830507429, 1.7817974362806785, 1.8877486253633868, + 2, 2.1189261887185906, 2.244924096618746, 2.3784142300054421, + 2.5198420997897464, 2.6696797083400687, 2.8284271247461903, 2.996614153753363, + 3.1748021039363992, 3.363585661014858, 3.5635948725613571, 3.7754972507267741, + 4, 4.2378523774371812, 4.4898481932374912, 4.7568284600108841, + 5.0396841995794928, 5.3393594166801366, 5.6568542494923806, 5.993228307506727, + 6.3496042078727974, 6.727171322029716, 7.1271897451227151, 7.5509945014535473, + 8, 8.4757047548743625, 8.9796963864749824, 9.5136569200217682, + 10.079368399158986, 10.678718833360273, 11.313708498984761, 11.986456615013454, + 12.699208415745595, 13.454342644059432, 14.25437949024543, 15.101989002907095, + 16, 16.951409509748721, 17.959392772949972, 19.027313840043536, + 20.158736798317967, 21.357437666720553, 22.627416997969522, 23.972913230026901, + 25.398416831491197, 26.908685288118864, 28.508758980490853, 30.203978005814196, + 32, 33.902819019497443, 35.918785545899944, 38.054627680087073, + 40.317473596635935, 42.714875333441107, 45.254833995939045, 47.945826460053802, + 50.796833662982394, 53.817370576237728, 57.017517960981706, 60.407956011628393, + 64, 67.805638038994886, 71.837571091799887, 76.109255360174146, + 80.63494719327187, 85.429750666882214, 90.509667991878089, 95.891652920107603, + 101.59366732596479, 107.63474115247546, 114.03503592196341, 120.81591202325679, + 128, 135.61127607798977, 143.67514218359977, 152.21851072034829, + 161.26989438654374, 170.85950133376443, 181.01933598375618, 191.78330584021521, + 203.18733465192958, 215.26948230495091, 228.07007184392683, 241.63182404651357, + 256, 271.22255215597971, 287.35028436719938, 304.43702144069658, + 322.53978877308765, 341.71900266752868, 362.03867196751236, 383.56661168043064, + 406.37466930385892, 430.53896460990183, 456.14014368785394, 483.26364809302686, + 512, 542.44510431195943, 574.70056873439876, 608.87404288139317, + 645.0795775461753, 683.43800533505737, 724.07734393502471, 767.13322336086128, + 812.74933860771785, 861.07792921980365, 912.28028737570787, 966.52729618605372, + 1024, 1084.8902086239189, 1149.4011374687975, 1217.7480857627863, + 1290.1591550923506, 1366.8760106701147, 1448.1546878700494, 1534.2664467217226 +}; + +#ifdef LOOKUP_SINE +static double sine_table[257]= +{ + 0, 0.0061358846491544753, 0.012271538285719925, 0.01840672990580482, + 0.024541228522912288, 0.030674803176636626, 0.036807222941358832, 0.04293825693494082, + 0.049067674327418015, 0.055195244349689934, 0.061320736302208578, 0.067443919563664051, + 0.073564563599667426, 0.079682437971430126, 0.085797312344439894, 0.091908956497132724, + 0.098017140329560604, 0.10412163387205459, 0.11022220729388306, 0.11631863091190475, + 0.1224106751992162, 0.12849811079379317, 0.13458070850712617, 0.14065823933284921, + 0.14673047445536175, 0.15279718525844344, 0.15885814333386145, 0.16491312048996989, + 0.17096188876030122, 0.17700422041214875, 0.18303988795514095, 0.18906866414980619, + 0.19509032201612825, 0.2011046348420919, 0.20711137619221856, 0.21311031991609136, + 0.2191012401568698, 0.22508391135979283, 0.23105810828067111, 0.2370236059943672, + 0.24298017990326387, 0.24892760574572015, 0.25486565960451457, 0.26079411791527551, + 0.26671275747489837, 0.27262135544994898, 0.27851968938505306, 0.28440753721127188, + 0.29028467725446233, 0.29615088824362379, 0.30200594931922808, 0.30784964004153487, + 0.31368174039889152, 0.31950203081601569, 0.32531029216226293, 0.33110630575987643, + 0.33688985339222005, 0.34266071731199438, 0.34841868024943456, 0.35416352542049034, + 0.35989503653498811, 0.36561299780477385, 0.37131719395183754, 0.37700741021641826, + 0.38268343236508978, 0.38834504669882625, 0.3939920400610481, 0.39962419984564679, + 0.40524131400498986, 0.41084317105790391, 0.41642956009763715, 0.42200027079979968, + 0.42755509343028208, 0.43309381885315196, 0.43861623853852766, 0.4441221445704292, + 0.44961132965460654, 0.45508358712634384, 0.46053871095824001, 0.46597649576796618, + 0.47139673682599764, 0.47679923006332209, 0.48218377207912272, 0.487550160148436, + 0.49289819222978404, 0.49822766697278187, 0.50353838372571758, 0.50883014254310699, + 0.51410274419322166, 0.51935599016558964, 0.52458968267846895, 0.52980362468629461, + 0.53499761988709715, 0.54017147272989285, 0.54532498842204646, 0.55045797293660481, + 0.55557023301960218, 0.56066157619733603, 0.56573181078361312, 0.57078074588696726, + 0.57580819141784534, 0.58081395809576453, 0.58579785745643886, 0.59075970185887416, + 0.59569930449243336, 0.60061647938386897, 0.60551104140432555, 0.61038280627630948, + 0.61523159058062682, 0.6200572117632891, 0.62485948814238634, 0.62963823891492698, + 0.63439328416364549, 0.63912444486377573, 0.64383154288979139, 0.64851440102211244, + 0.65317284295377676, 0.65780669329707864, 0.66241577759017178, 0.66699992230363747, + 0.67155895484701833, 0.67609270357531592, 0.68060099779545302, 0.68508366777270036, + 0.68954054473706683, 0.693971460889654, 0.69837624940897292, 0.7027547444572253, + 0.70710678118654746, 0.71143219574521643, 0.71573082528381859, 0.72000250796138165, + 0.72424708295146689, 0.7284643904482252, 0.73265427167241282, 0.73681656887736979, + 0.74095112535495911, 0.74505778544146595, 0.74913639452345926, 0.75318679904361241, + 0.75720884650648446, 0.76120238548426178, 0.76516726562245896, 0.76910333764557959, + 0.77301045336273699, 0.77688846567323244, 0.78073722857209438, 0.78455659715557524, + 0.78834642762660623, 0.79210657730021239, 0.79583690460888346, 0.79953726910790501, + 0.80320753148064483, 0.80684755354379922, 0.81045719825259477, 0.8140363297059483, + 0.81758481315158371, 0.82110251499110465, 0.82458930278502529, 0.8280450452577558, + 0.83146961230254524, 0.83486287498638001, 0.83822470555483797, 0.84155497743689833, + 0.84485356524970701, 0.84812034480329712, 0.8513551931052652, 0.85455798836540053, + 0.85772861000027212, 0.86086693863776731, 0.8639728561215867, 0.86704624551569265, + 0.87008699110871135, 0.87309497841829009, 0.8760700941954066, 0.87901222642863341, + 0.88192126434835494, 0.88479709843093779, 0.88763962040285393, 0.89044872324475788, + 0.89322430119551532, 0.89596624975618511, 0.89867446569395382, 0.90134884704602203, + 0.90398929312344334, 0.90659570451491533, 0.90916798309052227, 0.91170603200542988, + 0.91420975570353069, 0.9166790599210427, 0.91911385169005777, 0.9215140393420419, + 0.92387953251128674, 0.92621024213831127, 0.92850608047321548, 0.93076696107898371, + 0.93299279883473885, 0.9351835099389475, 0.93733901191257496, 0.93945922360218992, + 0.94154406518302081, 0.94359345816196039, 0.94560732538052128, 0.94758559101774109, + 0.94952818059303667, 0.95143502096900834, 0.95330604035419375, 0.95514116830577067, + 0.95694033573220894, 0.9587034748958716, 0.96043051941556579, 0.96212140426904158, + 0.96377606579543984, 0.9653944416976894, 0.96697647104485207, 0.96852209427441727, + 0.97003125319454397, 0.97150389098625178, 0.97293995220556007, 0.97433938278557586, + 0.97570213003852857, 0.97702814265775439, 0.97831737071962765, 0.97956976568544052, + 0.98078528040323043, 0.98196386910955524, 0.98310548743121629, 0.98421009238692903, + 0.98527764238894122, 0.98630809724459867, 0.98730141815785843, 0.98825756773074946, + 0.98917650996478101, 0.99005821026229712, 0.99090263542778001, 0.99170975366909953, + 0.99247953459870997, 0.9932119492347945, 0.99390697000235606, 0.99456457073425542, + 0.99518472667219682, 0.99576741446765982, 0.996312612182778, 0.99682029929116567, + 0.99729045667869021, 0.99772306664419164, 0.99811811290014918, 0.99847558057329477, + 0.99879545620517241, 0.99907772775264536, 0.99932238458834954, 0.99952941750109314, + 0.99969881869620425, 0.9998305817958234, 0.9999247018391445, 0.99998117528260111, + 1 +}; + +/* + looks up sin(2 * Pi * x / 1024) +*/ +FLOAT_T sine(int x) +{ + int xx = x & 0xFF; + switch ((x>>8) & 0x03) + { + default: /* just to shut gcc up. */ + case 0: + return sine_table[xx]; + case 1: + return sine_table[0x100 - xx]; + case 2: + return -sine_table[xx]; + case 3: + return -sine_table[0x100 - xx]; + } +} +#endif /* LOOKUP_SINE */ + +#ifdef LOOKUP_HACK +int16 _u2l[] = +{ + -32256, -31228, -30200, -29172, -28143, -27115, -26087, -25059, + -24031, -23002, -21974, -20946, -19918, -18889, -17861, -16833, + -16062, -15548, -15033, -14519, -14005, -13491, -12977, -12463, + -11949, -11435, -10920, -10406, -9892, -9378, -8864, -8350, + -7964, -7707, -7450, -7193, -6936, -6679, -6422, -6165, + -5908, -5651, -5394, -5137, -4880, -4623, -4365, -4108, + -3916, -3787, -3659, -3530, -3402, -3273, -3144, -3016, + -2887, -2759, -2630, -2502, -2373, -2245, -2116, -1988, + -1891, -1827, -1763, -1698, -1634, -1570, -1506, -1441, + -1377, -1313, -1249, -1184, -1120, -1056, -992, -927, + -879, -847, -815, -783, -751, -718, -686, -654, + -622, -590, -558, -526, -494, -461, -429, -397, + -373, -357, -341, -325, -309, -293, -277, -261, + -245, -228, -212, -196, -180, -164, -148, -132, + -120, -112, -104, -96, -88, -80, -72, -64, + -56, -48, -40, -32, -24, -16, -8, 0, + 32256, 31228, 30200, 29172, 28143, 27115, 26087, 25059, + 24031, 23002, 21974, 20946, 19918, 18889, 17861, 16833, + 16062, 15548, 15033, 14519, 14005, 13491, 12977, 12463, + 11949, 11435, 10920, 10406, 9892, 9378, 8864, 8350, + 7964, 7707, 7450, 7193, 6936, 6679, 6422, 6165, + 5908, 5651, 5394, 5137, 4880, 4623, 4365, 4108, + 3916, 3787, 3659, 3530, 3402, 3273, 3144, 3016, + 2887, 2759, 2630, 2502, 2373, 2245, 2116, 1988, + 1891, 1827, 1763, 1698, 1634, 1570, 1506, 1441, + 1377, 1313, 1249, 1184, 1120, 1056, 992, 927, + 879, 847, 815, 783, 751, 718, 686, 654, + 622, 590, 558, 526, 494, 461, 429, 397, + 373, 357, 341, 325, 309, 293, 277, 261, + 245, 228, 212, 196, 180, 164, 148, 132, + 120, 112, 104, 96, 88, 80, 72, 64, + 56, 48, 40, 32, 24, 16, 8, 0 +}; + +int32 *mixup; +#ifdef LOOKUP_INTERPOLATION +int8 *iplookup; +#endif + +#endif + +void init_tables(void) +{ +#ifdef LOOKUP_HACK + int i,j,v; + mixup=safe_malloc(1<<(7+8+2)); /* Give your cache a workout! */ + + for (i=0; i<128; i++) + { + v=_u2l[255-i]; + for (j=-128; j<128; j++) + { + mixup[ ((i & 0x7F)<<8) | (j & 0xFF)] = + (v * j) << MIXUP_SHIFT; + } + } + +#ifdef LOOKUP_INTERPOLATION + iplookup=safe_malloc(1<<(9+5)); + for (i=-256; i<256; i++) + for(j=0; j<32; j++) + iplookup[((i<<5) & 0x3FE0) | j] = (i * j)>>5; + /* I don't know. Quantum bits? Magick? */ +#endif + +#endif +} + +uint8 _l2u_[] = +{ + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, 0x01, + 0x01, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, 0x02, + 0x02, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, 0x03, + 0x03, 0x03, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, 0x04, + 0x04, 0x04, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, + 0x05, 0x05, 0x05, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, + 0x06, 0x06, 0x06, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, 0x07, + 0x07, 0x07, 0x07, 0x07, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, 0x08, + 0x08, 0x08, 0x08, 0x08, 0x08, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, 0x09, + 0x09, 0x09, 0x09, 0x09, 0x09, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, + 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0A, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, + 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0B, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, + 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0C, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, + 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0D, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, + 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0E, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, + 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x0F, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, + 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, + 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, + 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, + 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x10, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, + 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, + 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, + 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, + 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x11, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, + 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, + 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, + 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, + 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x12, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, + 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, + 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, + 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, + 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x13, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, + 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, + 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, + 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, + 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x14, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, + 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, + 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, + 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, + 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x15, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, + 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, + 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, + 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, + 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x16, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, + 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, + 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, + 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, + 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x17, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, + 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, + 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, + 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, + 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x18, 0x19, 0x19, 0x19, 0x19, 0x19, + 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, + 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, + 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, + 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x19, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, + 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, + 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, + 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, + 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1A, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, + 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, + 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, + 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, + 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1B, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, + 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, + 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, + 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, + 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1C, 0x1D, 0x1D, 0x1D, 0x1D, + 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, + 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, + 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, + 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1D, 0x1E, 0x1E, 0x1E, 0x1E, + 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, + 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, + 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, + 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1E, 0x1F, 0x1F, 0x1F, 0x1F, + 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, + 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, + 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, + 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x1F, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, + 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, + 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x21, 0x22, 0x22, 0x22, + 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, + 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x22, 0x23, 0x23, 0x23, + 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, + 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x23, 0x24, 0x24, 0x24, + 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, + 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x24, 0x25, 0x25, 0x25, + 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, + 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x25, 0x26, 0x26, 0x26, + 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, + 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x26, 0x27, 0x27, 0x27, + 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, + 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x27, 0x28, 0x28, + 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, + 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x28, 0x29, 0x29, + 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, + 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x29, 0x2A, 0x2A, + 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, + 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2A, 0x2B, 0x2B, + 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, + 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2B, 0x2C, 0x2C, + 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, + 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2C, 0x2D, 0x2D, + 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, + 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2D, 0x2E, 0x2E, + 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, + 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2E, 0x2F, 0x2F, + 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, + 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x2F, 0x30, + 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x31, + 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x31, 0x32, + 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x32, 0x33, + 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x33, 0x34, + 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x34, 0x35, + 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x35, 0x36, + 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x36, 0x37, + 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x37, 0x38, + 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x38, 0x39, + 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x39, 0x3A, + 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3A, 0x3B, + 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3B, 0x3C, + 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3C, 0x3D, + 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, 0x3D, + 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, 0x3E, + 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, 0x3F, + 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x40, 0x41, 0x41, 0x41, 0x41, 0x41, 0x41, 0x41, 0x41, + 0x42, 0x42, 0x42, 0x42, 0x42, 0x42, 0x42, 0x42, 0x43, 0x43, 0x43, 0x43, 0x43, 0x43, 0x43, 0x43, + 0x44, 0x44, 0x44, 0x44, 0x44, 0x44, 0x44, 0x44, 0x45, 0x45, 0x45, 0x45, 0x45, 0x45, 0x45, 0x45, + 0x46, 0x46, 0x46, 0x46, 0x46, 0x46, 0x46, 0x46, 0x47, 0x47, 0x47, 0x47, 0x47, 0x47, 0x47, 0x47, + 0x48, 0x48, 0x48, 0x48, 0x48, 0x48, 0x48, 0x48, 0x49, 0x49, 0x49, 0x49, 0x49, 0x49, 0x49, 0x49, + 0x4A, 0x4A, 0x4A, 0x4A, 0x4A, 0x4A, 0x4A, 0x4A, 0x4B, 0x4B, 0x4B, 0x4B, 0x4B, 0x4B, 0x4B, 0x4B, + 0x4C, 0x4C, 0x4C, 0x4C, 0x4C, 0x4C, 0x4C, 0x4C, 0x4D, 0x4D, 0x4D, 0x4D, 0x4D, 0x4D, 0x4D, 0x4D, + 0x4E, 0x4E, 0x4E, 0x4E, 0x4E, 0x4E, 0x4E, 0x4E, 0x4F, 0x4F, 0x4F, 0x4F, 0x4F, 0x4F, 0x4F, 0x4F, + 0x50, 0x50, 0x50, 0x50, 0x51, 0x51, 0x51, 0x51, 0x52, 0x52, 0x52, 0x52, 0x53, 0x53, 0x53, 0x53, + 0x54, 0x54, 0x54, 0x54, 0x55, 0x55, 0x55, 0x55, 0x56, 0x56, 0x56, 0x56, 0x57, 0x57, 0x57, 0x57, + 0x58, 0x58, 0x58, 0x58, 0x59, 0x59, 0x59, 0x59, 0x5A, 0x5A, 0x5A, 0x5A, 0x5B, 0x5B, 0x5B, 0x5B, + 0x5C, 0x5C, 0x5C, 0x5C, 0x5D, 0x5D, 0x5D, 0x5D, 0x5E, 0x5E, 0x5E, 0x5E, 0x5F, 0x5F, 0x5F, 0x5F, + 0x60, 0x60, 0x61, 0x61, 0x62, 0x62, 0x63, 0x63, 0x64, 0x64, 0x65, 0x65, 0x66, 0x66, 0x67, 0x67, + 0x68, 0x68, 0x68, 0x69, 0x69, 0x6A, 0x6A, 0x6B, 0x6B, 0x6C, 0x6C, 0x6D, 0x6D, 0x6E, 0x6E, 0x6F, + 0x6F, 0x70, 0x71, 0x72, 0x73, 0x74, 0x75, 0x76, 0x77, 0x78, 0x79, 0x7A, 0x7B, 0x7C, 0x7D, 0x7E, + 0xFF, 0xFE, 0xFD, 0xFC, 0xFB, 0xFA, 0xF9, 0xF8, 0xF7, 0xF6, 0xF5, 0xF4, 0xF3, 0xF2, 0xF1, 0xF0, + 0xEF, 0xEF, 0xEE, 0xEE, 0xED, 0xED, 0xEC, 0xEC, 0xEB, 0xEB, 0xEA, 0xEA, 0xE9, 0xE9, 0xE8, 0xE8, + 0xE7, 0xE7, 0xE6, 0xE6, 0xE5, 0xE5, 0xE4, 0xE4, 0xE3, 0xE3, 0xE2, 0xE2, 0xE1, 0xE1, 0xE0, 0xE0, + 0xDF, 0xDF, 0xDF, 0xDF, 0xDE, 0xDE, 0xDE, 0xDE, 0xDD, 0xDD, 0xDD, 0xDD, 0xDC, 0xDC, 0xDC, 0xDC, + 0xDB, 0xDB, 0xDB, 0xDB, 0xDA, 0xDA, 0xDA, 0xDA, 0xD9, 0xD9, 0xD9, 0xD9, 0xD8, 0xD8, 0xD8, 0xD8, + 0xD7, 0xD7, 0xD7, 0xD7, 0xD6, 0xD6, 0xD6, 0xD6, 0xD5, 0xD5, 0xD5, 0xD5, 0xD4, 0xD4, 0xD4, 0xD4, + 0xD3, 0xD3, 0xD3, 0xD3, 0xD2, 0xD2, 0xD2, 0xD2, 0xD1, 0xD1, 0xD1, 0xD1, 0xD0, 0xD0, 0xD0, 0xD0, + 0xCF, 0xCF, 0xCF, 0xCF, 0xCF, 0xCF, 0xCF, 0xCF, 0xCE, 0xCE, 0xCE, 0xCE, 0xCE, 0xCE, 0xCE, 0xCE, + 0xCD, 0xCD, 0xCD, 0xCD, 0xCD, 0xCD, 0xCD, 0xCD, 0xCC, 0xCC, 0xCC, 0xCC, 0xCC, 0xCC, 0xCC, 0xCC, + 0xCB, 0xCB, 0xCB, 0xCB, 0xCB, 0xCB, 0xCB, 0xCB, 0xCA, 0xCA, 0xCA, 0xCA, 0xCA, 0xCA, 0xCA, 0xCA, + 0xC9, 0xC9, 0xC9, 0xC9, 0xC9, 0xC9, 0xC9, 0xC9, 0xC8, 0xC8, 0xC8, 0xC8, 0xC8, 0xC8, 0xC8, 0xC8, + 0xC7, 0xC7, 0xC7, 0xC7, 0xC7, 0xC7, 0xC7, 0xC7, 0xC6, 0xC6, 0xC6, 0xC6, 0xC6, 0xC6, 0xC6, 0xC6, + 0xC5, 0xC5, 0xC5, 0xC5, 0xC5, 0xC5, 0xC5, 0xC5, 0xC4, 0xC4, 0xC4, 0xC4, 0xC4, 0xC4, 0xC4, 0xC4, + 0xC3, 0xC3, 0xC3, 0xC3, 0xC3, 0xC3, 0xC3, 0xC3, 0xC3, 0xC2, 0xC2, 0xC2, 0xC2, 0xC2, 0xC2, 0xC2, + 0xC2, 0xC1, 0xC1, 0xC1, 0xC1, 0xC1, 0xC1, 0xC1, 0xC1, 0xC0, 0xC0, 0xC0, 0xC0, 0xC0, 0xC0, 0xC0, + 0xC0, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, 0xBF, + 0xBF, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, 0xBE, + 0xBE, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, 0xBD, + 0xBD, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, 0xBC, + 0xBC, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, 0xBB, + 0xBB, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, 0xBA, + 0xBA, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, 0xB9, + 0xB9, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, 0xB8, + 0xB8, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, 0xB7, + 0xB7, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, 0xB6, + 0xB6, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, 0xB5, + 0xB5, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, 0xB4, + 0xB4, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, 0xB3, + 0xB3, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, 0xB2, + 0xB2, 0xB2, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, 0xB1, + 0xB1, 0xB1, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, 0xB0, + 0xB0, 0xB0, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, + 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, 0xAF, + 0xAF, 0xAF, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, + 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, 0xAE, + 0xAE, 0xAE, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, + 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, 0xAD, + 0xAD, 0xAD, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, + 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, 0xAC, + 0xAC, 0xAC, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, + 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, 0xAB, + 0xAB, 0xAB, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, + 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, 0xAA, + 0xAA, 0xAA, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, + 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, 0xA9, + 0xA9, 0xA9, 0xA9, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, + 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, 0xA8, + 0xA8, 0xA8, 0xA8, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, + 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, 0xA7, + 0xA7, 0xA7, 0xA7, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, + 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, 0xA6, + 0xA6, 0xA6, 0xA6, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, + 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, 0xA5, + 0xA5, 0xA5, 0xA5, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, + 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, 0xA4, + 0xA4, 0xA4, 0xA4, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, + 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, 0xA3, + 0xA3, 0xA3, 0xA3, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, + 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, 0xA2, + 0xA2, 0xA2, 0xA2, 0xA2, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, + 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, 0xA1, + 0xA1, 0xA1, 0xA1, 0xA1, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, + 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, 0xA0, + 0xA0, 0xA0, 0xA0, 0xA0, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, + 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, + 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, + 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, 0x9F, + 0x9F, 0x9F, 0x9F, 0x9F, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, + 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, + 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, + 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, 0x9E, + 0x9E, 0x9E, 0x9E, 0x9E, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, + 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, + 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, + 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, + 0x9D, 0x9D, 0x9D, 0x9D, 0x9D, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, + 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, + 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, + 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, + 0x9C, 0x9C, 0x9C, 0x9C, 0x9C, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, + 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, + 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, + 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, + 0x9B, 0x9B, 0x9B, 0x9B, 0x9B, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, + 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, + 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, + 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, + 0x9A, 0x9A, 0x9A, 0x9A, 0x9A, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, + 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, + 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, + 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, + 0x99, 0x99, 0x99, 0x99, 0x99, 0x99, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, + 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, + 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, + 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, + 0x98, 0x98, 0x98, 0x98, 0x98, 0x98, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, + 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, + 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, + 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, + 0x97, 0x97, 0x97, 0x97, 0x97, 0x97, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, + 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, + 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, + 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, + 0x96, 0x96, 0x96, 0x96, 0x96, 0x96, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, + 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, + 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, + 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, + 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x95, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, + 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, + 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, + 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, + 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x94, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, + 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, + 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, + 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, + 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x93, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, + 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, + 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, + 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, + 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x92, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, + 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, + 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, + 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, + 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x91, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, + 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, + 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, + 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, + 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x90, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, + 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8F, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, + 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8E, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, + 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8D, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, + 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8C, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, + 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8B, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, + 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x8A, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, + 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x89, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, + 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x88, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, + 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x87, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, + 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x86, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, + 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x85, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, + 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x84, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, + 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x83, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, + 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x82, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, 0x81, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, + 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80, 0x80 +}; + +uint8 *_l2u = _l2u_ + 4096; + + +/* $Id$ Greg Lee */ +int xmap[XMAPMAX][5] = { +{ SFXBANK, 0, 0, 120, 0 }, +{ SFXBANK, 0, 1, 120, 1 }, +{ SFXBANK, 0, 2, 120, 2 }, +{ SFXBANK, 0, 3, 120, 3 }, +{ SFXBANK, 0, 4, 120, 4 }, +{ SFXBANK, 0, 5, 120, 5 }, +{ SFXBANK, 0, 16, 120, 16 }, +{ SFXBANK, 0, 32, 120, 32 }, +{ SFXBANK, 0, 33, 120, 33 }, +{ SFXBANK, 0, 34, 120, 34 }, +{ SFXBANK, 0, 35, 120, 35 }, +{ SFXBANK, 0, 36, 120, 36 }, +{ SFXBANK, 0, 48, 120, 48 }, +{ SFXBANK, 0, 49, 120, 49 }, +{ SFXBANK, 0, 50, 120, 50 }, +{ SFXBANK, 0, 51, 120, 51 }, +{ SFXBANK, 0, 52, 120, 52 }, +{ SFXBANK, 0, 54, 120, 54 }, +{ SFXBANK, 0, 55, 120, 55 }, +{ SFXBANK, 0, 64, 120, 64 }, +{ SFXBANK, 0, 65, 120, 65 }, +{ SFXBANK, 0, 66, 120, 66 }, +{ SFXBANK, 0, 67, 120, 67 }, +{ SFXBANK, 0, 68, 120, 68 }, +{ SFXBANK, 0, 69, 120, 69 }, +{ SFXBANK, 0, 70, 120, 70 }, +{ SFXBANK, 0, 80, 120, 80 }, +{ SFXBANK, 0, 81, 120, 81 }, +{ SFXBANK, 0, 82, 120, 82 }, +{ SFXBANK, 0, 83, 120, 83 }, +{ SFXBANK, 0, 84, 120, 84 }, +{ SFXBANK, 0, 85, 120, 85 }, +{ SFXBANK, 0, 86, 120, 86 }, +{ SFXBANK, 0, 87, 120, 87 }, +{ SFXBANK, 0, 88, 120, 88 }, +{ SFXBANK, 0, 89, 120, 89 }, +{ SFXBANK, 0, 90, 120, 90 }, +{ SFXBANK, 0, 96, 120, 96 }, +{ SFXBANK, 0, 97, 120, 97 }, +{ SFXBANK, 0, 98, 120, 98 }, +{ SFXBANK, 0, 99, 120, 99 }, +{ SFXBANK, 0, 100, 120, 100 }, +{ SFXBANK, 0, 101, 120, 101 }, +{ SFXBANK, 0, 112, 120, 112 }, +{ SFXBANK, 0, 113, 120, 113 }, +{ SFXBANK, 0, 114, 120, 114 }, +{ SFXBANK, 0, 115, 120, 115 }, +{ SFXDRUM1, 0, 36, 121, 36 }, +{ SFXDRUM1, 0, 37, 121, 37 }, +{ SFXDRUM1, 0, 38, 121, 38 }, +{ SFXDRUM1, 0, 39, 121, 39 }, +{ SFXDRUM1, 0, 40, 121, 40 }, +{ SFXDRUM1, 0, 41, 121, 41 }, +{ SFXDRUM1, 0, 52, 121, 52 }, +{ SFXDRUM1, 0, 68, 121, 68 }, +{ SFXDRUM1, 0, 69, 121, 69 }, +{ SFXDRUM1, 0, 70, 121, 70 }, +{ SFXDRUM1, 0, 71, 121, 71 }, +{ SFXDRUM1, 0, 72, 121, 72 }, +{ SFXDRUM1, 0, 84, 121, 84 }, +{ SFXDRUM1, 0, 85, 121, 85 }, +{ SFXDRUM1, 0, 86, 121, 86 }, +{ SFXDRUM1, 0, 87, 121, 87 }, +{ SFXDRUM1, 0, 88, 121, 88 }, +{ SFXDRUM1, 0, 90, 121, 90 }, +{ SFXDRUM1, 0, 91, 121, 91 }, +{ SFXDRUM1, 1, 36, 122, 36 }, +{ SFXDRUM1, 1, 37, 122, 37 }, +{ SFXDRUM1, 1, 38, 122, 38 }, +{ SFXDRUM1, 1, 39, 122, 39 }, +{ SFXDRUM1, 1, 40, 122, 40 }, +{ SFXDRUM1, 1, 41, 122, 41 }, +{ SFXDRUM1, 1, 42, 122, 42 }, +{ SFXDRUM1, 1, 52, 122, 52 }, +{ SFXDRUM1, 1, 53, 122, 53 }, +{ SFXDRUM1, 1, 54, 122, 54 }, +{ SFXDRUM1, 1, 55, 122, 55 }, +{ SFXDRUM1, 1, 56, 122, 56 }, +{ SFXDRUM1, 1, 57, 122, 57 }, +{ SFXDRUM1, 1, 58, 122, 58 }, +{ SFXDRUM1, 1, 59, 122, 59 }, +{ SFXDRUM1, 1, 60, 122, 60 }, +{ SFXDRUM1, 1, 61, 122, 61 }, +{ SFXDRUM1, 1, 62, 122, 62 }, +{ SFXDRUM1, 1, 68, 122, 68 }, +{ SFXDRUM1, 1, 69, 122, 69 }, +{ SFXDRUM1, 1, 70, 122, 70 }, +{ SFXDRUM1, 1, 71, 122, 71 }, +{ SFXDRUM1, 1, 72, 122, 72 }, +{ SFXDRUM1, 1, 73, 122, 73 }, +{ SFXDRUM1, 1, 84, 122, 84 }, +{ SFXDRUM1, 1, 85, 122, 85 }, +{ SFXDRUM1, 1, 86, 122, 86 }, +{ SFXDRUM1, 1, 87, 122, 87 }, +{ XGDRUM, 0, 25, 40, 38 }, +{ XGDRUM, 0, 26, 40, 40 }, +{ XGDRUM, 0, 27, 40, 39 }, +{ XGDRUM, 0, 28, 40, 30 }, +{ XGDRUM, 0, 29, 0, 25 }, +{ XGDRUM, 0, 30, 0, 85 }, +{ XGDRUM, 0, 31, 0, 38 }, +{ XGDRUM, 0, 32, 0, 37 }, +{ XGDRUM, 0, 33, 0, 36 }, +{ XGDRUM, 0, 34, 0, 38 }, +{ XGDRUM, 0, 62, 0, 101 }, +{ XGDRUM, 0, 63, 0, 102 }, +{ XGDRUM, 0, 64, 0, 103 }, +{ XGDRUM, 8, 25, 40, 38 }, +{ XGDRUM, 8, 26, 40, 40 }, +{ XGDRUM, 8, 27, 40, 39 }, +{ XGDRUM, 8, 28, 40, 40 }, +{ XGDRUM, 8, 29, 8, 25 }, +{ XGDRUM, 8, 30, 8, 85 }, +{ XGDRUM, 8, 31, 8, 38 }, +{ XGDRUM, 8, 32, 8, 37 }, +{ XGDRUM, 8, 33, 8, 36 }, +{ XGDRUM, 8, 34, 8, 38 }, +{ XGDRUM, 8, 62, 8, 101 }, +{ XGDRUM, 8, 63, 8, 102 }, +{ XGDRUM, 8, 64, 8, 103 }, +{ XGDRUM, 16, 25, 40, 38 }, +{ XGDRUM, 16, 26, 40, 40 }, +{ XGDRUM, 16, 27, 40, 39 }, +{ XGDRUM, 16, 28, 40, 40 }, +{ XGDRUM, 16, 29, 16, 25 }, +{ XGDRUM, 16, 30, 16, 85 }, +{ XGDRUM, 16, 31, 16, 38 }, +{ XGDRUM, 16, 32, 16, 37 }, +{ XGDRUM, 16, 33, 16, 36 }, +{ XGDRUM, 16, 34, 16, 38 }, +{ XGDRUM, 16, 62, 16, 101 }, +{ XGDRUM, 16, 63, 16, 102 }, +{ XGDRUM, 16, 64, 16, 103 }, +{ XGDRUM, 24, 25, 40, 38 }, +{ XGDRUM, 24, 26, 40, 40 }, +{ XGDRUM, 24, 27, 40, 39 }, +{ XGDRUM, 24, 28, 24, 100 }, +{ XGDRUM, 24, 29, 24, 25 }, +{ XGDRUM, 24, 30, 24, 15 }, +{ XGDRUM, 24, 31, 24, 38 }, +{ XGDRUM, 24, 32, 24, 37 }, +{ XGDRUM, 24, 33, 24, 36 }, +{ XGDRUM, 24, 34, 24, 38 }, +{ XGDRUM, 24, 62, 24, 101 }, +{ XGDRUM, 24, 63, 24, 102 }, +{ XGDRUM, 24, 64, 24, 103 }, +{ XGDRUM, 24, 78, 0, 17 }, +{ XGDRUM, 24, 79, 0, 18 }, +{ XGDRUM, 25, 25, 40, 38 }, +{ XGDRUM, 25, 26, 40, 40 }, +{ XGDRUM, 25, 27, 40, 39 }, +{ XGDRUM, 25, 28, 25, 100 }, +{ XGDRUM, 25, 29, 25, 25 }, +{ XGDRUM, 25, 30, 25, 15 }, +{ XGDRUM, 25, 31, 25, 38 }, +{ XGDRUM, 25, 32, 25, 37 }, +{ XGDRUM, 25, 33, 25, 36 }, +{ XGDRUM, 25, 34, 25, 38 }, +{ XGDRUM, 25, 78, 0, 17 }, +{ XGDRUM, 25, 79, 0, 18 }, +{ XGDRUM, 32, 25, 40, 38 }, +{ XGDRUM, 32, 26, 40, 40 }, +{ XGDRUM, 32, 27, 40, 39 }, +{ XGDRUM, 32, 28, 40, 40 }, +{ XGDRUM, 32, 29, 32, 25 }, +{ XGDRUM, 32, 30, 32, 85 }, +{ XGDRUM, 32, 31, 32, 38 }, +{ XGDRUM, 32, 32, 32, 37 }, +{ XGDRUM, 32, 33, 32, 36 }, +{ XGDRUM, 32, 34, 32, 38 }, +{ XGDRUM, 32, 62, 32, 101 }, +{ XGDRUM, 32, 63, 32, 102 }, +{ XGDRUM, 32, 64, 32, 103 }, +{ XGDRUM, 40, 25, 40, 38 }, +{ XGDRUM, 40, 26, 40, 40 }, +{ XGDRUM, 40, 27, 40, 39 }, +{ XGDRUM, 40, 28, 40, 40 }, +{ XGDRUM, 40, 29, 40, 25 }, +{ XGDRUM, 40, 30, 40, 85 }, +{ XGDRUM, 40, 31, 40, 39 }, +{ XGDRUM, 40, 32, 40, 37 }, +{ XGDRUM, 40, 33, 40, 36 }, +{ XGDRUM, 40, 34, 40, 38 }, +{ XGDRUM, 40, 38, 40, 39 }, +{ XGDRUM, 40, 39, 0, 39 }, +{ XGDRUM, 40, 40, 40, 38 }, +{ XGDRUM, 40, 42, 0, 42 }, +{ XGDRUM, 40, 46, 0, 46 }, +{ XGDRUM, 40, 62, 40, 101 }, +{ XGDRUM, 40, 63, 40, 102 }, +{ XGDRUM, 40, 64, 40, 103 }, +{ XGDRUM, 40, 87, 40, 87 } +}; diff --git a/apps/plugins/sdl/SDL_mixer/timidity/tables.h b/apps/plugins/sdl/SDL_mixer/timidity/tables.h new file mode 100644 index 0000000..6bb7fef --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/tables.h @@ -0,0 +1,35 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#ifdef LOOKUP_SINE +extern FLOAT_T sine(int x); +#else +#define sine(x) (sin((2*PI/1024.0) * (x))) +#endif + +#define SINE_CYCLE_LENGTH 1024 +extern int32 freq_table[]; +extern double vol_table[]; +extern double expr_table[]; +extern double bend_fine[]; +extern double bend_coarse[]; +extern uint8 *_l2u; /* 13-bit PCM to 8-bit u-law */ +extern uint8 _l2u_[]; /* used in LOOKUP_HACK */ +#ifdef LOOKUP_HACK +extern int16 _u2l[]; +extern int32 *mixup; +#ifdef LOOKUP_INTERPOLATION +extern int8 *iplookup; +#endif +#endif + +extern void init_tables(void); + +#define XMAPMAX 800 +extern int xmap[XMAPMAX][5]; + diff --git a/apps/plugins/sdl/SDL_mixer/timidity/timidity.c b/apps/plugins/sdl/SDL_mixer/timidity/timidity.c new file mode 100644 index 0000000..7d3214f --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/timidity.c @@ -0,0 +1,359 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +#include "SDL.h" +#include "config.h" +#include "common.h" +#include "instrum.h" +#include "playmidi.h" +#include "readmidi.h" +#include "output.h" +#include "ctrlmode.h" +#include "timidity.h" + +#include "tables.h" + +void (*s32tobuf)(void *dp, int32 *lp, int32 c); +int free_instruments_afterwards=0; +static char def_instr_name[256]=""; + +int AUDIO_BUFFER_SIZE; +resample_t *resample_buffer=NULL; +int32 *common_buffer=NULL; +int num_ochannels; + +#define MAXWORDS 10 + +static int read_config_file(const char *name) +{ + FILE *fp; + char tmp[PATH_MAX], *w[MAXWORDS], *cp; + ToneBank *bank=0; + int i, j, k, line=0, words; + static int rcf_count=0; + + if (rcf_count>50) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "Probable source loop in configuration files"); + return (-1); + } + + if (!(fp=open_file(name, 1, OF_VERBOSE))) + return -1; + + while (fgets(tmp, sizeof(tmp), fp)) + { + line++; + w[words=0]=strtok(tmp, " \t\r\n\240"); + if (!w[0] || (*w[0]=='#')) continue; + while (w[words] && (words < MAXWORDS)) + { + w[++words]=strtok(0," \t\r\n\240"); + if (w[words] && w[words][0]=='#') break; + } + if (!strcmp(w[0], "map")) continue; + if (!strcmp(w[0], "dir")) + { + if (words < 2) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: No directory given\n", name, line); + return -2; + } + for (i=1; icmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: No file name given\n", name, line); + return -2; + } + for (i=1; icmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: Must specify exactly one patch name\n", + name, line); + return -2; + } + strncpy(def_instr_name, w[1], 255); + def_instr_name[255]='\0'; + } + else if (!strcmp(w[0], "drumset")) + { + if (words < 2) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: No drum set number given\n", + name, line); + return -2; + } + i=atoi(w[1]); + if (i<0 || i>127) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: Drum set must be between 0 and 127\n", + name, line); + return -2; + } + if (!drumset[i]) + { + drumset[i]=safe_malloc(sizeof(ToneBank)); + memset(drumset[i], 0, sizeof(ToneBank)); + } + bank=drumset[i]; + } + else if (!strcmp(w[0], "bank")) + { + if (words < 2) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: No bank number given\n", + name, line); + return -2; + } + i=atoi(w[1]); + if (i<0 || i>127) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: Tone bank must be between 0 and 127\n", + name, line); + return -2; + } + if (!tonebank[i]) + { + tonebank[i]=safe_malloc(sizeof(ToneBank)); + memset(tonebank[i], 0, sizeof(ToneBank)); + } + bank=tonebank[i]; + } + else { + if ((words < 2) || (*w[0] < '0' || *w[0] > '9')) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: syntax error\n", name, line); + return -2; + } + i=atoi(w[0]); + if (i<0 || i>127) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: Program must be between 0 and 127\n", + name, line); + return -2; + } + if (!bank) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: Must specify tone bank or drum set " + "before assignment\n", + name, line); + return -2; + } + if (bank->tone[i].name) + free(bank->tone[i].name); + strcpy((bank->tone[i].name=safe_malloc(strlen(w[1])+1)),w[1]); + bank->tone[i].note=bank->tone[i].amp=bank->tone[i].pan= + bank->tone[i].strip_loop=bank->tone[i].strip_envelope= + bank->tone[i].strip_tail=-1; + + for (j=2; j '9')) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: amplification must be between " + "0 and %d\n", name, line, MAX_AMPLIFICATION); + return -2; + } + bank->tone[i].amp=k; + } + else if (!strcmp(w[j], "note")) + { + k=atoi(cp); + if ((k<0 || k>127) || (*cp < '0' || *cp > '9')) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: note must be between 0 and 127\n", + name, line); + return -2; + } + bank->tone[i].note=k; + } + else if (!strcmp(w[j], "pan")) + { + if (!strcmp(cp, "center")) + k=64; + else if (!strcmp(cp, "left")) + k=0; + else if (!strcmp(cp, "right")) + k=127; + else + k=((atoi(cp)+100) * 100) / 157; + if ((k<0 || k>127) || + (k==0 && *cp!='-' && (*cp < '0' || *cp > '9'))) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: panning must be left, right, " + "center, or between -100 and 100\n", + name, line); + return -2; + } + bank->tone[i].pan=k; + } + else if (!strcmp(w[j], "keep")) + { + if (!strcmp(cp, "env")) + bank->tone[i].strip_envelope=0; + else if (!strcmp(cp, "loop")) + bank->tone[i].strip_loop=0; + else + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: keep must be env or loop\n", name, line); + return -2; + } + } + else if (!strcmp(w[j], "strip")) + { + if (!strcmp(cp, "env")) + bank->tone[i].strip_envelope=1; + else if (!strcmp(cp, "loop")) + bank->tone[i].strip_loop=1; + else if (!strcmp(cp, "tail")) + bank->tone[i].strip_tail=1; + else + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, + "%s: line %d: strip must be env, loop, or tail\n", + name, line); + return -2; + } + } + else + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "%s: line %d: bad patch option %s\n", + name, line, w[j]); + return -2; + } + } + } + } + if (ferror(fp)) + { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "Can't read from %s\n", name); + close_file(fp); + return -2; + } + close_file(fp); + return 0; +} + +int Timidity_Init(int rate, int format, int channels, int samples) +{ + const char *env = getenv("TIMIDITY_CFG"); + if (!env || read_config_file(env)<0) { + if (read_config_file(CONFIG_FILE)<0) { + if (read_config_file(CONFIG_FILE_ETC)<0) { + return(-1); + } + } + } + + if (channels < 1 || channels == 3 || channels == 5 || channels > 6) return(-1); + + num_ochannels = channels; + + /* Set play mode parameters */ + play_mode->rate = rate; + play_mode->encoding = 0; + if ( (format&0xFF) == 16 ) { + play_mode->encoding |= PE_16BIT; + } + if ( (format&0x8000) ) { + play_mode->encoding |= PE_SIGNED; + } + if ( channels == 1 ) { + play_mode->encoding |= PE_MONO; + } + switch (format) { + case AUDIO_S8: + s32tobuf = s32tos8; + break; + case AUDIO_U8: + s32tobuf = s32tou8; + break; + case AUDIO_S16LSB: + s32tobuf = s32tos16l; + break; + case AUDIO_S16MSB: + s32tobuf = s32tos16b; + break; + case AUDIO_U16LSB: + s32tobuf = s32tou16l; + break; + case AUDIO_U16MSB: + s32tobuf = s32tou16b; + break; + default: + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "Unsupported audio format"); + return(-1); + } + AUDIO_BUFFER_SIZE = samples; + + /* Allocate memory for mixing (WARNING: Memory leak!) */ + resample_buffer = safe_malloc(AUDIO_BUFFER_SIZE*sizeof(resample_t)+100); + common_buffer = safe_malloc(AUDIO_BUFFER_SIZE*num_ochannels*sizeof(int32)); + + init_tables(); + + if (ctl->open(0, 0)) { + ctl->cmsg(CMSG_ERROR, VERB_NORMAL, "Couldn't open %s\n", ctl->id_name); + return(-1); + } + + if (!control_ratio) { + control_ratio = play_mode->rate / CONTROLS_PER_SECOND; + if(control_ratio<1) + control_ratio=1; + else if (control_ratio > MAX_CONTROL_RATIO) + control_ratio=MAX_CONTROL_RATIO; + } + if (*def_instr_name) + set_default_instrument(def_instr_name); + return(0); +} + +char timidity_error[TIMIDITY_ERROR_SIZE] = ""; +const char *Timidity_Error(void) +{ + return(timidity_error); +} + diff --git a/apps/plugins/sdl/SDL_mixer/timidity/timidity.h b/apps/plugins/sdl/SDL_mixer/timidity/timidity.h new file mode 100644 index 0000000..ec1dbe8 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/timidity/timidity.h @@ -0,0 +1,20 @@ +/* + TiMidity -- Experimental MIDI to WAVE converter + Copyright (C) 1995 Tuukka Toivonen + + This program is free software; you can redistribute it and/or modify + it under the terms of the Perl Artistic License, available in COPYING. + */ + +typedef struct _MidiSong MidiSong; + +extern int Timidity_Init(int rate, int format, int channels, int samples); +extern const char *Timidity_Error(void); +extern void Timidity_SetVolume(int volume); +extern int Timidity_PlaySome(void *stream, int samples); +extern MidiSong *Timidity_LoadSong_RW(SDL_RWops *rw, int freerw); +extern void Timidity_Start(MidiSong *song); +extern int Timidity_Active(void); +extern void Timidity_Stop(void); +extern void Timidity_FreeSong(MidiSong *song); +extern void Timidity_Close(void); diff --git a/apps/plugins/sdl/SDL_mixer/wavestream.c b/apps/plugins/sdl/SDL_mixer/wavestream.c new file mode 100644 index 0000000..4e95da7 --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/wavestream.c @@ -0,0 +1,521 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +/* This file supports streaming WAV files, without volume adjustment */ + +#include "SDL_audio.h" +#include "SDL_mutex.h" +#include "SDL_rwops.h" +#include "SDL_endian.h" + +#include "SDL_mixer.h" +#include "wavestream.h" + +/* + Taken with permission from SDL_wave.h, part of the SDL library, + available at: http://www.libsdl.org/ + and placed under the same license as this mixer library. +*/ + +/* WAVE files are little-endian */ + +/*******************************************/ +/* Define values for Microsoft WAVE format */ +/*******************************************/ +#define RIFF 0x46464952 /* "RIFF" */ +#define WAVE 0x45564157 /* "WAVE" */ +#define FACT 0x74636166 /* "fact" */ +#define LIST 0x5453494c /* "LIST" */ +#define FMT 0x20746D66 /* "fmt " */ +#define DATA 0x61746164 /* "data" */ +#define PCM_CODE 1 +#define ADPCM_CODE 2 +#define WAVE_MONO 1 +#define WAVE_STEREO 2 + +/* Normally, these three chunks come consecutively in a WAVE file */ +typedef struct WaveFMT { +/* Not saved in the chunk we read: + Uint32 FMTchunk; + Uint32 fmtlen; +*/ + Uint16 encoding; + Uint16 channels; /* 1 = mono, 2 = stereo */ + Uint32 frequency; /* One of 11025, 22050, or 44100 Hz */ + Uint32 byterate; /* Average bytes per second */ + Uint16 blockalign; /* Bytes per sample block */ + Uint16 bitspersample; /* One of 8, 12, 16, or 4 for ADPCM */ +} WaveFMT; + +/* The general chunk found in the WAVE file */ +typedef struct Chunk { + Uint32 magic; + Uint32 length; + Uint8 *data; /* Data includes magic and length */ +} Chunk; + +/*********************************************/ +/* Define values for AIFF (IFF audio) format */ +/*********************************************/ +#define FORM 0x4d524f46 /* "FORM" */ +#define AIFF 0x46464941 /* "AIFF" */ +#define SSND 0x444e5353 /* "SSND" */ +#define COMM 0x4d4d4f43 /* "COMM" */ + + +/* Currently we only support a single stream at a time */ +static WAVStream *music = NULL; + +/* This is the format of the audio mixer data */ +static SDL_AudioSpec mixer; +static int wavestream_volume = MIX_MAX_VOLUME; + +/* Function to load the WAV/AIFF stream */ +static SDL_RWops *LoadWAVStream (SDL_RWops *rw, SDL_AudioSpec *spec, + long *start, long *stop); +static SDL_RWops *LoadAIFFStream (SDL_RWops *rw, SDL_AudioSpec *spec, + long *start, long *stop); + +/* Initialize the WAVStream player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +int WAVStream_Init(SDL_AudioSpec *mixerfmt) +{ + mixer = *mixerfmt; + return(0); +} + +void WAVStream_SetVolume(int volume) +{ + wavestream_volume = volume; +} + +/* Load a WAV stream from the given RWops object */ +WAVStream *WAVStream_LoadSong_RW(SDL_RWops *rw, const char *magic, int freerw) +{ + WAVStream *wave; + SDL_AudioSpec wavespec; + + if ( ! mixer.format ) { + Mix_SetError("WAV music output not started"); + if ( freerw ) { + SDL_RWclose(rw); + } + return(NULL); + } + wave = (WAVStream *)SDL_malloc(sizeof *wave); + if ( wave ) { + memset(wave, 0, (sizeof *wave)); + wave->freerw = freerw; + if ( strcmp(magic, "RIFF") == 0 ) { + wave->rw = LoadWAVStream(rw, &wavespec, + &wave->start, &wave->stop); + } else + if ( strcmp(magic, "FORM") == 0 ) { + wave->rw = LoadAIFFStream(rw, &wavespec, + &wave->start, &wave->stop); + } else { + Mix_SetError("Unknown WAVE format"); + } + if ( wave->rw == NULL ) { + SDL_free(wave); + if ( freerw ) { + SDL_RWclose(rw); + } + return(NULL); + } + SDL_BuildAudioCVT(&wave->cvt, + wavespec.format, wavespec.channels, wavespec.freq, + mixer.format, mixer.channels, mixer.freq); + } else { + SDL_OutOfMemory(); + if ( freerw ) { + SDL_RWclose(rw); + } + return(NULL); + } + return(wave); +} + +/* Start playback of a given WAV stream */ +void WAVStream_Start(WAVStream *wave) +{ + SDL_RWseek (wave->rw, wave->start, RW_SEEK_SET); + music = wave; +} + +/* Play some of a stream previously started with WAVStream_Start() */ +int WAVStream_PlaySome(Uint8 *stream, int len) +{ + long pos; + int left = 0; + + if ( music && ((pos=SDL_RWtell(music->rw)) < music->stop) ) { + if ( music->cvt.needed ) { + int original_len; + + original_len=(int)((double)len/music->cvt.len_ratio); + if ( music->cvt.len != original_len ) { + int worksize; + if ( music->cvt.buf != NULL ) { + SDL_free(music->cvt.buf); + } + worksize = original_len*music->cvt.len_mult; + music->cvt.buf=(Uint8 *)SDL_malloc(worksize); + if ( music->cvt.buf == NULL ) { + return 0; + } + music->cvt.len = original_len; + } + if ( (music->stop - pos) < original_len ) { + left = (original_len - (music->stop - pos)); + original_len -= left; + left = (int)((double)left*music->cvt.len_ratio); + } + original_len = SDL_RWread(music->rw, music->cvt.buf,1,original_len); + /* At least at the time of writing, SDL_ConvertAudio() + does byte-order swapping starting at the end of the + buffer. Thus, if we are reading 16-bit samples, we + had better make damn sure that we get an even + number of bytes, or we'll get garbage. + */ + if ( (music->cvt.src_format & 0x0010) && (original_len & 1) ) { + original_len--; + } + music->cvt.len = original_len; + SDL_ConvertAudio(&music->cvt); + SDL_MixAudio(stream, music->cvt.buf, music->cvt.len_cvt, wavestream_volume); + } else { + Uint8 *data; + if ( (music->stop - pos) < len ) { + left = (len - (music->stop - pos)); + len -= left; + } + data = SDL_stack_alloc(Uint8, len); + if (data) + { + SDL_RWread(music->rw, data, len, 1); + SDL_MixAudio(stream, data, len, wavestream_volume); + SDL_stack_free(data); + } + } + } + return left; +} + +/* Stop playback of a stream previously started with WAVStream_Start() */ +void WAVStream_Stop(void) +{ + music = NULL; +} + +/* Close the given WAV stream */ +void WAVStream_FreeSong(WAVStream *wave) +{ + if ( wave ) { + /* Clean up associated data */ + if ( wave->cvt.buf ) { + SDL_free(wave->cvt.buf); + } + if ( wave->freerw ) { + SDL_RWclose(wave->rw); + } + SDL_free(wave); + } +} + +/* Return non-zero if a stream is currently playing */ +int WAVStream_Active(void) +{ + int active; + + active = 0; + if ( music && (SDL_RWtell(music->rw) < music->stop) ) { + active = 1; + } + return(active); +} + +static int ReadChunk(SDL_RWops *src, Chunk *chunk, int read_data) +{ + chunk->magic = SDL_ReadLE32(src); + chunk->length = SDL_ReadLE32(src); + if ( read_data ) { + chunk->data = (Uint8 *)SDL_malloc(chunk->length); + if ( chunk->data == NULL ) { + Mix_SetError("Out of memory"); + return(-1); + } + if ( SDL_RWread(src, chunk->data, chunk->length, 1) != 1 ) { + Mix_SetError("Couldn't read chunk"); + SDL_free(chunk->data); + return(-1); + } + } else { + SDL_RWseek(src, chunk->length, RW_SEEK_CUR); + } + return(chunk->length); +} + +static SDL_RWops *LoadWAVStream (SDL_RWops *src, SDL_AudioSpec *spec, + long *start, long *stop) +{ + int was_error; + Chunk chunk; + int lenread; + + /* WAV magic header */ + Uint32 RIFFchunk; + Uint32 wavelen; + Uint32 WAVEmagic; + + /* FMT chunk */ + WaveFMT *format = NULL; + + was_error = 0; + + /* Check the magic header */ + RIFFchunk = SDL_ReadLE32(src); + wavelen = SDL_ReadLE32(src); + WAVEmagic = SDL_ReadLE32(src); + if ( (RIFFchunk != RIFF) || (WAVEmagic != WAVE) ) { + Mix_SetError("Unrecognized file type (not WAVE)"); + was_error = 1; + goto done; + } + + /* Read the audio data format chunk */ + chunk.data = NULL; + do { + /* FIXME! Add this logic to SDL_LoadWAV_RW() */ + if ( chunk.data ) { + SDL_free(chunk.data); + } + lenread = ReadChunk(src, &chunk, 1); + if ( lenread < 0 ) { + was_error = 1; + goto done; + } + } while ( (chunk.magic == FACT) || (chunk.magic == LIST) ); + + /* Decode the audio data format */ + format = (WaveFMT *)chunk.data; + if ( chunk.magic != FMT ) { + SDL_free(chunk.data); + Mix_SetError("Complex WAVE files not supported"); + was_error = 1; + goto done; + } + switch (SDL_SwapLE16(format->encoding)) { + case PCM_CODE: + /* We can understand this */ + break; + default: + Mix_SetError("Unknown WAVE data format"); + was_error = 1; + goto done; + } + memset(spec, 0, (sizeof *spec)); + spec->freq = SDL_SwapLE32(format->frequency); + switch (SDL_SwapLE16(format->bitspersample)) { + case 8: + spec->format = AUDIO_U8; + break; + case 16: + spec->format = AUDIO_S16; + break; + default: + Mix_SetError("Unknown PCM data format"); + was_error = 1; + goto done; + } + spec->channels = (Uint8) SDL_SwapLE16(format->channels); + spec->samples = 4096; /* Good default buffer size */ + + /* Set the file offset to the DATA chunk data */ + chunk.data = NULL; + do { + *start = SDL_RWtell(src) + 2*sizeof(Uint32); + lenread = ReadChunk(src, &chunk, 0); + if ( lenread < 0 ) { + was_error = 1; + goto done; + } + } while ( chunk.magic != DATA ); + *stop = SDL_RWtell(src); + +done: + if ( format != NULL ) { + SDL_free(format); + } + if ( was_error ) { + return NULL; + } + return(src); +} + +/* I couldn't get SANE_to_double() to work, so I stole this from libsndfile. + * I don't pretend to fully understand it. + */ + +static Uint32 SANE_to_Uint32 (Uint8 *sanebuf) +{ + /* Negative number? */ + if (sanebuf[0] & 0x80) + return 0; + + /* Less than 1? */ + if (sanebuf[0] <= 0x3F) + return 1; + + /* Way too big? */ + if (sanebuf[0] > 0x40) + return 0x4000000; + + /* Still too big? */ + if (sanebuf[0] == 0x40 && sanebuf[1] > 0x1C) + return 800000000; + + return ((sanebuf[2] << 23) | (sanebuf[3] << 15) | (sanebuf[4] << 7) + | (sanebuf[5] >> 1)) >> (29 - sanebuf[1]); +} + +static SDL_RWops *LoadAIFFStream (SDL_RWops *src, SDL_AudioSpec *spec, + long *start, long *stop) +{ + int was_error; + int found_SSND; + int found_COMM; + + Uint32 chunk_type; + Uint32 chunk_length; + long next_chunk; + + /* AIFF magic header */ + Uint32 FORMchunk; + Uint32 AIFFmagic; + /* SSND chunk */ + Uint32 offset; + Uint32 blocksize; + /* COMM format chunk */ + Uint16 channels = 0; + Uint32 numsamples = 0; + Uint16 samplesize = 0; + Uint8 sane_freq[10]; + Uint32 frequency = 0; + + was_error = 0; + + /* Check the magic header */ + FORMchunk = SDL_ReadLE32(src); + chunk_length = SDL_ReadBE32(src); + AIFFmagic = SDL_ReadLE32(src); + if ( (FORMchunk != FORM) || (AIFFmagic != AIFF) ) { + Mix_SetError("Unrecognized file type (not AIFF)"); + was_error = 1; + goto done; + } + + /* From what I understand of the specification, chunks may appear in + * any order, and we should just ignore unknown ones. + * + * TODO: Better sanity-checking. E.g. what happens if the AIFF file + * contains compressed sound data? + */ + + found_SSND = 0; + found_COMM = 0; + + do { + chunk_type = SDL_ReadLE32(src); + chunk_length = SDL_ReadBE32(src); + next_chunk = SDL_RWtell(src) + chunk_length; + + /* Paranoia to avoid infinite loops */ + if (chunk_length == 0) + break; + + switch (chunk_type) { + case SSND: + found_SSND = 1; + offset = SDL_ReadBE32(src); + blocksize = SDL_ReadBE32(src); + *start = SDL_RWtell(src) + offset; + break; + + case COMM: + found_COMM = 1; + + /* Read the audio data format chunk */ + channels = SDL_ReadBE16(src); + numsamples = SDL_ReadBE32(src); + samplesize = SDL_ReadBE16(src); + SDL_RWread(src, sane_freq, sizeof(sane_freq), 1); + frequency = SANE_to_Uint32(sane_freq); + break; + + default: + break; + } + } while ((!found_SSND || !found_COMM) + && SDL_RWseek(src, next_chunk, RW_SEEK_SET) != -1); + + if (!found_SSND) { + Mix_SetError("Bad AIFF file (no SSND chunk)"); + was_error = 1; + goto done; + } + + if (!found_COMM) { + Mix_SetError("Bad AIFF file (no COMM chunk)"); + was_error = 1; + goto done; + } + + *stop = *start + channels * numsamples * (samplesize / 8); + + /* Decode the audio data format */ + memset(spec, 0, (sizeof *spec)); + spec->freq = frequency; + switch (samplesize) { + case 8: + spec->format = AUDIO_S8; + break; + case 16: + spec->format = AUDIO_S16MSB; + break; + default: + Mix_SetError("Unknown samplesize in data format"); + was_error = 1; + goto done; + } + spec->channels = (Uint8) channels; + spec->samples = 4096; /* Good default buffer size */ + +done: + if ( was_error ) { + return NULL; + } + return(src); +} + diff --git a/apps/plugins/sdl/SDL_mixer/wavestream.h b/apps/plugins/sdl/SDL_mixer/wavestream.h new file mode 100644 index 0000000..9d119dc --- /dev/null +++ b/apps/plugins/sdl/SDL_mixer/wavestream.h @@ -0,0 +1,60 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +/* This file supports streaming WAV files, without volume adjustment */ + +#include + +typedef struct { + SDL_RWops *rw; + SDL_bool freerw; + long start; + long stop; + SDL_AudioCVT cvt; +} WAVStream; + +/* Initialize the WAVStream player, with the given mixer settings + This function returns 0, or -1 if there was an error. + */ +extern int WAVStream_Init(SDL_AudioSpec *mixer); + +/* Unimplemented */ +extern void WAVStream_SetVolume(int volume); + +/* Load a WAV stream from an SDL_RWops object */ +extern WAVStream *WAVStream_LoadSong_RW(SDL_RWops *rw, const char *magic, int freerw); + +/* Start playback of a given WAV stream */ +extern void WAVStream_Start(WAVStream *wave); + +/* Play some of a stream previously started with WAVStream_Start() */ +extern int WAVStream_PlaySome(Uint8 *stream, int len); + +/* Stop playback of a stream previously started with WAVStream_Start() */ +extern void WAVStream_Stop(void); + +/* Close the given WAV stream */ +extern void WAVStream_FreeSong(WAVStream *wave); + +/* Return non-zero if a stream is currently playing */ +extern int WAVStream_Active(void); diff --git a/apps/plugins/sdl/SOURCES b/apps/plugins/sdl/SOURCES new file mode 100644 index 0000000..85b193b --- /dev/null +++ b/apps/plugins/sdl/SOURCES @@ -0,0 +1,129 @@ +main.c + +wrappers.c + +/* SDL lib */ +src/SDL.c +src/SDL_error.c +src/SDL_fatal.c +src/audio/SDL_audio.c +src/audio/SDL_audiocvt.c +src/audio/SDL_audiodev.c +src/audio/SDL_mixer.c +src/audio/SDL_mixer_MMX.c +src/audio/SDL_mixer_MMX_VC.c +src/audio/SDL_mixer_m68k.c +src/audio/SDL_wave.c +src/audio/rockbox/SDL_rockboxaudio.c +src/cdrom/SDL_cdrom.c +src/cdrom/dummy/SDL_syscdrom.c +src/cpuinfo/SDL_cpuinfo.c +src/events/SDL_active.c +src/events/SDL_events.c +src/events/SDL_expose.c +src/events/SDL_keyboard.c +src/events/SDL_mouse.c +src/events/SDL_quit.c +src/events/SDL_resize.c +src/file/SDL_rwops.c +src/joystick/SDL_joystick.c +src/joystick/dummy/SDL_sysjoystick.c +src/loadso/dummy/SDL_sysloadso.c +src/stdlib/SDL_getenv.c +src/stdlib/SDL_iconv.c +src/stdlib/SDL_malloc.c +src/stdlib/SDL_qsort.c +src/stdlib/SDL_stdlib.c +src/stdlib/SDL_string.c + + +src/thread/SDL_thread.c +#if 1 +src/thread/rockbox/SDL_syscond.c +src/thread/rockbox/SDL_sysmutex.c +src/thread/rockbox/SDL_syssem.c +src/thread/rockbox/SDL_systhread.c +#else +src/thread/generic/SDL_syscond.c +src/thread/generic/SDL_sysmutex.c +src/thread/generic/SDL_syssem.c +src/thread/generic/SDL_systhread.c +#endif + +src/timer/SDL_timer.c +src/timer/rockbox/SDL_systimer.c +src/video/SDL_RLEaccel.c +src/video/SDL_blit.c +src/video/SDL_blit_0.c +src/video/SDL_blit_1.c +src/video/SDL_blit_A.c +src/video/SDL_blit_N.c +src/video/SDL_bmp.c +src/video/SDL_cursor.c +src/video/SDL_gamma.c +src/video/SDL_pixels.c +src/video/SDL_stretch.c +src/video/SDL_surface.c +src/video/SDL_video.c +src/video/SDL_yuv.c +src/video/SDL_yuv_mmx.c +src/video/SDL_yuv_sw.c +src/video/dummy/SDL_nullevents.c +src/video/dummy/SDL_nullmouse.c +src/video/dummy/SDL_nullvideo.c +src/video/rockbox/SDL_rockboxvideo.c + +/* IMG lib */ +SDL_image/IMG_bmp.c +SDL_image/IMG.c +SDL_image/IMG_gif.c +SDL_image/IMG_jpg.c +SDL_image/IMG_lbm.c +SDL_image/IMG_pcx.c +SDL_image/IMG_png.c +SDL_image/IMG_pnm.c +SDL_image/IMG_tga.c +SDL_image/IMG_tif.c +SDL_image/IMG_webp.c +SDL_image/IMG_xcf.c +SDL_image/IMG_xpm.c +SDL_image/IMG_xv.c +SDL_image/IMG_xxx.c + +/* Mix */ +SDL_mixer/dynamic_flac.c +SDL_mixer/dynamic_fluidsynth.c +SDL_mixer/dynamic_mod.c +SDL_mixer/dynamic_mp3.c +SDL_mixer/dynamic_ogg.c +SDL_mixer/effect_position.c +SDL_mixer/effects_internal.c +SDL_mixer/effect_stereoreverse.c +SDL_mixer/fluidsynth.c +SDL_mixer/load_aiff.c +SDL_mixer/load_flac.c +SDL_mixer/load_ogg.c +SDL_mixer/load_voc.c +SDL_mixer/mixer.c +SDL_mixer/music.c +SDL_mixer/music_cmd.c +SDL_mixer/music_flac.c +SDL_mixer/music_mad.c +SDL_mixer/music_mod.c +SDL_mixer/music_modplug.c +SDL_mixer/music_ogg.c +SDL_mixer/wavestream.c + +SDL_mixer/timidity/common.c +SDL_mixer/timidity/ctrlmode.c +SDL_mixer/timidity/filter.c +SDL_mixer/timidity/instrum.c +SDL_mixer/timidity/mix.c +SDL_mixer/timidity/output.c +SDL_mixer/timidity/playmidi.c +SDL_mixer/timidity/readmidi.c +SDL_mixer/timidity/resample.c +SDL_mixer/timidity/sdl_a.c +SDL_mixer/timidity/sdl_c.c +SDL_mixer/timidity/tables.c +SDL_mixer/timidity/timidity.c diff --git a/apps/plugins/sdl/SOURCES.duke b/apps/plugins/sdl/SOURCES.duke new file mode 100644 index 0000000..9a9a07f --- /dev/null +++ b/apps/plugins/sdl/SOURCES.duke @@ -0,0 +1,41 @@ +progs/duke3d/Engine/src/cache.c +progs/duke3d/Engine/src/display.c +progs/duke3d/Engine/src/draw.c +progs/duke3d/Engine/src/dummy_multi.c +progs/duke3d/Engine/src/engine.c +progs/duke3d/Engine/src/filesystem.c +progs/duke3d/Engine/src/fixedPoint_math.c +progs/duke3d/Engine/src/icon.c +progs/duke3d/Engine/src/mmulti.c +progs/duke3d/Engine/src/network.c +progs/duke3d/Engine/src/tiles.c +progs/duke3d/Game/src/audiolib/fx_man.c +progs/duke3d/Game/src/audiolib/dsl.c +progs/duke3d/Game/src/audiolib/ll_man.c +progs/duke3d/Game/src/audiolib/multivoc.c +progs/duke3d/Game/src/audiolib/mv_mix.c +progs/duke3d/Game/src/audiolib/mvreverb.c +progs/duke3d/Game/src/audiolib/nodpmi.c +progs/duke3d/Game/src/audiolib/pitch.c +progs/duke3d/Game/src/audiolib/user.c +progs/duke3d/Game/src/audiolib/usrhooks.c +progs/duke3d/Game/src/actors.c +progs/duke3d/Game/src/animlib.c +progs/duke3d/Game/src/config.c +progs/duke3d/Game/src/console.c +progs/duke3d/Game/src/control.c +progs/duke3d/Game/src/cvar_defs.c +progs/duke3d/Game/src/cvars.c +progs/duke3d/Game/src/dummy_audiolib.c +progs/duke3d/Game/src/game.c +progs/duke3d/Game/src/gamedef.c +progs/duke3d/Game/src/global.c +progs/duke3d/Game/src/keyboard.c +progs/duke3d/Game/src/menues.c +progs/duke3d/Game/src/midi/sdl_midi.c +progs/duke3d/Game/src/player.c +progs/duke3d/Game/src/premap.c +progs/duke3d/Game/src/rts.c +progs/duke3d/Game/src/scriplib.c +progs/duke3d/Game/src/sector.c +progs/duke3d/Game/src/sounds.c diff --git a/apps/plugins/sdl/include/SDL.h b/apps/plugins/sdl/include/SDL.h new file mode 100644 index 0000000..6087b7c --- /dev/null +++ b/apps/plugins/sdl/include/SDL.h @@ -0,0 +1,101 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL.h + * Main include header for the SDL library + */ + +#ifndef _SDL_H +#define _SDL_H + +#include "SDL_main.h" +#include "SDL_stdinc.h" +#include "SDL_audio.h" +#include "SDL_cdrom.h" +#include "SDL_cpuinfo.h" +#include "SDL_endian.h" +#include "SDL_error.h" +#include "SDL_events.h" +#include "SDL_loadso.h" +#include "SDL_mutex.h" +#include "SDL_rwops.h" +#include "SDL_thread.h" +#include "SDL_timer.h" +#include "SDL_video.h" +#include "SDL_version.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @file SDL.h + * @note As of version 0.5, SDL is loaded dynamically into the application + */ + +/** @name SDL_INIT Flags + * These are the flags which may be passed to SDL_Init() -- you should + * specify the subsystems which you will be using in your application. + */ +/*@{*/ +#define SDL_INIT_TIMER 0x00000001 +#define SDL_INIT_AUDIO 0x00000010 +#define SDL_INIT_VIDEO 0x00000020 +#define SDL_INIT_CDROM 0x00000100 +#define SDL_INIT_JOYSTICK 0x00000200 +#define SDL_INIT_NOPARACHUTE 0x00100000 /**< Don't catch fatal signals */ +#define SDL_INIT_EVENTTHREAD 0x01000000 /**< Not supported on all OS's */ +#define SDL_INIT_EVERYTHING 0x0000FFFF +/*@}*/ + +/** This function loads the SDL dynamically linked library and initializes + * the subsystems specified by 'flags' (and those satisfying dependencies) + * Unless the SDL_INIT_NOPARACHUTE flag is set, it will install cleanup + * signal handlers for some commonly ignored fatal signals (like SIGSEGV) + */ +extern DECLSPEC int SDLCALL SDL_Init(Uint32 flags); + +/** This function initializes specific SDL subsystems */ +extern DECLSPEC int SDLCALL SDL_InitSubSystem(Uint32 flags); + +/** This function cleans up specific SDL subsystems */ +extern DECLSPEC void SDLCALL SDL_QuitSubSystem(Uint32 flags); + +/** This function returns mask of the specified subsystems which have + * been initialized. + * If 'flags' is 0, it returns a mask of all initialized subsystems. + */ +extern DECLSPEC Uint32 SDLCALL SDL_WasInit(Uint32 flags); + +/** This function cleans up all initialized subsystems and unloads the + * dynamically linked library. You should call it upon all exit conditions. + */ +extern DECLSPEC void SDLCALL SDL_Quit(void); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_H */ diff --git a/apps/plugins/sdl/include/SDL_active.h b/apps/plugins/sdl/include/SDL_active.h new file mode 100644 index 0000000..cd854e8 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_active.h @@ -0,0 +1,63 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_active.h + * Include file for SDL application focus event handling + */ + +#ifndef _SDL_active_h +#define _SDL_active_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @name The available application states */ +/*@{*/ +#define SDL_APPMOUSEFOCUS 0x01 /**< The app has mouse coverage */ +#define SDL_APPINPUTFOCUS 0x02 /**< The app has input focus */ +#define SDL_APPACTIVE 0x04 /**< The application is active */ +/*@}*/ + +/* Function prototypes */ +/** + * This function returns the current state of the application, which is a + * bitwise combination of SDL_APPMOUSEFOCUS, SDL_APPINPUTFOCUS, and + * SDL_APPACTIVE. If SDL_APPACTIVE is set, then the user is able to + * see your application, otherwise it has been iconified or disabled. + */ +extern DECLSPEC Uint8 SDLCALL SDL_GetAppState(void); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_active_h */ diff --git a/apps/plugins/sdl/include/SDL_audio.h b/apps/plugins/sdl/include/SDL_audio.h new file mode 100644 index 0000000..e879c98 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_audio.h @@ -0,0 +1,284 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_audio.h + * Access to the raw audio mixing buffer for the SDL library + */ + +#ifndef _SDL_audio_h +#define _SDL_audio_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" +#include "SDL_endian.h" +#include "SDL_mutex.h" +#include "SDL_thread.h" +#include "SDL_rwops.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** + * When filling in the desired audio spec structure, + * - 'desired->freq' should be the desired audio frequency in samples-per-second. + * - 'desired->format' should be the desired audio format. + * - 'desired->samples' is the desired size of the audio buffer, in samples. + * This number should be a power of two, and may be adjusted by the audio + * driver to a value more suitable for the hardware. Good values seem to + * range between 512 and 8096 inclusive, depending on the application and + * CPU speed. Smaller values yield faster response time, but can lead + * to underflow if the application is doing heavy processing and cannot + * fill the audio buffer in time. A stereo sample consists of both right + * and left channels in LR ordering. + * Note that the number of samples is directly related to time by the + * following formula: ms = (samples*1000)/freq + * - 'desired->size' is the size in bytes of the audio buffer, and is + * calculated by SDL_OpenAudio(). + * - 'desired->silence' is the value used to set the buffer to silence, + * and is calculated by SDL_OpenAudio(). + * - 'desired->callback' should be set to a function that will be called + * when the audio device is ready for more data. It is passed a pointer + * to the audio buffer, and the length in bytes of the audio buffer. + * This function usually runs in a separate thread, and so you should + * protect data structures that it accesses by calling SDL_LockAudio() + * and SDL_UnlockAudio() in your code. + * - 'desired->userdata' is passed as the first parameter to your callback + * function. + * + * @note The calculated values in this structure are calculated by SDL_OpenAudio() + * + */ +typedef struct SDL_AudioSpec { + int freq; /**< DSP frequency -- samples per second */ + Uint16 format; /**< Audio data format */ + Uint8 channels; /**< Number of channels: 1 mono, 2 stereo */ + Uint8 silence; /**< Audio buffer silence value (calculated) */ + Uint16 samples; /**< Audio buffer size in samples (power of 2) */ + Uint16 padding; /**< Necessary for some compile environments */ + Uint32 size; /**< Audio buffer size in bytes (calculated) */ + /** + * This function is called when the audio device needs more data. + * + * @param[out] stream A pointer to the audio data buffer + * @param[in] len The length of the audio buffer in bytes. + * + * Once the callback returns, the buffer will no longer be valid. + * Stereo samples are stored in a LRLRLR ordering. + */ + void (SDLCALL *callback)(void *userdata, Uint8 *stream, int len); + void *userdata; +} SDL_AudioSpec; + +/** + * @name Audio format flags + * defaults to LSB byte order + */ +/*@{*/ +#define AUDIO_U8 0x0008 /**< Unsigned 8-bit samples */ +#define AUDIO_S8 0x8008 /**< Signed 8-bit samples */ +#define AUDIO_U16LSB 0x0010 /**< Unsigned 16-bit samples */ +#define AUDIO_S16LSB 0x8010 /**< Signed 16-bit samples */ +#define AUDIO_U16MSB 0x1010 /**< As above, but big-endian byte order */ +#define AUDIO_S16MSB 0x9010 /**< As above, but big-endian byte order */ +#define AUDIO_U16 AUDIO_U16LSB +#define AUDIO_S16 AUDIO_S16LSB + +/** + * @name Native audio byte ordering + */ +/*@{*/ +#if SDL_BYTEORDER == SDL_LIL_ENDIAN +#define AUDIO_U16SYS AUDIO_U16LSB +#define AUDIO_S16SYS AUDIO_S16LSB +#else +#define AUDIO_U16SYS AUDIO_U16MSB +#define AUDIO_S16SYS AUDIO_S16MSB +#endif +/*@}*/ + +/*@}*/ + + +/** A structure to hold a set of audio conversion filters and buffers */ +typedef struct SDL_AudioCVT { + int needed; /**< Set to 1 if conversion possible */ + Uint16 src_format; /**< Source audio format */ + Uint16 dst_format; /**< Target audio format */ + double rate_incr; /**< Rate conversion increment */ + Uint8 *buf; /**< Buffer to hold entire audio data */ + int len; /**< Length of original audio buffer */ + int len_cvt; /**< Length of converted audio buffer */ + int len_mult; /**< buffer must be len*len_mult big */ + double len_ratio; /**< Given len, final size is len*len_ratio */ + void (SDLCALL *filters[10])(struct SDL_AudioCVT *cvt, Uint16 format); + int filter_index; /**< Current audio conversion function */ +} SDL_AudioCVT; + + +/* Function prototypes */ + +/** + * @name Audio Init and Quit + * These functions are used internally, and should not be used unless you + * have a specific need to specify the audio driver you want to use. + * You should normally use SDL_Init() or SDL_InitSubSystem(). + */ +/*@{*/ +extern DECLSPEC int SDLCALL SDL_AudioInit(const char *driver_name); +extern DECLSPEC void SDLCALL SDL_AudioQuit(void); +/*@}*/ + +/** + * This function fills the given character buffer with the name of the + * current audio driver, and returns a pointer to it if the audio driver has + * been initialized. It returns NULL if no driver has been initialized. + */ +extern DECLSPEC char * SDLCALL SDL_AudioDriverName(char *namebuf, int maxlen); + +/** + * This function opens the audio device with the desired parameters, and + * returns 0 if successful, placing the actual hardware parameters in the + * structure pointed to by 'obtained'. If 'obtained' is NULL, the audio + * data passed to the callback function will be guaranteed to be in the + * requested format, and will be automatically converted to the hardware + * audio format if necessary. This function returns -1 if it failed + * to open the audio device, or couldn't set up the audio thread. + * + * The audio device starts out playing silence when it's opened, and should + * be enabled for playing by calling SDL_PauseAudio(0) when you are ready + * for your audio callback function to be called. Since the audio driver + * may modify the requested size of the audio buffer, you should allocate + * any local mixing buffers after you open the audio device. + * + * @sa SDL_AudioSpec + */ +extern DECLSPEC int SDLCALL SDL_OpenAudio(SDL_AudioSpec *desired, SDL_AudioSpec *obtained); + +typedef enum { + SDL_AUDIO_STOPPED = 0, + SDL_AUDIO_PLAYING, + SDL_AUDIO_PAUSED +} SDL_audiostatus; + +/** Get the current audio state */ +extern DECLSPEC SDL_audiostatus SDLCALL SDL_GetAudioStatus(void); + +/** + * This function pauses and unpauses the audio callback processing. + * It should be called with a parameter of 0 after opening the audio + * device to start playing sound. This is so you can safely initialize + * data for your callback function after opening the audio device. + * Silence will be written to the audio device during the pause. + */ +extern DECLSPEC void SDLCALL SDL_PauseAudio(int pause_on); + +/** + * This function loads a WAVE from the data source, automatically freeing + * that source if 'freesrc' is non-zero. For example, to load a WAVE file, + * you could do: + * @code SDL_LoadWAV_RW(SDL_RWFromFile("sample.wav", "rb"), 1, ...); @endcode + * + * If this function succeeds, it returns the given SDL_AudioSpec, + * filled with the audio data format of the wave data, and sets + * 'audio_buf' to a malloc()'d buffer containing the audio data, + * and sets 'audio_len' to the length of that audio buffer, in bytes. + * You need to free the audio buffer with SDL_FreeWAV() when you are + * done with it. + * + * This function returns NULL and sets the SDL error message if the + * wave file cannot be opened, uses an unknown data format, or is + * corrupt. Currently raw and MS-ADPCM WAVE files are supported. + */ +extern DECLSPEC SDL_AudioSpec * SDLCALL SDL_LoadWAV_RW(SDL_RWops *src, int freesrc, SDL_AudioSpec *spec, Uint8 **audio_buf, Uint32 *audio_len); + +/** Compatibility convenience function -- loads a WAV from a file */ +#define SDL_LoadWAV(file, spec, audio_buf, audio_len) \ + SDL_LoadWAV_RW(SDL_RWFromFile(file, "rb"),1, spec,audio_buf,audio_len) + +/** + * This function frees data previously allocated with SDL_LoadWAV_RW() + */ +extern DECLSPEC void SDLCALL SDL_FreeWAV(Uint8 *audio_buf); + +/** + * This function takes a source format and rate and a destination format + * and rate, and initializes the 'cvt' structure with information needed + * by SDL_ConvertAudio() to convert a buffer of audio data from one format + * to the other. + * + * @return This function returns 0, or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_BuildAudioCVT(SDL_AudioCVT *cvt, + Uint16 src_format, Uint8 src_channels, int src_rate, + Uint16 dst_format, Uint8 dst_channels, int dst_rate); + +/** + * Once you have initialized the 'cvt' structure using SDL_BuildAudioCVT(), + * created an audio buffer cvt->buf, and filled it with cvt->len bytes of + * audio data in the source format, this function will convert it in-place + * to the desired format. + * The data conversion may expand the size of the audio data, so the buffer + * cvt->buf should be allocated after the cvt structure is initialized by + * SDL_BuildAudioCVT(), and should be cvt->len*cvt->len_mult bytes long. + */ +extern DECLSPEC int SDLCALL SDL_ConvertAudio(SDL_AudioCVT *cvt); + + +#define SDL_MIX_MAXVOLUME 128 +/** + * This takes two audio buffers of the playing audio format and mixes + * them, performing addition, volume adjustment, and overflow clipping. + * The volume ranges from 0 - 128, and should be set to SDL_MIX_MAXVOLUME + * for full audio volume. Note this does not change hardware volume. + * This is provided for convenience -- you can mix your own audio data. + */ +extern DECLSPEC void SDLCALL SDL_MixAudio(Uint8 *dst, const Uint8 *src, Uint32 len, int volume); + +/** + * @name Audio Locks + * The lock manipulated by these functions protects the callback function. + * During a LockAudio/UnlockAudio pair, you can be guaranteed that the + * callback function is not running. Do not call these from the callback + * function or you will cause deadlock. + */ +/*@{*/ +extern DECLSPEC void SDLCALL SDL_LockAudio(void); +extern DECLSPEC void SDLCALL SDL_UnlockAudio(void); +/*@}*/ + +/** + * This function shuts down audio processing and closes the audio device. + */ +extern DECLSPEC void SDLCALL SDL_CloseAudio(void); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_audio_h */ diff --git a/apps/plugins/sdl/include/SDL_byteorder.h b/apps/plugins/sdl/include/SDL_byteorder.h new file mode 100644 index 0000000..47332c3 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_byteorder.h @@ -0,0 +1,29 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_byteorder.h + * @deprecated Use SDL_endian.h instead + */ + +/* DEPRECATED */ +#include "SDL_endian.h" diff --git a/apps/plugins/sdl/include/SDL_cdrom.h b/apps/plugins/sdl/include/SDL_cdrom.h new file mode 100644 index 0000000..febb19d --- /dev/null +++ b/apps/plugins/sdl/include/SDL_cdrom.h @@ -0,0 +1,202 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_cdrom.h + * This is the CD-audio control API for Simple DirectMedia Layer + */ + +#ifndef _SDL_cdrom_h +#define _SDL_cdrom_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** + * @file SDL_cdrom.h + * In order to use these functions, SDL_Init() must have been called + * with the SDL_INIT_CDROM flag. This causes SDL to scan the system + * for CD-ROM drives, and load appropriate drivers. + */ + +/** The maximum number of CD-ROM tracks on a disk */ +#define SDL_MAX_TRACKS 99 + +/** @name Track Types + * The types of CD-ROM track possible + */ +/*@{*/ +#define SDL_AUDIO_TRACK 0x00 +#define SDL_DATA_TRACK 0x04 +/*@}*/ + +/** The possible states which a CD-ROM drive can be in. */ +typedef enum { + CD_TRAYEMPTY, + CD_STOPPED, + CD_PLAYING, + CD_PAUSED, + CD_ERROR = -1 +} CDstatus; + +/** Given a status, returns true if there's a disk in the drive */ +#define CD_INDRIVE(status) ((int)(status) > 0) + +typedef struct SDL_CDtrack { + Uint8 id; /**< Track number */ + Uint8 type; /**< Data or audio track */ + Uint16 unused; + Uint32 length; /**< Length, in frames, of this track */ + Uint32 offset; /**< Offset, in frames, from start of disk */ +} SDL_CDtrack; + +/** This structure is only current as of the last call to SDL_CDStatus() */ +typedef struct SDL_CD { + int id; /**< Private drive identifier */ + CDstatus status; /**< Current drive status */ + + /** The rest of this structure is only valid if there's a CD in drive */ + /*@{*/ + int numtracks; /**< Number of tracks on disk */ + int cur_track; /**< Current track position */ + int cur_frame; /**< Current frame offset within current track */ + SDL_CDtrack track[SDL_MAX_TRACKS+1]; + /*@}*/ +} SDL_CD; + +/** @name Frames / MSF Conversion Functions + * Conversion functions from frames to Minute/Second/Frames and vice versa + */ +/*@{*/ +#define CD_FPS 75 +#define FRAMES_TO_MSF(f, M,S,F) { \ + int value = f; \ + *(F) = value%CD_FPS; \ + value /= CD_FPS; \ + *(S) = value%60; \ + value /= 60; \ + *(M) = value; \ +} +#define MSF_TO_FRAMES(M, S, F) ((M)*60*CD_FPS+(S)*CD_FPS+(F)) +/*@}*/ + +/* CD-audio API functions: */ + +/** + * Returns the number of CD-ROM drives on the system, or -1 if + * SDL_Init() has not been called with the SDL_INIT_CDROM flag. + */ +extern DECLSPEC int SDLCALL SDL_CDNumDrives(void); + +/** + * Returns a human-readable, system-dependent identifier for the CD-ROM. + * Example: + * - "/dev/cdrom" + * - "E:" + * - "/dev/disk/ide/1/master" + */ +extern DECLSPEC const char * SDLCALL SDL_CDName(int drive); + +/** + * Opens a CD-ROM drive for access. It returns a drive handle on success, + * or NULL if the drive was invalid or busy. This newly opened CD-ROM + * becomes the default CD used when other CD functions are passed a NULL + * CD-ROM handle. + * Drives are numbered starting with 0. Drive 0 is the system default CD-ROM. + */ +extern DECLSPEC SDL_CD * SDLCALL SDL_CDOpen(int drive); + +/** + * This function returns the current status of the given drive. + * If the drive has a CD in it, the table of contents of the CD and current + * play position of the CD will be stored in the SDL_CD structure. + */ +extern DECLSPEC CDstatus SDLCALL SDL_CDStatus(SDL_CD *cdrom); + +/** + * Play the given CD starting at 'start_track' and 'start_frame' for 'ntracks' + * tracks and 'nframes' frames. If both 'ntrack' and 'nframe' are 0, play + * until the end of the CD. This function will skip data tracks. + * This function should only be called after calling SDL_CDStatus() to + * get track information about the CD. + * For example: + * @code + * // Play entire CD: + * if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) + * SDL_CDPlayTracks(cdrom, 0, 0, 0, 0); + * // Play last track: + * if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) { + * SDL_CDPlayTracks(cdrom, cdrom->numtracks-1, 0, 0, 0); + * } + * // Play first and second track and 10 seconds of third track: + * if ( CD_INDRIVE(SDL_CDStatus(cdrom)) ) + * SDL_CDPlayTracks(cdrom, 0, 0, 2, 10); + * @endcode + * + * @return This function returns 0, or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_CDPlayTracks(SDL_CD *cdrom, + int start_track, int start_frame, int ntracks, int nframes); + +/** + * Play the given CD starting at 'start' frame for 'length' frames. + * @return It returns 0, or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_CDPlay(SDL_CD *cdrom, int start, int length); + +/** Pause play + * @return returns 0, or -1 on error + */ +extern DECLSPEC int SDLCALL SDL_CDPause(SDL_CD *cdrom); + +/** Resume play + * @return returns 0, or -1 on error + */ +extern DECLSPEC int SDLCALL SDL_CDResume(SDL_CD *cdrom); + +/** Stop play + * @return returns 0, or -1 on error + */ +extern DECLSPEC int SDLCALL SDL_CDStop(SDL_CD *cdrom); + +/** Eject CD-ROM + * @return returns 0, or -1 on error + */ +extern DECLSPEC int SDLCALL SDL_CDEject(SDL_CD *cdrom); + +/** Closes the handle for the CD-ROM drive */ +extern DECLSPEC void SDLCALL SDL_CDClose(SDL_CD *cdrom); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_video_h */ diff --git a/apps/plugins/sdl/include/SDL_config.h b/apps/plugins/sdl/include/SDL_config.h new file mode 100644 index 0000000..af06f49 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config.h @@ -0,0 +1,47 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_h +#define _SDL_config_h + +#include "SDL_platform.h" + +/* Add any platform that doesn't build using the configure system */ +#if defined(__DREAMCAST__) +#include "SDL_config_dreamcast.h" +#elif defined(__MACOS__) +#include "SDL_config_macos.h" +#elif defined(__MACOSX__) +#include "SDL_config_macosx.h" +#elif defined(__SYMBIAN32__) +#include "SDL_config_symbian.h" /* must be before win32! */ +#elif defined(__WIN32__) +#include "SDL_config_win32.h" +#elif defined(__OS2__) +#include "SDL_config_os2.h" +#elif defined(__ROCKBOX__) +#include "SDL_config_rockbox.h" +#else +#include "SDL_config_minimal.h" +#endif /* platform config */ + +#endif /* _SDL_config_h */ diff --git a/apps/plugins/sdl/include/SDL_config.h.default b/apps/plugins/sdl/include/SDL_config.h.default new file mode 100644 index 0000000..09ba38a --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config.h.default @@ -0,0 +1,45 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_h +#define _SDL_config_h + +#include "SDL_platform.h" + +/* Add any platform that doesn't build using the configure system */ +#if defined(__DREAMCAST__) +#include "SDL_config_dreamcast.h" +#elif defined(__MACOS__) +#include "SDL_config_macos.h" +#elif defined(__MACOSX__) +#include "SDL_config_macosx.h" +#elif defined(__SYMBIAN32__) +#include "SDL_config_symbian.h" /* must be before win32! */ +#elif defined(__WIN32__) +#include "SDL_config_win32.h" +#elif defined(__OS2__) +#include "SDL_config_os2.h" +#else +#include "SDL_config_minimal.h" +#endif /* platform config */ + +#endif /* _SDL_config_h */ diff --git a/apps/plugins/sdl/include/SDL_config.h.in b/apps/plugins/sdl/include/SDL_config.h.in new file mode 100644 index 0000000..8bb1773 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config.h.in @@ -0,0 +1,312 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_h +#define _SDL_config_h + +/* This is a set of defines to configure the SDL features */ + +/* General platform specific identifiers */ +#include "SDL_platform.h" + +/* Make sure that this isn't included by Visual C++ */ +#ifdef _MSC_VER +#error You should copy include/SDL_config.h.default to include/SDL_config.h +#endif + +/* C language features */ +#undef const +#undef inline +#undef volatile + +/* C datatypes */ +#undef size_t +#undef int8_t +#undef uint8_t +#undef int16_t +#undef uint16_t +#undef int32_t +#undef uint32_t +#undef int64_t +#undef uint64_t +#undef uintptr_t +#undef SDL_HAS_64BIT_TYPE + +/* Endianness */ +#undef SDL_BYTEORDER + +/* Comment this if you want to build without any C library requirements */ +#undef HAVE_LIBC +#if HAVE_LIBC + +/* Useful headers */ +#undef HAVE_ALLOCA_H +#undef HAVE_SYS_TYPES_H +#undef HAVE_STDIO_H +#undef STDC_HEADERS +#undef HAVE_STDLIB_H +#undef HAVE_STDARG_H +#undef HAVE_MALLOC_H +#undef HAVE_MEMORY_H +#undef HAVE_STRING_H +#undef HAVE_STRINGS_H +#undef HAVE_INTTYPES_H +#undef HAVE_STDINT_H +#undef HAVE_CTYPE_H +#undef HAVE_MATH_H +#undef HAVE_ICONV_H +#undef HAVE_SIGNAL_H +#undef HAVE_ALTIVEC_H + +/* C library functions */ +#undef HAVE_MALLOC +#undef HAVE_CALLOC +#undef HAVE_REALLOC +#undef HAVE_FREE +#undef HAVE_ALLOCA +#ifndef _WIN32 /* Don't use C runtime versions of these on Windows */ +#undef HAVE_GETENV +#undef HAVE_PUTENV +#undef HAVE_UNSETENV +#endif +#undef HAVE_QSORT +#undef HAVE_ABS +#undef HAVE_BCOPY +#undef HAVE_MEMSET +#undef HAVE_MEMCPY +#undef HAVE_MEMMOVE +#undef HAVE_MEMCMP +#undef HAVE_STRLEN +#undef HAVE_STRLCPY +#undef HAVE_STRLCAT +#undef HAVE_STRDUP +#undef HAVE__STRREV +#undef HAVE__STRUPR +#undef HAVE__STRLWR +#undef HAVE_INDEX +#undef HAVE_RINDEX +#undef HAVE_STRCHR +#undef HAVE_STRRCHR +#undef HAVE_STRSTR +#undef HAVE_ITOA +#undef HAVE__LTOA +#undef HAVE__UITOA +#undef HAVE__ULTOA +#undef HAVE_STRTOL +#undef HAVE_STRTOUL +#undef HAVE__I64TOA +#undef HAVE__UI64TOA +#undef HAVE_STRTOLL +#undef HAVE_STRTOULL +#undef HAVE_STRTOD +#undef HAVE_ATOI +#undef HAVE_ATOF +#undef HAVE_STRCMP +#undef HAVE_STRNCMP +#undef HAVE__STRICMP +#undef HAVE_STRCASECMP +#undef HAVE__STRNICMP +#undef HAVE_STRNCASECMP +#undef HAVE_SSCANF +#undef HAVE_SNPRINTF +#undef HAVE_VSNPRINTF +#undef HAVE_ICONV +#undef HAVE_SIGACTION +#undef HAVE_SA_SIGACTION +#undef HAVE_SETJMP +#undef HAVE_NANOSLEEP +#undef HAVE_CLOCK_GETTIME +#undef HAVE_GETPAGESIZE +#undef HAVE_MPROTECT +#undef HAVE_SEM_TIMEDWAIT + +#else +/* We may need some replacement for stdarg.h here */ +#include +#endif /* HAVE_LIBC */ + +/* Allow disabling of core subsystems */ +#undef SDL_AUDIO_DISABLED +#undef SDL_CDROM_DISABLED +#undef SDL_CPUINFO_DISABLED +#undef SDL_EVENTS_DISABLED +#undef SDL_FILE_DISABLED +#undef SDL_JOYSTICK_DISABLED +#undef SDL_LOADSO_DISABLED +#undef SDL_THREADS_DISABLED +#undef SDL_TIMERS_DISABLED +#undef SDL_VIDEO_DISABLED + +/* Enable various audio drivers */ +#undef SDL_AUDIO_DRIVER_ALSA +#undef SDL_AUDIO_DRIVER_ALSA_DYNAMIC +#undef SDL_AUDIO_DRIVER_ARTS +#undef SDL_AUDIO_DRIVER_ARTS_DYNAMIC +#undef SDL_AUDIO_DRIVER_BAUDIO +#undef SDL_AUDIO_DRIVER_BSD +#undef SDL_AUDIO_DRIVER_COREAUDIO +#undef SDL_AUDIO_DRIVER_DART +#undef SDL_AUDIO_DRIVER_DC +#undef SDL_AUDIO_DRIVER_DISK +#undef SDL_AUDIO_DRIVER_DUMMY +#undef SDL_AUDIO_DRIVER_DMEDIA +#undef SDL_AUDIO_DRIVER_DSOUND +#undef SDL_AUDIO_DRIVER_PULSE +#undef SDL_AUDIO_DRIVER_PULSE_DYNAMIC +#undef SDL_AUDIO_DRIVER_ESD +#undef SDL_AUDIO_DRIVER_ESD_DYNAMIC +#undef SDL_AUDIO_DRIVER_MINT +#undef SDL_AUDIO_DRIVER_MMEAUDIO +#undef SDL_AUDIO_DRIVER_NAS +#undef SDL_AUDIO_DRIVER_NAS_DYNAMIC +#undef SDL_AUDIO_DRIVER_OSS +#undef SDL_AUDIO_DRIVER_OSS_SOUNDCARD_H +#undef SDL_AUDIO_DRIVER_PAUD +#undef SDL_AUDIO_DRIVER_QNXNTO +#undef SDL_AUDIO_DRIVER_SNDMGR +#undef SDL_AUDIO_DRIVER_SUNAUDIO +#undef SDL_AUDIO_DRIVER_WAVEOUT + +/* Enable various cdrom drivers */ +#undef SDL_CDROM_AIX +#undef SDL_CDROM_BEOS +#undef SDL_CDROM_BSDI +#undef SDL_CDROM_DC +#undef SDL_CDROM_DUMMY +#undef SDL_CDROM_FREEBSD +#undef SDL_CDROM_LINUX +#undef SDL_CDROM_MACOS +#undef SDL_CDROM_MACOSX +#undef SDL_CDROM_MINT +#undef SDL_CDROM_OPENBSD +#undef SDL_CDROM_OS2 +#undef SDL_CDROM_OSF +#undef SDL_CDROM_QNX +#undef SDL_CDROM_WIN32 + +/* Enable various input drivers */ +#undef SDL_INPUT_LINUXEV +#undef SDL_INPUT_TSLIB +#undef SDL_JOYSTICK_BEOS +#undef SDL_JOYSTICK_DC +#undef SDL_JOYSTICK_DUMMY +#undef SDL_JOYSTICK_IOKIT +#undef SDL_JOYSTICK_LINUX +#undef SDL_JOYSTICK_MACOS +#undef SDL_JOYSTICK_MINT +#undef SDL_JOYSTICK_OS2 +#undef SDL_JOYSTICK_RISCOS +#undef SDL_JOYSTICK_WINMM +#undef SDL_JOYSTICK_USBHID +#undef SDL_JOYSTICK_USBHID_MACHINE_JOYSTICK_H + +/* Enable various shared object loading systems */ +#undef SDL_LOADSO_BEOS +#undef SDL_LOADSO_DLCOMPAT +#undef SDL_LOADSO_DLOPEN +#undef SDL_LOADSO_DUMMY +#undef SDL_LOADSO_LDG +#undef SDL_LOADSO_MACOS +#undef SDL_LOADSO_OS2 +#undef SDL_LOADSO_WIN32 + +/* Enable various threading systems */ +#undef SDL_THREAD_BEOS +#undef SDL_THREAD_DC +#undef SDL_THREAD_OS2 +#undef SDL_THREAD_PTH +#undef SDL_THREAD_PTHREAD +#undef SDL_THREAD_PTHREAD_RECURSIVE_MUTEX +#undef SDL_THREAD_PTHREAD_RECURSIVE_MUTEX_NP +#undef SDL_THREAD_SPROC +#undef SDL_THREAD_WIN32 + +/* Enable various timer systems */ +#undef SDL_TIMER_BEOS +#undef SDL_TIMER_DC +#undef SDL_TIMER_DUMMY +#undef SDL_TIMER_MACOS +#undef SDL_TIMER_MINT +#undef SDL_TIMER_OS2 +#undef SDL_TIMER_RISCOS +#undef SDL_TIMER_UNIX +#undef SDL_TIMER_WIN32 +#undef SDL_TIMER_WINCE + +/* Enable various video drivers */ +#undef SDL_VIDEO_DRIVER_AALIB +#undef SDL_VIDEO_DRIVER_BWINDOW +#undef SDL_VIDEO_DRIVER_CACA +#undef SDL_VIDEO_DRIVER_DC +#undef SDL_VIDEO_DRIVER_DDRAW +#undef SDL_VIDEO_DRIVER_DGA +#undef SDL_VIDEO_DRIVER_DIRECTFB +#undef SDL_VIDEO_DRIVER_DRAWSPROCKET +#undef SDL_VIDEO_DRIVER_DUMMY +#undef SDL_VIDEO_DRIVER_FBCON +#undef SDL_VIDEO_DRIVER_GAPI +#undef SDL_VIDEO_DRIVER_GEM +#undef SDL_VIDEO_DRIVER_GGI +#undef SDL_VIDEO_DRIVER_IPOD +#undef SDL_VIDEO_DRIVER_NANOX +#undef SDL_VIDEO_DRIVER_OS2FS +#undef SDL_VIDEO_DRIVER_PHOTON +#undef SDL_VIDEO_DRIVER_PICOGUI +#undef SDL_VIDEO_DRIVER_PS2GS +#undef SDL_VIDEO_DRIVER_PS3 +#undef SDL_VIDEO_DRIVER_QTOPIA +#undef SDL_VIDEO_DRIVER_QUARTZ +#undef SDL_VIDEO_DRIVER_RISCOS +#undef SDL_VIDEO_DRIVER_SVGALIB +#undef SDL_VIDEO_DRIVER_TOOLBOX +#undef SDL_VIDEO_DRIVER_VGL +#undef SDL_VIDEO_DRIVER_WINDIB +#undef SDL_VIDEO_DRIVER_WSCONS +#undef SDL_VIDEO_DRIVER_X11 +#undef SDL_VIDEO_DRIVER_X11_DGAMOUSE +#undef SDL_VIDEO_DRIVER_X11_DYNAMIC +#undef SDL_VIDEO_DRIVER_X11_DYNAMIC_XEXT +#undef SDL_VIDEO_DRIVER_X11_DYNAMIC_XRANDR +#undef SDL_VIDEO_DRIVER_X11_DYNAMIC_XRENDER +#undef SDL_VIDEO_DRIVER_X11_VIDMODE +#undef SDL_VIDEO_DRIVER_X11_XINERAMA +#undef SDL_VIDEO_DRIVER_X11_XME +#undef SDL_VIDEO_DRIVER_X11_XRANDR +#undef SDL_VIDEO_DRIVER_X11_XV +#undef SDL_VIDEO_DRIVER_XBIOS + +/* Enable OpenGL support */ +#undef SDL_VIDEO_OPENGL +#undef SDL_VIDEO_OPENGL_GLX +#undef SDL_VIDEO_OPENGL_WGL +#undef SDL_VIDEO_OPENGL_OSMESA +#undef SDL_VIDEO_OPENGL_OSMESA_DYNAMIC + +/* Disable screensaver */ +#undef SDL_VIDEO_DISABLE_SCREENSAVER + +/* Enable assembly routines */ +#undef SDL_ASSEMBLY_ROUTINES +#undef SDL_HERMES_BLITTERS +#undef SDL_ALTIVEC_BLITTERS + +#endif /* _SDL_config_h */ diff --git a/apps/plugins/sdl/include/SDL_config_dreamcast.h b/apps/plugins/sdl/include/SDL_config_dreamcast.h new file mode 100644 index 0000000..fb03098 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_dreamcast.h @@ -0,0 +1,106 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_dreamcast_h +#define _SDL_config_dreamcast_h + +#include "SDL_platform.h" + +/* This is a set of defines to configure the SDL features */ + +typedef signed char int8_t; +typedef unsigned char uint8_t; +typedef signed short int16_t; +typedef unsigned short uint16_t; +typedef signed int int32_t; +typedef unsigned int uint32_t; +typedef signed long long int64_t; +typedef unsigned long long uint64_t; +typedef unsigned long uintptr_t; +#define SDL_HAS_64BIT_TYPE 1 + +/* Useful headers */ +#define HAVE_SYS_TYPES_H 1 +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STRING_H 1 +#define HAVE_CTYPE_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_GETENV 1 +#define HAVE_PUTENV 1 +#define HAVE_QSORT 1 +#define HAVE_ABS 1 +#define HAVE_BCOPY 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE_STRDUP 1 +#define HAVE_INDEX 1 +#define HAVE_RINDEX 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_STRTOL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE_STRICMP 1 +#define HAVE_STRCASECMP 1 +#define HAVE_SSCANF 1 +#define HAVE_SNPRINTF 1 +#define HAVE_VSNPRINTF 1 + +/* Enable various audio drivers */ +#define SDL_AUDIO_DRIVER_DC 1 +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various cdrom drivers */ +#define SDL_CDROM_DC 1 + +/* Enable various input drivers */ +#define SDL_JOYSTICK_DC 1 + +/* Enable various shared object loading systems */ +#define SDL_LOADSO_DUMMY 1 + +/* Enable various threading systems */ +#define SDL_THREAD_DC 1 + +/* Enable various timer systems */ +#define SDL_TIMER_DC 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_DC 1 +#define SDL_VIDEO_DRIVER_DUMMY 1 + +#endif /* _SDL_config_dreamcast_h */ diff --git a/apps/plugins/sdl/include/SDL_config_macos.h b/apps/plugins/sdl/include/SDL_config_macos.h new file mode 100644 index 0000000..4fe1715 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_macos.h @@ -0,0 +1,112 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_macos_h +#define _SDL_config_macos_h + +#include "SDL_platform.h" + +/* This is a set of defines to configure the SDL features */ + +#include + +typedef SInt8 int8_t; +typedef UInt8 uint8_t; +typedef SInt16 int16_t; +typedef UInt16 uint16_t; +typedef SInt32 int32_t; +typedef UInt32 uint32_t; +typedef SInt64 int64_t; +typedef UInt64 uint64_t; +typedef unsigned long uintptr_t; + +#define SDL_HAS_64BIT_TYPE 1 + +/* Useful headers */ +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STRING_H 1 +#define HAVE_CTYPE_H 1 +#define HAVE_MATH_H 1 +#define HAVE_SIGNAL_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_ABS 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_ITOA 1 +#define HAVE_STRTOL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE_SSCANF 1 + +/* Enable various audio drivers */ +#define SDL_AUDIO_DRIVER_SNDMGR 1 +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various cdrom drivers */ +#if TARGET_API_MAC_CARBON +#define SDL_CDROM_DUMMY 1 +#else +#define SDL_CDROM_MACOS 1 +#endif + +/* Enable various input drivers */ +#if TARGET_API_MAC_CARBON +#define SDL_JOYSTICK_DUMMY 1 +#else +#define SDL_JOYSTICK_MACOS 1 +#endif + +/* Enable various shared object loading systems */ +#define SDL_LOADSO_MACOS 1 + +/* Enable various threading systems */ +#define SDL_THREADS_DISABLED 1 + +/* Enable various timer systems */ +#define SDL_TIMER_MACOS 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_DUMMY 1 +#define SDL_VIDEO_DRIVER_DRAWSPROCKET 1 +#define SDL_VIDEO_DRIVER_TOOLBOX 1 + +/* Enable OpenGL support */ +#define SDL_VIDEO_OPENGL 1 + +#endif /* _SDL_config_macos_h */ diff --git a/apps/plugins/sdl/include/SDL_config_macosx.h b/apps/plugins/sdl/include/SDL_config_macosx.h new file mode 100644 index 0000000..84be617 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_macosx.h @@ -0,0 +1,150 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_macosx_h +#define _SDL_config_macosx_h + +#include "SDL_platform.h" + +/* This gets us MAC_OS_X_VERSION_MIN_REQUIRED... */ +#include + +/* This is a set of defines to configure the SDL features */ + +#define SDL_HAS_64BIT_TYPE 1 + +/* Useful headers */ +/* If we specified an SDK or have a post-PowerPC chip, then alloca.h exists. */ +#if ( (MAC_OS_X_VERSION_MIN_REQUIRED >= 1030) || (!defined(__POWERPC__)) ) +#define HAVE_ALLOCA_H 1 +#endif +#define HAVE_SYS_TYPES_H 1 +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STRING_H 1 +#define HAVE_INTTYPES_H 1 +#define HAVE_STDINT_H 1 +#define HAVE_CTYPE_H 1 +#define HAVE_MATH_H 1 +#define HAVE_SIGNAL_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_GETENV 1 +#define HAVE_PUTENV 1 +#define HAVE_UNSETENV 1 +#define HAVE_QSORT 1 +#define HAVE_ABS 1 +#define HAVE_BCOPY 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE_STRLCPY 1 +#define HAVE_STRLCAT 1 +#define HAVE_STRDUP 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_STRTOL 1 +#define HAVE_STRTOUL 1 +#define HAVE_STRTOLL 1 +#define HAVE_STRTOULL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE_STRCASECMP 1 +#define HAVE_STRNCASECMP 1 +#define HAVE_SSCANF 1 +#define HAVE_SNPRINTF 1 +#define HAVE_VSNPRINTF 1 +#define HAVE_SIGACTION 1 +#define HAVE_SETJMP 1 +#define HAVE_NANOSLEEP 1 + +/* Enable various audio drivers */ +#define SDL_AUDIO_DRIVER_COREAUDIO 1 +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various cdrom drivers */ +#define SDL_CDROM_MACOSX 1 + +/* Enable various input drivers */ +#define SDL_JOYSTICK_IOKIT 1 + +/* Enable various shared object loading systems */ +#ifdef __ppc__ +/* For Mac OS X 10.2 compatibility */ +#define SDL_LOADSO_DLCOMPAT 1 +#else +#define SDL_LOADSO_DLOPEN 1 +#endif + +/* Enable various threading systems */ +#define SDL_THREAD_PTHREAD 1 +#define SDL_THREAD_PTHREAD_RECURSIVE_MUTEX 1 + +/* Enable various timer systems */ +#define SDL_TIMER_UNIX 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_DUMMY 1 +#if ((defined TARGET_API_MAC_CARBON) && (TARGET_API_MAC_CARBON)) +#define SDL_VIDEO_DRIVER_TOOLBOX 1 +#else +#define SDL_VIDEO_DRIVER_QUARTZ 1 +#endif +#define SDL_VIDEO_DRIVER_DGA 1 +#define SDL_VIDEO_DRIVER_X11 1 +#define SDL_VIDEO_DRIVER_X11_DGAMOUSE 1 +#define SDL_VIDEO_DRIVER_X11_DYNAMIC "/usr/X11R6/lib/libX11.6.dylib" +#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XEXT "/usr/X11R6/lib/libXext.6.dylib" +#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRANDR "/usr/X11R6/lib/libXrandr.2.dylib" +#define SDL_VIDEO_DRIVER_X11_DYNAMIC_XRENDER "/usr/X11R6/lib/libXrender.1.dylib" +#define SDL_VIDEO_DRIVER_X11_VIDMODE 1 +#define SDL_VIDEO_DRIVER_X11_XINERAMA 1 +#define SDL_VIDEO_DRIVER_X11_XME 1 +#define SDL_VIDEO_DRIVER_X11_XRANDR 1 +#define SDL_VIDEO_DRIVER_X11_XV 1 + +/* Enable OpenGL support */ +#define SDL_VIDEO_OPENGL 1 +#define SDL_VIDEO_OPENGL_GLX 1 + +/* Disable screensaver */ +#define SDL_VIDEO_DISABLE_SCREENSAVER 1 + +/* Enable assembly routines */ +#define SDL_ASSEMBLY_ROUTINES 1 +#ifdef __ppc__ +#define SDL_ALTIVEC_BLITTERS 1 +#endif + +#endif /* _SDL_config_macosx_h */ diff --git a/apps/plugins/sdl/include/SDL_config_minimal.h b/apps/plugins/sdl/include/SDL_config_minimal.h new file mode 100644 index 0000000..d10db7c --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_minimal.h @@ -0,0 +1,62 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_minimal_h +#define _SDL_config_minimal_h + +#include "SDL_platform.h" + +/* This is the minimal configuration that can be used to build SDL */ + +#include + +typedef signed char int8_t; +typedef unsigned char uint8_t; +typedef signed short int16_t; +typedef unsigned short uint16_t; +typedef signed int int32_t; +typedef unsigned int uint32_t; +typedef unsigned int size_t; +typedef unsigned long uintptr_t; + +/* Enable the dummy audio driver (src/audio/dummy/\*.c) */ +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ +#define SDL_CDROM_DISABLED 1 + +/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */ +#define SDL_JOYSTICK_DISABLED 1 + +/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ +#define SDL_LOADSO_DISABLED 1 + +/* Enable the stub thread support (src/thread/generic/\*.c) */ +#define SDL_THREADS_DISABLED 1 + +/* Enable the stub timer support (src/timer/dummy/\*.c) */ +#define SDL_TIMERS_DISABLED 1 + +/* Enable the dummy video driver (src/video/dummy/\*.c) */ +#define SDL_VIDEO_DRIVER_DUMMY 1 + +#endif /* _SDL_config_minimal_h */ diff --git a/apps/plugins/sdl/include/SDL_config_nds.h b/apps/plugins/sdl/include/SDL_config_nds.h new file mode 100644 index 0000000..cb4d61f --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_nds.h @@ -0,0 +1,115 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_nds_h +#define _SDL_config_nds_h + +#include "SDL_platform.h" + +/* This is a set of defines to configure the SDL features */ + +/* General platform specific identifiers */ +#include "SDL_platform.h" + +/* C datatypes */ +#define SDL_HAS_64BIT_TYPE 1 + +/* Endianness */ +#define SDL_BYTEORDER 1234 + +/* Useful headers */ +#define HAVE_ALLOCA_H 1 +#define HAVE_SYS_TYPES_H 1 +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STDLIB_H 1 +#define HAVE_STDARG_H 1 +#define HAVE_MALLOC_H 1 +#define HAVE_STRING_H 1 +#define HAVE_INTTYPES_H 1 +#define HAVE_STDINT_H 1 +#define HAVE_CTYPE_H 1 +#define HAVE_MATH_H 1 +#define HAVE_ICONV_H 1 +#define HAVE_SIGNAL_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_GETENV 1 +#define HAVE_PUTENV 1 +#define HAVE_UNSETENV 1 +#define HAVE_QSORT 1 +#define HAVE_ABS 1 +#define HAVE_BCOPY 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_STRLEN 1 +#define HAVE_STRLCPY 1 +#define HAVE_STRLCAT 1 +#define HAVE_STRDUP 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_STRTOL 1 +#define HAVE_STRTOUL 1 +#define HAVE_STRTOLL 1 +#define HAVE_STRTOULL 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE_STRCASECMP 1 +#define HAVE_STRNCASECMP 1 +#define HAVE_SSCANF 1 +#define HAVE_SNPRINTF 1 +#define HAVE_VSNPRINTF 1 +#define HAVE_SETJMP 1 + +/* Enable various audio drivers */ +#define SDL_AUDIO_DRIVER_NDS 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ +#define SDL_CDROM_DISABLED 1 + +/* Enable various input drivers */ +#define SDL_JOYSTICK_NDS 1 + +/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ +#define SDL_LOADSO_DISABLED 1 + +/* Enable the stub thread support (src/thread/generic/\*.c) */ +#define SDL_THREADS_DISABLED 1 + +/* Enable various timer systems */ +#define SDL_TIMER_NDS 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_NDS 1 +#define SDL_VIDEO_DRIVER_DUMMY 1 + +#endif /* _SDL_config_nds_h */ diff --git a/apps/plugins/sdl/include/SDL_config_os2.h b/apps/plugins/sdl/include/SDL_config_os2.h new file mode 100644 index 0000000..42edd20 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_os2.h @@ -0,0 +1,141 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_os2_h +#define _SDL_config_os2_h + +#include "SDL_platform.h" + +/* This is a set of defines to configure the SDL features */ + +typedef signed char int8_t; +typedef unsigned char uint8_t; +typedef signed short int16_t; +typedef unsigned short uint16_t; +typedef signed int int32_t; +typedef unsigned int uint32_t; +typedef unsigned int size_t; +typedef unsigned long uintptr_t; +typedef signed long long int64_t; +typedef unsigned long long uint64_t; + +#define SDL_HAS_64BIT_TYPE 1 + +/* Use Watcom's LIBC */ +#define HAVE_LIBC 1 + +/* Useful headers */ +#define HAVE_SYS_TYPES_H 1 +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STDLIB_H 1 +#define HAVE_STDARG_H 1 +#define HAVE_MALLOC_H 1 +#define HAVE_MEMORY_H 1 +#define HAVE_STRING_H 1 +#define HAVE_STRINGS_H 1 +#define HAVE_INTTYPES_H 1 +#define HAVE_STDINT_H 1 +#define HAVE_CTYPE_H 1 +#define HAVE_MATH_H 1 +#define HAVE_SIGNAL_H 1 + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_GETENV 1 +#define HAVE_PUTENV 1 +#define HAVE_UNSETENV 1 +#define HAVE_QSORT 1 +#define HAVE_ABS 1 +#define HAVE_BCOPY 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE_STRLCPY 1 +#define HAVE_STRLCAT 1 +#define HAVE_STRDUP 1 +#define HAVE__STRREV 1 +#define HAVE__STRUPR 1 +#define HAVE__STRLWR 1 +#define HAVE_INDEX 1 +#define HAVE_RINDEX 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_ITOA 1 +#define HAVE__LTOA 1 +#define HAVE__UITOA 1 +#define HAVE__ULTOA 1 +#define HAVE_STRTOL 1 +#define HAVE__I64TOA 1 +#define HAVE__UI64TOA 1 +#define HAVE_STRTOLL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE_STRICMP 1 +#define HAVE_STRCASECMP 1 +#define HAVE_SSCANF 1 +#define HAVE_SNPRINTF 1 +#define HAVE_VSNPRINTF 1 +#define HAVE_SETJMP 1 +#define HAVE_CLOCK_GETTIME 1 + +/* Enable various audio drivers */ +#define SDL_AUDIO_DRIVER_DART 1 +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various cdrom drivers */ +#define SDL_CDROM_OS2 1 + +/* Enable various input drivers */ +#define SDL_JOYSTICK_OS2 1 + +/* Enable various shared object loading systems */ +#define SDL_LOADSO_OS2 1 + +/* Enable various threading systems */ +#define SDL_THREAD_OS2 1 + +/* Enable various timer systems */ +#define SDL_TIMER_OS2 1 + +/* Enable various video drivers */ +#define SDL_VIDEO_DRIVER_DUMMY 1 +#define SDL_VIDEO_DRIVER_OS2FS 1 + +/* Enable OpenGL support */ +/* Nothing here yet for OS/2... :( */ + +/* Enable assembly routines where available */ +#define SDL_ASSEMBLY_ROUTINES 1 + +#endif /* _SDL_config_os2_h */ diff --git a/apps/plugins/sdl/include/SDL_config_rockbox.h b/apps/plugins/sdl/include/SDL_config_rockbox.h new file mode 100644 index 0000000..42801e4 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_rockbox.h @@ -0,0 +1,198 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_rockbox_h +#define _SDL_config_rockbox_h + +#include "SDL_platform.h" + +/* Rockbox SDL config header */ + +#include "plugin.h" +#include "lib/pluginlib_exit.h" + +#include +#include +#include +#include +#include + +//#define COMBINED_SDL + +/* games will use this sample rate */ +#ifdef SIMULATOR +#define RB_SAMPR SAMPR_44 +#else +#define RB_SAMPR SAMPR_16 +#endif + +/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ +#define SDL_CDROM_DISABLED 1 + +/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */ +#define SDL_JOYSTICK_DISABLED 1 + +/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ +#define SDL_LOADSO_DISABLED 1 + +/* woot */ +#define SDL_AUDIO_DRIVER_ROCKBOX 1 +#define SDL_THREAD_ROCKBOX 1 +#define SDL_TIMER_ROCKBOX 1 +#define SDL_VIDEO_DRIVER_ROCKBOX 1 + +#ifndef ROCKBOX_BIG_ENDIAN +#define SDL_BYTEORDER SDL_LIL_ENDIAN +#else +#define SDL_BYTEORDER SDL_BIG_ENDIAN +#endif + +#define SDL_HAS_64BIT_TYPE 1 +#define LACKS_UNISTD_H 1 +#define LACKS_STDLIB_H 1 +#define LACKS_MMAN_H 1 +#define LACKS_SYS_PARAM_H 1 +#define LACKS_SYS_MMAN_H 1 + +#define HAVE_STDIO_H 1 +#define HAVE_MALLOC 1 +#define HAVE_FREE 1 +#define HAVE_REALLOC 1 +#define HAVE_QSORT 1 + +#undef strdup + +/* clock() wraps current_tick */ +#define CLOCKS_PER_SEC HZ + +/* + copied from firmware/assert.h +*/ + +#undef assert + +#ifdef NDEBUG /* required by ANSI standard */ +#define assert(p) ((void)0) +#else + +#define assert(e) ((e) ? (void)0 : fatal("assertion failed %s:%d", __FILE__, __LINE__)) + +#endif /* NDEBUG */ + +#define SDL_calloc calloc +#define atan atan_wrapper +#define atan2 atan2_wrapper +#define atexit rb_atexit +#define atof atof_wrapper +#define atoi rb->atoi +#define atol atoi +#define calloc tlsf_calloc +#define ceil ceil_wrapper +#define clock() (*rb->current_tick) +#define closedir rb->closedir +#define cos cos_wrapper +#define exit rb_exit +#define exp(x) pow(2.71828182845, (x)) /* HACK */ +#define fabs fabs_wrapper +#define floor floor_wrapper +#define fmod fmod_wrapper +#define free tlsf_free +#define getchar() rb->sleep(2*HZ) +#define getenv SDL_getenv +#define log rb_log +#define lseek rb->lseek +#define malloc tlsf_malloc +#define mkdir rb->mkdir +#define opendir rb->opendir +#define pow pow_wrapper +#define printf printf_wrapper +#define putenv(x) /* nothing */ +#define puts printf +#define qsort rb->qsort +#define rand rb->rand +#define rb_atexit rbsdl_atexit +#define readdir rb->readdir +#define realloc tlsf_realloc +#define remove rb->remove +#define sin sin_wrapper +#define snprintf rb->snprintf +#define sprintf sprintf_wrapper +#define sqrt sqrt_wrapper +#define srand rb->srand +#define sscanf SDL_sscanf +#define strcasecmp rb->strcasecmp +#define strcat strcat_wrapper +#define strchr rb->strchr +#define strcmp rb->strcmp +#define strcpy strcpy_wrapper +#define strdup strdup_wrapper +#define strerror(x) "error" +#define strlen rb->strlen +#define strncasecmp rb->strncasecmp +#define strncat rb->strlcat /* hack */ +#define strncmp rb->strncmp +#define strpbrk strpbrk_wrapper +#define strrchr rb->strrchr +#define strstr SDL_strstr +#define strtok strtok_wrapper +#define strtok_r rb->strtok_r +#define strtol SDL_strtol +#define tan tan_wrapper +#define time(x) (*rb->current_tick/HZ) +#define unlink remove +#define vprintf vprintf_wrapper +#define vsnprintf rb->vsnprintf +#define vsprintf vsprintf_wrapper + +#define M_PI 3.141592 +#define EOF 0xff + +#define LOAD_XPM +#define MID_MUSIC +#define USE_TIMIDITY_MIDI + +#define FILENAME_MAX MAX_PATH + +char *strcat_wrapper(char *dest, const char *src); +char *strcpy_wrapper(char *dest, const char *src); +char *strtok_wrapper(char *str, const char *delim); +double ceil_wrapper(double x); +double cos_wrapper(double); +double floor_wrapper(double n); +double sin_wrapper(double); +float atan2_wrapper(float, float); +float atan_wrapper(float x); +float fabs_wrapper(float); +float fmod(float x, float y); +float pow_wrapper(float x, float y); +float rb_log(float x); +float sqrt_wrapper(float); +float tan_wrapper(float); +int mkdir_wrapepr(const char *path); +int printf_wrapper(const char*, ...); +int sprintf_wrapper(char*, const char*, ...); +int vprintf(const char *fmt, va_list ap); +void fatal(char *fmt, ...); +void rb_exit(int rc); +void rbsdl_atexit(void (*)(void)); + +#endif /* _SDL_config_rockbox_h */ diff --git a/apps/plugins/sdl/include/SDL_config_symbian.h b/apps/plugins/sdl/include/SDL_config_symbian.h new file mode 100644 index 0000000..e917ac6 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_symbian.h @@ -0,0 +1,146 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/* + +Symbian version Markus Mertama + +*/ + + +#ifndef _SDL_CONFIG_SYMBIAN_H +#define _SDL_CONFIG_SYMBIAN_H + +#include "SDL_platform.h" + +/* This is the minimal configuration that can be used to build SDL */ + + +#include +#include + + +#ifdef __GCCE__ +#define SYMBIAN32_GCCE +#endif + +#ifndef _SIZE_T_DEFINED +typedef unsigned int size_t; +#endif + +#ifndef _INTPTR_T_DECLARED +typedef unsigned int uintptr_t; +#endif + +#ifndef _INT8_T_DECLARED +typedef signed char int8_t; +#endif + +#ifndef _UINT8_T_DECLARED +typedef unsigned char uint8_t; +#endif + +#ifndef _INT16_T_DECLARED +typedef signed short int16_t; +#endif + +#ifndef _UINT16_T_DECLARED +typedef unsigned short uint16_t; +#endif + +#ifndef _INT32_T_DECLARED +typedef signed int int32_t; +#endif + +#ifndef _UINT32_T_DECLARED +typedef unsigned int uint32_t; +#endif + +#ifndef _INT64_T_DECLARED +typedef signed long long int64_t; +#endif + +#ifndef _UINT64_T_DECLARED +typedef unsigned long long uint64_t; +#endif + +#define SDL_AUDIO_DRIVER_EPOCAUDIO 1 + + +/* Enable the stub cdrom driver (src/cdrom/dummy/\*.c) */ +#define SDL_CDROM_DISABLED 1 + +/* Enable the stub joystick driver (src/joystick/dummy/\*.c) */ +#define SDL_JOYSTICK_DISABLED 1 + +/* Enable the stub shared object loader (src/loadso/dummy/\*.c) */ +#define SDL_LOADSO_DISABLED 1 + +#define SDL_THREAD_SYMBIAN 1 + +#define SDL_VIDEO_DRIVER_EPOC 1 + +#define SDL_VIDEO_OPENGL 0 + +#define SDL_HAS_64BIT_TYPE 1 + +#define HAVE_LIBC 1 +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STRING_H 1 +#define HAVE_CTYPE_H 1 +#define HAVE_MATH_H 1 + +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +/*#define HAVE_ALLOCA 1*/ +#define HAVE_QSORT 1 +#define HAVE_ABS 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE__STRUPR 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_ITOA 1 +#define HAVE_STRTOL 1 +#define HAVE_STRTOUL 1 +#define HAVE_STRTOLL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +/*#define HAVE__STRICMP 1*/ +#define HAVE__STRNICMP 1 +#define HAVE_SSCANF 1 +#define HAVE_STDARG_H 1 +#define HAVE_STDDEF_H 1 + + + +#endif /* _SDL_CONFIG_SYMBIAN_H */ diff --git a/apps/plugins/sdl/include/SDL_config_win32.h b/apps/plugins/sdl/include/SDL_config_win32.h new file mode 100644 index 0000000..da2c15d --- /dev/null +++ b/apps/plugins/sdl/include/SDL_config_win32.h @@ -0,0 +1,183 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_config_win32_h +#define _SDL_config_win32_h + +#include "SDL_platform.h" + +/* This is a set of defines to configure the SDL features */ + +#if defined(__GNUC__) || defined(__DMC__) +#define HAVE_STDINT_H 1 +#elif defined(_MSC_VER) +typedef signed __int8 int8_t; +typedef unsigned __int8 uint8_t; +typedef signed __int16 int16_t; +typedef unsigned __int16 uint16_t; +typedef signed __int32 int32_t; +typedef unsigned __int32 uint32_t; +typedef signed __int64 int64_t; +typedef unsigned __int64 uint64_t; +#ifndef _UINTPTR_T_DEFINED +#ifdef _WIN64 +typedef unsigned __int64 uintptr_t; +#else +typedef unsigned int uintptr_t; +#endif +#define _UINTPTR_T_DEFINED +#endif +/* Older Visual C++ headers don't have the Win64-compatible typedefs... */ +#if ((_MSC_VER <= 1200) && (!defined(DWORD_PTR))) +#define DWORD_PTR DWORD +#endif +#if ((_MSC_VER <= 1200) && (!defined(LONG_PTR))) +#define LONG_PTR LONG +#endif +#else /* !__GNUC__ && !_MSC_VER */ +typedef signed char int8_t; +typedef unsigned char uint8_t; +typedef signed short int16_t; +typedef unsigned short uint16_t; +typedef signed int int32_t; +typedef unsigned int uint32_t; +typedef signed long long int64_t; +typedef unsigned long long uint64_t; +#ifndef _SIZE_T_DEFINED_ +#define _SIZE_T_DEFINED_ +typedef unsigned int size_t; +#endif +typedef unsigned int uintptr_t; +#endif /* __GNUC__ || _MSC_VER */ +#define SDL_HAS_64BIT_TYPE 1 + +/* Enabled for SDL 1.2 (binary compatibility) */ +#define HAVE_LIBC 1 +#ifdef HAVE_LIBC +/* Useful headers */ +#define HAVE_STDIO_H 1 +#define STDC_HEADERS 1 +#define HAVE_STRING_H 1 +#define HAVE_CTYPE_H 1 +#define HAVE_MATH_H 1 +#ifndef _WIN32_WCE +#define HAVE_SIGNAL_H 1 +#endif + +/* C library functions */ +#define HAVE_MALLOC 1 +#define HAVE_CALLOC 1 +#define HAVE_REALLOC 1 +#define HAVE_FREE 1 +#define HAVE_ALLOCA 1 +#define HAVE_QSORT 1 +#define HAVE_ABS 1 +#define HAVE_MEMSET 1 +#define HAVE_MEMCPY 1 +#define HAVE_MEMMOVE 1 +#define HAVE_MEMCMP 1 +#define HAVE_STRLEN 1 +#define HAVE__STRREV 1 +#define HAVE__STRUPR 1 +#define HAVE__STRLWR 1 +#define HAVE_STRCHR 1 +#define HAVE_STRRCHR 1 +#define HAVE_STRSTR 1 +#define HAVE_ITOA 1 +#define HAVE__LTOA 1 +#define HAVE__ULTOA 1 +#define HAVE_STRTOL 1 +#define HAVE_STRTOUL 1 +#define HAVE_STRTOLL 1 +#define HAVE_STRTOD 1 +#define HAVE_ATOI 1 +#define HAVE_ATOF 1 +#define HAVE_STRCMP 1 +#define HAVE_STRNCMP 1 +#define HAVE__STRICMP 1 +#define HAVE__STRNICMP 1 +#define HAVE_SSCANF 1 +#else +#define HAVE_STDARG_H 1 +#define HAVE_STDDEF_H 1 +#endif + +/* Enable various audio drivers */ +#ifndef _WIN32_WCE +#define SDL_AUDIO_DRIVER_DSOUND 1 +#endif +#define SDL_AUDIO_DRIVER_WAVEOUT 1 +#define SDL_AUDIO_DRIVER_DISK 1 +#define SDL_AUDIO_DRIVER_DUMMY 1 + +/* Enable various cdrom drivers */ +#ifdef _WIN32_WCE +#define SDL_CDROM_DISABLED 1 +#else +#define SDL_CDROM_WIN32 1 +#endif + +/* Enable various input drivers */ +#ifdef _WIN32_WCE +#define SDL_JOYSTICK_DISABLED 1 +#else +#define SDL_JOYSTICK_WINMM 1 +#endif + +/* Enable various shared object loading systems */ +#define SDL_LOADSO_WIN32 1 + +/* Enable various threading systems */ +#define SDL_THREAD_WIN32 1 + +/* Enable various timer systems */ +#ifdef _WIN32_WCE +#define SDL_TIMER_WINCE 1 +#else +#define SDL_TIMER_WIN32 1 +#endif + +/* Enable various video drivers */ +#ifdef _WIN32_WCE +#define SDL_VIDEO_DRIVER_GAPI 1 +#endif +#ifndef _WIN32_WCE +#define SDL_VIDEO_DRIVER_DDRAW 1 +#endif +#define SDL_VIDEO_DRIVER_DUMMY 1 +#define SDL_VIDEO_DRIVER_WINDIB 1 + +/* Enable OpenGL support */ +#ifndef _WIN32_WCE +#define SDL_VIDEO_OPENGL 1 +#define SDL_VIDEO_OPENGL_WGL 1 +#endif + +/* Disable screensaver */ +#define SDL_VIDEO_DISABLE_SCREENSAVER 1 + +/* Enable assembly routines (Win64 doesn't have inline asm) */ +#ifndef _WIN64 +#define SDL_ASSEMBLY_ROUTINES 1 +#endif + +#endif /* _SDL_config_win32_h */ diff --git a/apps/plugins/sdl/include/SDL_copying.h b/apps/plugins/sdl/include/SDL_copying.h new file mode 100644 index 0000000..b5b64f2 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_copying.h @@ -0,0 +1,22 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + diff --git a/apps/plugins/sdl/include/SDL_cpuinfo.h b/apps/plugins/sdl/include/SDL_cpuinfo.h new file mode 100644 index 0000000..4200d6d --- /dev/null +++ b/apps/plugins/sdl/include/SDL_cpuinfo.h @@ -0,0 +1,69 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_cpuinfo.h + * CPU feature detection for SDL + */ + +#ifndef _SDL_cpuinfo_h +#define _SDL_cpuinfo_h + +#include "SDL_stdinc.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** This function returns true if the CPU has the RDTSC instruction */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasRDTSC(void); + +/** This function returns true if the CPU has MMX features */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasMMX(void); + +/** This function returns true if the CPU has MMX Ext. features */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasMMXExt(void); + +/** This function returns true if the CPU has 3DNow features */ +extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNow(void); + +/** This function returns true if the CPU has 3DNow! Ext. features */ +extern DECLSPEC SDL_bool SDLCALL SDL_Has3DNowExt(void); + +/** This function returns true if the CPU has SSE features */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE(void); + +/** This function returns true if the CPU has SSE2 features */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasSSE2(void); + +/** This function returns true if the CPU has AltiVec features */ +extern DECLSPEC SDL_bool SDLCALL SDL_HasAltiVec(void); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_cpuinfo_h */ diff --git a/apps/plugins/sdl/include/SDL_endian.h b/apps/plugins/sdl/include/SDL_endian.h new file mode 100644 index 0000000..aa604f8 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_endian.h @@ -0,0 +1,224 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_endian.h + * Functions for reading and writing endian-specific values + */ + +#ifndef _SDL_endian_h +#define _SDL_endian_h + +#include "SDL_stdinc.h" + +/** @name SDL_ENDIANs + * The two types of endianness + */ +/*@{*/ +#define SDL_LIL_ENDIAN 1234 +#define SDL_BIG_ENDIAN 4321 +/*@}*/ + +#ifndef SDL_BYTEORDER /* Not defined in SDL_config.h? */ +#ifdef __linux__ +#include +#define SDL_BYTEORDER __BYTE_ORDER +#else /* __linux __ */ +#if defined(__hppa__) || \ + defined(__m68k__) || defined(mc68000) || defined(_M_M68K) || \ + (defined(__MIPS__) && defined(__MISPEB__)) || \ + defined(__ppc__) || defined(__POWERPC__) || defined(_M_PPC) || \ + defined(__sparc__) +#define SDL_BYTEORDER SDL_BIG_ENDIAN +#else +#define SDL_BYTEORDER SDL_LIL_ENDIAN +#endif +#endif /* __linux __ */ +#endif /* !SDL_BYTEORDER */ + + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** + * @name SDL_Swap Functions + * Use inline functions for compilers that support them, and static + * functions for those that do not. Because these functions become + * static for compilers that do not support inline functions, this + * header should only be included in files that actually use them. + */ +/*@{*/ + +#define Uint16 uint16_t +#define Uint32 uint32_t +#define Uint64 uint64_t +#undef SDL_static_cast +#define SDL_static_cast(type, val) ((type)((val))) +#if defined(__GNUC__) && defined(__i386__) && \ + !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */) +static __inline__ Uint16 SDL_Swap16(Uint16 x) +{ + __asm__("xchgb %b0,%h0" : "=q" (x) : "0" (x)); + return x; +} +#elif defined(__GNUC__) && defined(__x86_64__) +static __inline__ Uint16 SDL_Swap16(Uint16 x) +{ + __asm__("xchgb %b0,%h0" : "=Q" (x) : "0" (x)); + return x; +} +#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__)) +static __inline__ Uint16 SDL_Swap16(Uint16 x) +{ + int result; + + __asm__("rlwimi %0,%2,8,16,23" : "=&r" (result) : "0" (x >> 8), "r" (x)); + return (Uint16)result; +} +#elif defined(__GNUC__) && (defined(__m68k__) && !defined(__mcoldfire__)) +static __inline__ Uint16 SDL_Swap16(Uint16 x) +{ + __asm__("rorw #8,%0" : "=d" (x) : "0" (x) : "cc"); + return x; +} +#else +static __inline__ Uint16 SDL_Swap16(Uint16 x) { + return SDL_static_cast(Uint16, ((x<<8)|(x>>8))); +} +#endif + +#if defined(__GNUC__) && defined(__i386__) && \ + !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */) +static __inline__ Uint32 SDL_Swap32(Uint32 x) +{ + __asm__("bswap %0" : "=r" (x) : "0" (x)); + return x; +} +#elif defined(__GNUC__) && defined(__x86_64__) +static __inline__ Uint32 SDL_Swap32(Uint32 x) +{ + __asm__("bswapl %0" : "=r" (x) : "0" (x)); + return x; +} +#elif defined(__GNUC__) && (defined(__powerpc__) || defined(__ppc__)) +static __inline__ Uint32 SDL_Swap32(Uint32 x) +{ + Uint32 result; + + __asm__("rlwimi %0,%2,24,16,23" : "=&r" (result) : "0" (x>>24), "r" (x)); + __asm__("rlwimi %0,%2,8,8,15" : "=&r" (result) : "0" (result), "r" (x)); + __asm__("rlwimi %0,%2,24,0,7" : "=&r" (result) : "0" (result), "r" (x)); + return result; +} +#elif defined(__GNUC__) && (defined(__m68k__) && !defined(__mcoldfire__)) +static __inline__ Uint32 SDL_Swap32(Uint32 x) +{ + __asm__("rorw #8,%0\n\tswap %0\n\trorw #8,%0" : "=d" (x) : "0" (x) : "cc"); + return x; +} +#else +static __inline__ Uint32 SDL_Swap32(Uint32 x) { + return SDL_static_cast(Uint32, ((x<<24)|((x<<8)&0x00FF0000)|((x>>8)&0x0000FF00)|(x>>24))); +} +#endif + +#ifdef SDL_HAS_64BIT_TYPE +#if defined(__GNUC__) && defined(__i386__) && \ + !(__GNUC__ == 2 && __GNUC_MINOR__ <= 95 /* broken gcc version */) +static __inline__ Uint64 SDL_Swap64(Uint64 x) +{ + union { + struct { Uint32 a,b; } s; + Uint64 u; + } v; + v.u = x; + __asm__("bswapl %0 ; bswapl %1 ; xchgl %0,%1" + : "=r" (v.s.a), "=r" (v.s.b) + : "0" (v.s.a), "1" (v.s.b)); + return v.u; +} +#elif defined(__GNUC__) && defined(__x86_64__) +static __inline__ Uint64 SDL_Swap64(Uint64 x) +{ + __asm__("bswapq %0" : "=r" (x) : "0" (x)); + return x; +} +#else +static __inline__ Uint64 SDL_Swap64(Uint64 x) +{ + Uint32 hi, lo; + + /* Separate into high and low 32-bit values and swap them */ + lo = SDL_static_cast(Uint32, x & 0xFFFFFFFF); + x >>= 32; + hi = SDL_static_cast(Uint32, x & 0xFFFFFFFF); + x = SDL_Swap32(lo); + x <<= 32; + x |= SDL_Swap32(hi); + return (x); +} +#endif +#else +/* This is mainly to keep compilers from complaining in SDL code. + * If there is no real 64-bit datatype, then compilers will complain about + * the fake 64-bit datatype that SDL provides when it compiles user code. + */ +#define SDL_Swap64(X) (X) +#endif /* SDL_HAS_64BIT_TYPE */ +/*@}*/ + +#undef Uint16 +#undef Uint32 +#undef Uint64 + +/** + * @name SDL_SwapLE and SDL_SwapBE Functions + * Byteswap item from the specified endianness to the native endianness + */ +/*@{*/ +#if SDL_BYTEORDER == SDL_LIL_ENDIAN +#define SDL_SwapLE16(X) (X) +#define SDL_SwapLE32(X) (X) +#define SDL_SwapLE64(X) (X) +#define SDL_SwapBE16(X) SDL_Swap16(X) +#define SDL_SwapBE32(X) SDL_Swap32(X) +#define SDL_SwapBE64(X) SDL_Swap64(X) +#else +#define SDL_SwapLE16(X) SDL_Swap16(X) +#define SDL_SwapLE32(X) SDL_Swap32(X) +#define SDL_SwapLE64(X) SDL_Swap64(X) +#define SDL_SwapBE16(X) (X) +#define SDL_SwapBE32(X) (X) +#define SDL_SwapBE64(X) (X) +#endif +/*@}*/ + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_endian_h */ diff --git a/apps/plugins/sdl/include/SDL_error.h b/apps/plugins/sdl/include/SDL_error.h new file mode 100644 index 0000000..4e1cce3 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_error.h @@ -0,0 +1,72 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_error.h + * Simple error message routines for SDL + */ + +#ifndef _SDL_error_h +#define _SDL_error_h + +#include "SDL_stdinc.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** + * @name Public functions + */ +/*@{*/ +extern DECLSPEC void SDLCALL SDL_SetError(const char *fmt, ...); +extern DECLSPEC char * SDLCALL SDL_GetError(void); +extern DECLSPEC void SDLCALL SDL_ClearError(void); +/*@}*/ + +/** + * @name Private functions + * @internal Private error message function - used internally + */ +/*@{*/ +#define SDL_OutOfMemory() SDL_Error(SDL_ENOMEM) +#define SDL_Unsupported() SDL_Error(SDL_UNSUPPORTED) +typedef enum { + SDL_ENOMEM, + SDL_EFREAD, + SDL_EFWRITE, + SDL_EFSEEK, + SDL_UNSUPPORTED, + SDL_LASTERROR +} SDL_errorcode; +extern DECLSPEC void SDLCALL SDL_Error(SDL_errorcode code); +/*@}*/ + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_error_h */ diff --git a/apps/plugins/sdl/include/SDL_events.h b/apps/plugins/sdl/include/SDL_events.h new file mode 100644 index 0000000..94b4202 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_events.h @@ -0,0 +1,356 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file SDL_events.h + * Include file for SDL event handling + */ + +#ifndef _SDL_events_h +#define _SDL_events_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" +#include "SDL_active.h" +#include "SDL_keyboard.h" +#include "SDL_mouse.h" +#include "SDL_joystick.h" +#include "SDL_quit.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @name General keyboard/mouse state definitions */ +/*@{*/ +#define SDL_RELEASED 0 +#define SDL_PRESSED 1 +/*@}*/ + +/** Event enumerations */ +typedef enum { + SDL_NOEVENT = 0, /**< Unused (do not remove) */ + SDL_ACTIVEEVENT, /**< Application loses/gains visibility */ + SDL_KEYDOWN, /**< Keys pressed */ + SDL_KEYUP, /**< Keys released */ + SDL_MOUSEMOTION, /**< Mouse moved */ + SDL_MOUSEBUTTONDOWN, /**< Mouse button pressed */ + SDL_MOUSEBUTTONUP, /**< Mouse button released */ + SDL_JOYAXISMOTION, /**< Joystick axis motion */ + SDL_JOYBALLMOTION, /**< Joystick trackball motion */ + SDL_JOYHATMOTION, /**< Joystick hat position change */ + SDL_JOYBUTTONDOWN, /**< Joystick button pressed */ + SDL_JOYBUTTONUP, /**< Joystick button released */ + SDL_QUIT, /**< User-requested quit */ + SDL_SYSWMEVENT, /**< System specific event */ + SDL_EVENT_RESERVEDA, /**< Reserved for future use.. */ + SDL_EVENT_RESERVEDB, /**< Reserved for future use.. */ + SDL_VIDEORESIZE, /**< User resized video mode */ + SDL_VIDEOEXPOSE, /**< Screen needs to be redrawn */ + SDL_EVENT_RESERVED2, /**< Reserved for future use.. */ + SDL_EVENT_RESERVED3, /**< Reserved for future use.. */ + SDL_EVENT_RESERVED4, /**< Reserved for future use.. */ + SDL_EVENT_RESERVED5, /**< Reserved for future use.. */ + SDL_EVENT_RESERVED6, /**< Reserved for future use.. */ + SDL_EVENT_RESERVED7, /**< Reserved for future use.. */ + /** Events SDL_USEREVENT through SDL_MAXEVENTS-1 are for your use */ + SDL_USEREVENT = 24, + /** This last event is only for bounding internal arrays + * It is the number of bits in the event mask datatype -- Uint32 + */ + SDL_NUMEVENTS = 32 +} SDL_EventType; + +/** @name Predefined event masks */ +/*@{*/ +#define SDL_EVENTMASK(X) (1<<(X)) +typedef enum { + SDL_ACTIVEEVENTMASK = SDL_EVENTMASK(SDL_ACTIVEEVENT), + SDL_KEYDOWNMASK = SDL_EVENTMASK(SDL_KEYDOWN), + SDL_KEYUPMASK = SDL_EVENTMASK(SDL_KEYUP), + SDL_KEYEVENTMASK = SDL_EVENTMASK(SDL_KEYDOWN)| + SDL_EVENTMASK(SDL_KEYUP), + SDL_MOUSEMOTIONMASK = SDL_EVENTMASK(SDL_MOUSEMOTION), + SDL_MOUSEBUTTONDOWNMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN), + SDL_MOUSEBUTTONUPMASK = SDL_EVENTMASK(SDL_MOUSEBUTTONUP), + SDL_MOUSEEVENTMASK = SDL_EVENTMASK(SDL_MOUSEMOTION)| + SDL_EVENTMASK(SDL_MOUSEBUTTONDOWN)| + SDL_EVENTMASK(SDL_MOUSEBUTTONUP), + SDL_JOYAXISMOTIONMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION), + SDL_JOYBALLMOTIONMASK = SDL_EVENTMASK(SDL_JOYBALLMOTION), + SDL_JOYHATMOTIONMASK = SDL_EVENTMASK(SDL_JOYHATMOTION), + SDL_JOYBUTTONDOWNMASK = SDL_EVENTMASK(SDL_JOYBUTTONDOWN), + SDL_JOYBUTTONUPMASK = SDL_EVENTMASK(SDL_JOYBUTTONUP), + SDL_JOYEVENTMASK = SDL_EVENTMASK(SDL_JOYAXISMOTION)| + SDL_EVENTMASK(SDL_JOYBALLMOTION)| + SDL_EVENTMASK(SDL_JOYHATMOTION)| + SDL_EVENTMASK(SDL_JOYBUTTONDOWN)| + SDL_EVENTMASK(SDL_JOYBUTTONUP), + SDL_VIDEORESIZEMASK = SDL_EVENTMASK(SDL_VIDEORESIZE), + SDL_VIDEOEXPOSEMASK = SDL_EVENTMASK(SDL_VIDEOEXPOSE), + SDL_QUITMASK = SDL_EVENTMASK(SDL_QUIT), + SDL_SYSWMEVENTMASK = SDL_EVENTMASK(SDL_SYSWMEVENT) +} SDL_EventMask ; +#define SDL_ALLEVENTS 0xFFFFFFFF +/*@}*/ + +/** Application visibility event structure */ +typedef struct SDL_ActiveEvent { + Uint8 type; /**< SDL_ACTIVEEVENT */ + Uint8 gain; /**< Whether given states were gained or lost (1/0) */ + Uint8 state; /**< A mask of the focus states */ +} SDL_ActiveEvent; + +/** Keyboard event structure */ +typedef struct SDL_KeyboardEvent { + Uint8 type; /**< SDL_KEYDOWN or SDL_KEYUP */ + Uint8 which; /**< The keyboard device index */ + Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */ + SDL_keysym keysym; +} SDL_KeyboardEvent; + +/** Mouse motion event structure */ +typedef struct SDL_MouseMotionEvent { + Uint8 type; /**< SDL_MOUSEMOTION */ + Uint8 which; /**< The mouse device index */ + Uint8 state; /**< The current button state */ + Uint16 x, y; /**< The X/Y coordinates of the mouse */ + Sint16 xrel; /**< The relative motion in the X direction */ + Sint16 yrel; /**< The relative motion in the Y direction */ +} SDL_MouseMotionEvent; + +/** Mouse button event structure */ +typedef struct SDL_MouseButtonEvent { + Uint8 type; /**< SDL_MOUSEBUTTONDOWN or SDL_MOUSEBUTTONUP */ + Uint8 which; /**< The mouse device index */ + Uint8 button; /**< The mouse button index */ + Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */ + Uint16 x, y; /**< The X/Y coordinates of the mouse at press time */ +} SDL_MouseButtonEvent; + +/** Joystick axis motion event structure */ +typedef struct SDL_JoyAxisEvent { + Uint8 type; /**< SDL_JOYAXISMOTION */ + Uint8 which; /**< The joystick device index */ + Uint8 axis; /**< The joystick axis index */ + Sint16 value; /**< The axis value (range: -32768 to 32767) */ +} SDL_JoyAxisEvent; + +/** Joystick trackball motion event structure */ +typedef struct SDL_JoyBallEvent { + Uint8 type; /**< SDL_JOYBALLMOTION */ + Uint8 which; /**< The joystick device index */ + Uint8 ball; /**< The joystick trackball index */ + Sint16 xrel; /**< The relative motion in the X direction */ + Sint16 yrel; /**< The relative motion in the Y direction */ +} SDL_JoyBallEvent; + +/** Joystick hat position change event structure */ +typedef struct SDL_JoyHatEvent { + Uint8 type; /**< SDL_JOYHATMOTION */ + Uint8 which; /**< The joystick device index */ + Uint8 hat; /**< The joystick hat index */ + Uint8 value; /**< The hat position value: + * SDL_HAT_LEFTUP SDL_HAT_UP SDL_HAT_RIGHTUP + * SDL_HAT_LEFT SDL_HAT_CENTERED SDL_HAT_RIGHT + * SDL_HAT_LEFTDOWN SDL_HAT_DOWN SDL_HAT_RIGHTDOWN + * Note that zero means the POV is centered. + */ +} SDL_JoyHatEvent; + +/** Joystick button event structure */ +typedef struct SDL_JoyButtonEvent { + Uint8 type; /**< SDL_JOYBUTTONDOWN or SDL_JOYBUTTONUP */ + Uint8 which; /**< The joystick device index */ + Uint8 button; /**< The joystick button index */ + Uint8 state; /**< SDL_PRESSED or SDL_RELEASED */ +} SDL_JoyButtonEvent; + +/** The "window resized" event + * When you get this event, you are responsible for setting a new video + * mode with the new width and height. + */ +typedef struct SDL_ResizeEvent { + Uint8 type; /**< SDL_VIDEORESIZE */ + int w; /**< New width */ + int h; /**< New height */ +} SDL_ResizeEvent; + +/** The "screen redraw" event */ +typedef struct SDL_ExposeEvent { + Uint8 type; /**< SDL_VIDEOEXPOSE */ +} SDL_ExposeEvent; + +/** The "quit requested" event */ +typedef struct SDL_QuitEvent { + Uint8 type; /**< SDL_QUIT */ +} SDL_QuitEvent; + +/** A user-defined event type */ +typedef struct SDL_UserEvent { + Uint8 type; /**< SDL_USEREVENT through SDL_NUMEVENTS-1 */ + int code; /**< User defined event code */ + void *data1; /**< User defined data pointer */ + void *data2; /**< User defined data pointer */ +} SDL_UserEvent; + +/** If you want to use this event, you should include SDL_syswm.h */ +struct SDL_SysWMmsg; +typedef struct SDL_SysWMmsg SDL_SysWMmsg; +typedef struct SDL_SysWMEvent { + Uint8 type; + SDL_SysWMmsg *msg; +} SDL_SysWMEvent; + +/** General event structure */ +typedef union SDL_Event { + Uint8 type; + SDL_ActiveEvent active; + SDL_KeyboardEvent key; + SDL_MouseMotionEvent motion; + SDL_MouseButtonEvent button; + SDL_JoyAxisEvent jaxis; + SDL_JoyBallEvent jball; + SDL_JoyHatEvent jhat; + SDL_JoyButtonEvent jbutton; + SDL_ResizeEvent resize; + SDL_ExposeEvent expose; + SDL_QuitEvent quit; + SDL_UserEvent user; + SDL_SysWMEvent syswm; +} SDL_Event; + + +/* Function prototypes */ + +/** Pumps the event loop, gathering events from the input devices. + * This function updates the event queue and internal input device state. + * This should only be run in the thread that sets the video mode. + */ +extern DECLSPEC void SDLCALL SDL_PumpEvents(void); + +typedef enum { + SDL_ADDEVENT, + SDL_PEEKEVENT, + SDL_GETEVENT +} SDL_eventaction; + +/** + * Checks the event queue for messages and optionally returns them. + * + * If 'action' is SDL_ADDEVENT, up to 'numevents' events will be added to + * the back of the event queue. + * If 'action' is SDL_PEEKEVENT, up to 'numevents' events at the front + * of the event queue, matching 'mask', will be returned and will not + * be removed from the queue. + * If 'action' is SDL_GETEVENT, up to 'numevents' events at the front + * of the event queue, matching 'mask', will be returned and will be + * removed from the queue. + * + * @return + * This function returns the number of events actually stored, or -1 + * if there was an error. + * + * This function is thread-safe. + */ +extern DECLSPEC int SDLCALL SDL_PeepEvents(SDL_Event *events, int numevents, + SDL_eventaction action, Uint32 mask); + +/** Polls for currently pending events, and returns 1 if there are any pending + * events, or 0 if there are none available. If 'event' is not NULL, the next + * event is removed from the queue and stored in that area. + */ +extern DECLSPEC int SDLCALL SDL_PollEvent(SDL_Event *event); + +/** Waits indefinitely for the next available event, returning 1, or 0 if there + * was an error while waiting for events. If 'event' is not NULL, the next + * event is removed from the queue and stored in that area. + */ +extern DECLSPEC int SDLCALL SDL_WaitEvent(SDL_Event *event); + +/** Add an event to the event queue. + * This function returns 0 on success, or -1 if the event queue was full + * or there was some other error. + */ +extern DECLSPEC int SDLCALL SDL_PushEvent(SDL_Event *event); + +/** @name Event Filtering */ +/*@{*/ +typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); +/** + * This function sets up a filter to process all events before they + * change internal state and are posted to the internal event queue. + * + * The filter is protypted as: + * @code typedef int (SDLCALL *SDL_EventFilter)(const SDL_Event *event); @endcode + * + * If the filter returns 1, then the event will be added to the internal queue. + * If it returns 0, then the event will be dropped from the queue, but the + * internal state will still be updated. This allows selective filtering of + * dynamically arriving events. + * + * @warning Be very careful of what you do in the event filter function, as + * it may run in a different thread! + * + * There is one caveat when dealing with the SDL_QUITEVENT event type. The + * event filter is only called when the window manager desires to close the + * application window. If the event filter returns 1, then the window will + * be closed, otherwise the window will remain open if possible. + * If the quit event is generated by an interrupt signal, it will bypass the + * internal queue and be delivered to the application at the next event poll. + */ +extern DECLSPEC void SDLCALL SDL_SetEventFilter(SDL_EventFilter filter); + +/** + * Return the current event filter - can be used to "chain" filters. + * If there is no event filter set, this function returns NULL. + */ +extern DECLSPEC SDL_EventFilter SDLCALL SDL_GetEventFilter(void); +/*@}*/ + +/** @name Event State */ +/*@{*/ +#define SDL_QUERY -1 +#define SDL_IGNORE 0 +#define SDL_DISABLE 0 +#define SDL_ENABLE 1 +/*@}*/ + +/** +* This function allows you to set the state of processing certain events. +* If 'state' is set to SDL_IGNORE, that event will be automatically dropped +* from the event queue and will not event be filtered. +* If 'state' is set to SDL_ENABLE, that event will be processed normally. +* If 'state' is set to SDL_QUERY, SDL_EventState() will return the +* current processing state of the specified event. +*/ +extern DECLSPEC Uint8 SDLCALL SDL_EventState(Uint8 type, int state); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_events_h */ diff --git a/apps/plugins/sdl/include/SDL_getenv.h b/apps/plugins/sdl/include/SDL_getenv.h new file mode 100644 index 0000000..bea6300 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_getenv.h @@ -0,0 +1,28 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_getenv.h + * @deprecated Use SDL_stdinc.h instead + */ + +/* DEPRECATED */ +#include "SDL_stdinc.h" diff --git a/apps/plugins/sdl/include/SDL_image.h b/apps/plugins/sdl/include/SDL_image.h new file mode 100644 index 0000000..bc41513 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_image.h @@ -0,0 +1,138 @@ +/* + SDL_image: An example image loading library for use with SDL + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* A simple library to load images of various formats as SDL surfaces */ + +#ifndef _SDL_IMAGE_H +#define _SDL_IMAGE_H + +#include "SDL.h" +#include "SDL_version.h" +#include "begin_code.h" + +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/* Printable format: "%d.%d.%d", MAJOR, MINOR, PATCHLEVEL +*/ +#define SDL_IMAGE_MAJOR_VERSION 1 +#define SDL_IMAGE_MINOR_VERSION 2 +#define SDL_IMAGE_PATCHLEVEL 12 + +/* This macro can be used to fill a version structure with the compile-time + * version of the SDL_image library. + */ +#define SDL_IMAGE_VERSION(X) \ +{ \ + (X)->major = SDL_IMAGE_MAJOR_VERSION; \ + (X)->minor = SDL_IMAGE_MINOR_VERSION; \ + (X)->patch = SDL_IMAGE_PATCHLEVEL; \ +} + +/* This function gets the version of the dynamically linked SDL_image library. + it should NOT be used to fill a version structure, instead you should + use the SDL_IMAGE_VERSION() macro. + */ +extern DECLSPEC const SDL_version * SDLCALL IMG_Linked_Version(void); + +typedef enum +{ + IMG_INIT_JPG = 0x00000001, + IMG_INIT_PNG = 0x00000002, + IMG_INIT_TIF = 0x00000004, + IMG_INIT_WEBP = 0x00000008 +} IMG_InitFlags; + +/* Loads dynamic libraries and prepares them for use. Flags should be + one or more flags from IMG_InitFlags OR'd together. + It returns the flags successfully initialized, or 0 on failure. + */ +extern DECLSPEC int SDLCALL IMG_Init(int flags); + +/* Unloads libraries loaded with IMG_Init */ +extern DECLSPEC void SDLCALL IMG_Quit(void); + +/* Load an image from an SDL data source. + The 'type' may be one of: "BMP", "GIF", "PNG", etc. + + If the image format supports a transparent pixel, SDL will set the + colorkey for the surface. You can enable RLE acceleration on the + surface afterwards by calling: + SDL_SetColorKey(image, SDL_RLEACCEL, image->format->colorkey); + */ +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadTyped_RW(SDL_RWops *src, int freesrc, char *type); +/* Convenience functions */ +extern DECLSPEC SDL_Surface * SDLCALL IMG_Load(const char *file); +extern DECLSPEC SDL_Surface * SDLCALL IMG_Load_RW(SDL_RWops *src, int freesrc); + +/* Invert the alpha of a surface for use with OpenGL + This function is now a no-op, and only provided for backwards compatibility. +*/ +extern DECLSPEC int SDLCALL IMG_InvertAlpha(int on); + +/* Functions to detect a file type, given a seekable source */ +extern DECLSPEC int SDLCALL IMG_isICO(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isCUR(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isBMP(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isGIF(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isJPG(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isLBM(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isPCX(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isPNG(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isPNM(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isTIF(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isXCF(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isXPM(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isXV(SDL_RWops *src); +extern DECLSPEC int SDLCALL IMG_isWEBP(SDL_RWops *src); + +/* Individual loading functions */ +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadICO_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadCUR_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadBMP_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadGIF_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadJPG_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadLBM_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadPCX_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadPNG_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadPNM_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadTGA_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadTIF_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadXCF_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadXPM_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadXV_RW(SDL_RWops *src); +extern DECLSPEC SDL_Surface * SDLCALL IMG_LoadWEBP_RW(SDL_RWops *src); + +extern DECLSPEC SDL_Surface * SDLCALL IMG_ReadXPMFromArray(char **xpm); + +/* We'll use SDL for reporting errors */ +#define IMG_SetError SDL_SetError +#define IMG_GetError SDL_GetError + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_IMAGE_H */ diff --git a/apps/plugins/sdl/include/SDL_joystick.h b/apps/plugins/sdl/include/SDL_joystick.h new file mode 100644 index 0000000..708d1a9 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_joystick.h @@ -0,0 +1,187 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_joystick.h + * Include file for SDL joystick event handling + */ + +#ifndef _SDL_joystick_h +#define _SDL_joystick_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @file SDL_joystick.h + * @note In order to use these functions, SDL_Init() must have been called + * with the SDL_INIT_JOYSTICK flag. This causes SDL to scan the system + * for joysticks, and load appropriate drivers. + */ + +/** The joystick structure used to identify an SDL joystick */ +struct _SDL_Joystick; +typedef struct _SDL_Joystick SDL_Joystick; + +/* Function prototypes */ +/** + * Count the number of joysticks attached to the system + */ +extern DECLSPEC int SDLCALL SDL_NumJoysticks(void); + +/** + * Get the implementation dependent name of a joystick. + * + * This can be called before any joysticks are opened. + * If no name can be found, this function returns NULL. + */ +extern DECLSPEC const char * SDLCALL SDL_JoystickName(int device_index); + +/** + * Open a joystick for use. + * + * @param[in] device_index + * The index passed as an argument refers to + * the N'th joystick on the system. This index is the value which will + * identify this joystick in future joystick events. + * + * @return This function returns a joystick identifier, or NULL if an error occurred. + */ +extern DECLSPEC SDL_Joystick * SDLCALL SDL_JoystickOpen(int device_index); + +/** + * Returns 1 if the joystick has been opened, or 0 if it has not. + */ +extern DECLSPEC int SDLCALL SDL_JoystickOpened(int device_index); + +/** + * Get the device index of an opened joystick. + */ +extern DECLSPEC int SDLCALL SDL_JoystickIndex(SDL_Joystick *joystick); + +/** + * Get the number of general axis controls on a joystick + */ +extern DECLSPEC int SDLCALL SDL_JoystickNumAxes(SDL_Joystick *joystick); + +/** + * Get the number of trackballs on a joystick + * + * Joystick trackballs have only relative motion events associated + * with them and their state cannot be polled. + */ +extern DECLSPEC int SDLCALL SDL_JoystickNumBalls(SDL_Joystick *joystick); + +/** + * Get the number of POV hats on a joystick + */ +extern DECLSPEC int SDLCALL SDL_JoystickNumHats(SDL_Joystick *joystick); + +/** + * Get the number of buttons on a joystick + */ +extern DECLSPEC int SDLCALL SDL_JoystickNumButtons(SDL_Joystick *joystick); + +/** + * Update the current state of the open joysticks. + * + * This is called automatically by the event loop if any joystick + * events are enabled. + */ +extern DECLSPEC void SDLCALL SDL_JoystickUpdate(void); + +/** + * Enable/disable joystick event polling. + * + * If joystick events are disabled, you must call SDL_JoystickUpdate() + * yourself and check the state of the joystick when you want joystick + * information. + * + * @param[in] state The state can be one of SDL_QUERY, SDL_ENABLE or SDL_IGNORE. + */ +extern DECLSPEC int SDLCALL SDL_JoystickEventState(int state); + +/** + * Get the current state of an axis control on a joystick + * + * @param[in] axis The axis indices start at index 0. + * + * @return The state is a value ranging from -32768 to 32767. + */ +extern DECLSPEC Sint16 SDLCALL SDL_JoystickGetAxis(SDL_Joystick *joystick, int axis); + +/** + * @name Hat Positions + * The return value of SDL_JoystickGetHat() is one of the following positions: + */ +/*@{*/ +#define SDL_HAT_CENTERED 0x00 +#define SDL_HAT_UP 0x01 +#define SDL_HAT_RIGHT 0x02 +#define SDL_HAT_DOWN 0x04 +#define SDL_HAT_LEFT 0x08 +#define SDL_HAT_RIGHTUP (SDL_HAT_RIGHT|SDL_HAT_UP) +#define SDL_HAT_RIGHTDOWN (SDL_HAT_RIGHT|SDL_HAT_DOWN) +#define SDL_HAT_LEFTUP (SDL_HAT_LEFT|SDL_HAT_UP) +#define SDL_HAT_LEFTDOWN (SDL_HAT_LEFT|SDL_HAT_DOWN) +/*@}*/ + +/** + * Get the current state of a POV hat on a joystick + * + * @param[in] hat The hat indices start at index 0. + */ +extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetHat(SDL_Joystick *joystick, int hat); + +/** + * Get the ball axis change since the last poll + * + * @param[in] ball The ball indices start at index 0. + * + * @return This returns 0, or -1 if you passed it invalid parameters. + */ +extern DECLSPEC int SDLCALL SDL_JoystickGetBall(SDL_Joystick *joystick, int ball, int *dx, int *dy); + +/** + * Get the current state of a button on a joystick + * + * @param[in] button The button indices start at index 0. + */ +extern DECLSPEC Uint8 SDLCALL SDL_JoystickGetButton(SDL_Joystick *joystick, int button); + +/** + * Close a joystick previously opened with SDL_JoystickOpen() + */ +extern DECLSPEC void SDLCALL SDL_JoystickClose(SDL_Joystick *joystick); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_joystick_h */ diff --git a/apps/plugins/sdl/include/SDL_keyboard.h b/apps/plugins/sdl/include/SDL_keyboard.h new file mode 100644 index 0000000..9d7129c --- /dev/null +++ b/apps/plugins/sdl/include/SDL_keyboard.h @@ -0,0 +1,135 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_keyboard.h + * Include file for SDL keyboard event handling + */ + +#ifndef _SDL_keyboard_h +#define _SDL_keyboard_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" +#include "SDL_keysym.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** Keysym structure + * + * - The scancode is hardware dependent, and should not be used by general + * applications. If no hardware scancode is available, it will be 0. + * + * - The 'unicode' translated character is only available when character + * translation is enabled by the SDL_EnableUNICODE() API. If non-zero, + * this is a UNICODE character corresponding to the keypress. If the + * high 9 bits of the character are 0, then this maps to the equivalent + * ASCII character: + * @code + * char ch; + * if ( (keysym.unicode & 0xFF80) == 0 ) { + * ch = keysym.unicode & 0x7F; + * } else { + * An international character.. + * } + * @endcode + */ +typedef struct SDL_keysym { + Uint8 scancode; /**< hardware specific scancode */ + SDLKey sym; /**< SDL virtual keysym */ + SDLMod mod; /**< current key modifiers */ + Uint16 unicode; /**< translated character */ +} SDL_keysym; + +/** This is the mask which refers to all hotkey bindings */ +#define SDL_ALL_HOTKEYS 0xFFFFFFFF + +/* Function prototypes */ +/** + * Enable/Disable UNICODE translation of keyboard input. + * + * This translation has some overhead, so translation defaults off. + * + * @param[in] enable + * If 'enable' is 1, translation is enabled. + * If 'enable' is 0, translation is disabled. + * If 'enable' is -1, the translation state is not changed. + * + * @return It returns the previous state of keyboard translation. + */ +extern DECLSPEC int SDLCALL SDL_EnableUNICODE(int enable); + +#define SDL_DEFAULT_REPEAT_DELAY 500 +#define SDL_DEFAULT_REPEAT_INTERVAL 30 +/** + * Enable/Disable keyboard repeat. Keyboard repeat defaults to off. + * + * @param[in] delay + * 'delay' is the initial delay in ms between the time when a key is + * pressed, and keyboard repeat begins. + * + * @param[in] interval + * 'interval' is the time in ms between keyboard repeat events. + * + * If 'delay' is set to 0, keyboard repeat is disabled. + */ +extern DECLSPEC int SDLCALL SDL_EnableKeyRepeat(int delay, int interval); +extern DECLSPEC void SDLCALL SDL_GetKeyRepeat(int *delay, int *interval); + +/** + * Get a snapshot of the current state of the keyboard. + * Returns an array of keystates, indexed by the SDLK_* syms. + * Usage: + * @code + * Uint8 *keystate = SDL_GetKeyState(NULL); + * if ( keystate[SDLK_RETURN] ) //... \ is pressed. + * @endcode + */ +extern DECLSPEC Uint8 * SDLCALL SDL_GetKeyState(int *numkeys); + +/** + * Get the current key modifier state + */ +extern DECLSPEC SDLMod SDLCALL SDL_GetModState(void); + +/** + * Set the current key modifier state. + * This does not change the keyboard state, only the key modifier flags. + */ +extern DECLSPEC void SDLCALL SDL_SetModState(SDLMod modstate); + +/** + * Get the name of an SDL virtual keysym + */ +extern DECLSPEC char * SDLCALL SDL_GetKeyName(SDLKey key); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_keyboard_h */ diff --git a/apps/plugins/sdl/include/SDL_keysym.h b/apps/plugins/sdl/include/SDL_keysym.h new file mode 100644 index 0000000..f2ad12b --- /dev/null +++ b/apps/plugins/sdl/include/SDL_keysym.h @@ -0,0 +1,326 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_keysym_h +#define _SDL_keysym_h + +/** What we really want is a mapping of every raw key on the keyboard. + * To support international keyboards, we use the range 0xA1 - 0xFF + * as international virtual keycodes. We'll follow in the footsteps of X11... + * @brief The names of the keys + */ +typedef enum { + /** @name ASCII mapped keysyms + * The keyboard syms have been cleverly chosen to map to ASCII + */ + /*@{*/ + SDLK_UNKNOWN = 0, + SDLK_FIRST = 0, + SDLK_BACKSPACE = 8, + SDLK_TAB = 9, + SDLK_CLEAR = 12, + SDLK_RETURN = 13, + SDLK_PAUSE = 19, + SDLK_ESCAPE = 27, + SDLK_SPACE = 32, + SDLK_EXCLAIM = 33, + SDLK_QUOTEDBL = 34, + SDLK_HASH = 35, + SDLK_DOLLAR = 36, + SDLK_AMPERSAND = 38, + SDLK_QUOTE = 39, + SDLK_LEFTPAREN = 40, + SDLK_RIGHTPAREN = 41, + SDLK_ASTERISK = 42, + SDLK_PLUS = 43, + SDLK_COMMA = 44, + SDLK_MINUS = 45, + SDLK_PERIOD = 46, + SDLK_SLASH = 47, + SDLK_0 = 48, + SDLK_1 = 49, + SDLK_2 = 50, + SDLK_3 = 51, + SDLK_4 = 52, + SDLK_5 = 53, + SDLK_6 = 54, + SDLK_7 = 55, + SDLK_8 = 56, + SDLK_9 = 57, + SDLK_COLON = 58, + SDLK_SEMICOLON = 59, + SDLK_LESS = 60, + SDLK_EQUALS = 61, + SDLK_GREATER = 62, + SDLK_QUESTION = 63, + SDLK_AT = 64, + /* + Skip uppercase letters + */ + SDLK_LEFTBRACKET = 91, + SDLK_BACKSLASH = 92, + SDLK_RIGHTBRACKET = 93, + SDLK_CARET = 94, + SDLK_UNDERSCORE = 95, + SDLK_BACKQUOTE = 96, + SDLK_a = 97, + SDLK_b = 98, + SDLK_c = 99, + SDLK_d = 100, + SDLK_e = 101, + SDLK_f = 102, + SDLK_g = 103, + SDLK_h = 104, + SDLK_i = 105, + SDLK_j = 106, + SDLK_k = 107, + SDLK_l = 108, + SDLK_m = 109, + SDLK_n = 110, + SDLK_o = 111, + SDLK_p = 112, + SDLK_q = 113, + SDLK_r = 114, + SDLK_s = 115, + SDLK_t = 116, + SDLK_u = 117, + SDLK_v = 118, + SDLK_w = 119, + SDLK_x = 120, + SDLK_y = 121, + SDLK_z = 122, + SDLK_DELETE = 127, + /* End of ASCII mapped keysyms */ + /*@}*/ + + /** @name International keyboard syms */ + /*@{*/ + SDLK_WORLD_0 = 160, /* 0xA0 */ + SDLK_WORLD_1 = 161, + SDLK_WORLD_2 = 162, + SDLK_WORLD_3 = 163, + SDLK_WORLD_4 = 164, + SDLK_WORLD_5 = 165, + SDLK_WORLD_6 = 166, + SDLK_WORLD_7 = 167, + SDLK_WORLD_8 = 168, + SDLK_WORLD_9 = 169, + SDLK_WORLD_10 = 170, + SDLK_WORLD_11 = 171, + SDLK_WORLD_12 = 172, + SDLK_WORLD_13 = 173, + SDLK_WORLD_14 = 174, + SDLK_WORLD_15 = 175, + SDLK_WORLD_16 = 176, + SDLK_WORLD_17 = 177, + SDLK_WORLD_18 = 178, + SDLK_WORLD_19 = 179, + SDLK_WORLD_20 = 180, + SDLK_WORLD_21 = 181, + SDLK_WORLD_22 = 182, + SDLK_WORLD_23 = 183, + SDLK_WORLD_24 = 184, + SDLK_WORLD_25 = 185, + SDLK_WORLD_26 = 186, + SDLK_WORLD_27 = 187, + SDLK_WORLD_28 = 188, + SDLK_WORLD_29 = 189, + SDLK_WORLD_30 = 190, + SDLK_WORLD_31 = 191, + SDLK_WORLD_32 = 192, + SDLK_WORLD_33 = 193, + SDLK_WORLD_34 = 194, + SDLK_WORLD_35 = 195, + SDLK_WORLD_36 = 196, + SDLK_WORLD_37 = 197, + SDLK_WORLD_38 = 198, + SDLK_WORLD_39 = 199, + SDLK_WORLD_40 = 200, + SDLK_WORLD_41 = 201, + SDLK_WORLD_42 = 202, + SDLK_WORLD_43 = 203, + SDLK_WORLD_44 = 204, + SDLK_WORLD_45 = 205, + SDLK_WORLD_46 = 206, + SDLK_WORLD_47 = 207, + SDLK_WORLD_48 = 208, + SDLK_WORLD_49 = 209, + SDLK_WORLD_50 = 210, + SDLK_WORLD_51 = 211, + SDLK_WORLD_52 = 212, + SDLK_WORLD_53 = 213, + SDLK_WORLD_54 = 214, + SDLK_WORLD_55 = 215, + SDLK_WORLD_56 = 216, + SDLK_WORLD_57 = 217, + SDLK_WORLD_58 = 218, + SDLK_WORLD_59 = 219, + SDLK_WORLD_60 = 220, + SDLK_WORLD_61 = 221, + SDLK_WORLD_62 = 222, + SDLK_WORLD_63 = 223, + SDLK_WORLD_64 = 224, + SDLK_WORLD_65 = 225, + SDLK_WORLD_66 = 226, + SDLK_WORLD_67 = 227, + SDLK_WORLD_68 = 228, + SDLK_WORLD_69 = 229, + SDLK_WORLD_70 = 230, + SDLK_WORLD_71 = 231, + SDLK_WORLD_72 = 232, + SDLK_WORLD_73 = 233, + SDLK_WORLD_74 = 234, + SDLK_WORLD_75 = 235, + SDLK_WORLD_76 = 236, + SDLK_WORLD_77 = 237, + SDLK_WORLD_78 = 238, + SDLK_WORLD_79 = 239, + SDLK_WORLD_80 = 240, + SDLK_WORLD_81 = 241, + SDLK_WORLD_82 = 242, + SDLK_WORLD_83 = 243, + SDLK_WORLD_84 = 244, + SDLK_WORLD_85 = 245, + SDLK_WORLD_86 = 246, + SDLK_WORLD_87 = 247, + SDLK_WORLD_88 = 248, + SDLK_WORLD_89 = 249, + SDLK_WORLD_90 = 250, + SDLK_WORLD_91 = 251, + SDLK_WORLD_92 = 252, + SDLK_WORLD_93 = 253, + SDLK_WORLD_94 = 254, + SDLK_WORLD_95 = 255, /* 0xFF */ + /*@}*/ + + /** @name Numeric keypad */ + /*@{*/ + SDLK_KP0 = 256, + SDLK_KP1 = 257, + SDLK_KP2 = 258, + SDLK_KP3 = 259, + SDLK_KP4 = 260, + SDLK_KP5 = 261, + SDLK_KP6 = 262, + SDLK_KP7 = 263, + SDLK_KP8 = 264, + SDLK_KP9 = 265, + SDLK_KP_PERIOD = 266, + SDLK_KP_DIVIDE = 267, + SDLK_KP_MULTIPLY = 268, + SDLK_KP_MINUS = 269, + SDLK_KP_PLUS = 270, + SDLK_KP_ENTER = 271, + SDLK_KP_EQUALS = 272, + /*@}*/ + + /** @name Arrows + Home/End pad */ + /*@{*/ + SDLK_UP = 273, + SDLK_DOWN = 274, + SDLK_RIGHT = 275, + SDLK_LEFT = 276, + SDLK_INSERT = 277, + SDLK_HOME = 278, + SDLK_END = 279, + SDLK_PAGEUP = 280, + SDLK_PAGEDOWN = 281, + /*@}*/ + + /** @name Function keys */ + /*@{*/ + SDLK_F1 = 282, + SDLK_F2 = 283, + SDLK_F3 = 284, + SDLK_F4 = 285, + SDLK_F5 = 286, + SDLK_F6 = 287, + SDLK_F7 = 288, + SDLK_F8 = 289, + SDLK_F9 = 290, + SDLK_F10 = 291, + SDLK_F11 = 292, + SDLK_F12 = 293, + SDLK_F13 = 294, + SDLK_F14 = 295, + SDLK_F15 = 296, + /*@}*/ + + /** @name Key state modifier keys */ + /*@{*/ + SDLK_NUMLOCK = 300, + SDLK_CAPSLOCK = 301, + SDLK_SCROLLOCK = 302, + SDLK_RSHIFT = 303, + SDLK_LSHIFT = 304, + SDLK_RCTRL = 305, + SDLK_LCTRL = 306, + SDLK_RALT = 307, + SDLK_LALT = 308, + SDLK_RMETA = 309, + SDLK_LMETA = 310, + SDLK_LSUPER = 311, /**< Left "Windows" key */ + SDLK_RSUPER = 312, /**< Right "Windows" key */ + SDLK_MODE = 313, /**< "Alt Gr" key */ + SDLK_COMPOSE = 314, /**< Multi-key compose key */ + /*@}*/ + + /** @name Miscellaneous function keys */ + /*@{*/ + SDLK_HELP = 315, + SDLK_PRINT = 316, + SDLK_SYSREQ = 317, + SDLK_BREAK = 318, + SDLK_MENU = 319, + SDLK_POWER = 320, /**< Power Macintosh power key */ + SDLK_EURO = 321, /**< Some european keyboards */ + SDLK_UNDO = 322, /**< Atari keyboard has Undo */ + /*@}*/ + + /* Add any other keys here */ + + SDLK_LAST +} SDLKey; + +/** Enumeration of valid key mods (possibly OR'd together) */ +typedef enum { + KMOD_NONE = 0x0000, + KMOD_LSHIFT= 0x0001, + KMOD_RSHIFT= 0x0002, + KMOD_LCTRL = 0x0040, + KMOD_RCTRL = 0x0080, + KMOD_LALT = 0x0100, + KMOD_RALT = 0x0200, + KMOD_LMETA = 0x0400, + KMOD_RMETA = 0x0800, + KMOD_NUM = 0x1000, + KMOD_CAPS = 0x2000, + KMOD_MODE = 0x4000, + KMOD_RESERVED = 0x8000 +} SDLMod; + +#define KMOD_CTRL (KMOD_LCTRL|KMOD_RCTRL) +#define KMOD_SHIFT (KMOD_LSHIFT|KMOD_RSHIFT) +#define KMOD_ALT (KMOD_LALT|KMOD_RALT) +#define KMOD_META (KMOD_LMETA|KMOD_RMETA) + +#endif /* _SDL_keysym_h */ diff --git a/apps/plugins/sdl/include/SDL_loadso.h b/apps/plugins/sdl/include/SDL_loadso.h new file mode 100644 index 0000000..0c5e536 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_loadso.h @@ -0,0 +1,78 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_loadso.h + * System dependent library loading routines + */ + +/** @file SDL_loadso.h + * Some things to keep in mind: + * - These functions only work on C function names. Other languages may + * have name mangling and intrinsic language support that varies from + * compiler to compiler. + * - Make sure you declare your function pointers with the same calling + * convention as the actual library function. Your code will crash + * mysteriously if you do not do this. + * - Avoid namespace collisions. If you load a symbol from the library, + * it is not defined whether or not it goes into the global symbol + * namespace for the application. If it does and it conflicts with + * symbols in your code or other shared libraries, you will not get + * the results you expect. :) + */ + + +#ifndef _SDL_loadso_h +#define _SDL_loadso_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** + * This function dynamically loads a shared object and returns a pointer + * to the object handle (or NULL if there was an error). + * The 'sofile' parameter is a system dependent name of the object file. + */ +extern DECLSPEC void * SDLCALL SDL_LoadObject(const char *sofile); + +/** + * Given an object handle, this function looks up the address of the + * named function in the shared object and returns it. This address + * is no longer valid after calling SDL_UnloadObject(). + */ +extern DECLSPEC void * SDLCALL SDL_LoadFunction(void *handle, const char *name); + +/** Unload a shared object from memory */ +extern DECLSPEC void SDLCALL SDL_UnloadObject(void *handle); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_loadso_h */ diff --git a/apps/plugins/sdl/include/SDL_main.h b/apps/plugins/sdl/include/SDL_main.h new file mode 100644 index 0000000..ab50ef1 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_main.h @@ -0,0 +1,106 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_main_h +#define _SDL_main_h + +#include "SDL_stdinc.h" + +/** @file SDL_main.h + * Redefine main() on Win32 and MacOS so that it is called by winmain.c + */ + +#if defined(__WIN32__) || \ + (defined(__MWERKS__) && !defined(__BEOS__)) || \ + defined(__MACOS__) || defined(__MACOSX__) || \ + defined(__SYMBIAN32__) || defined(QWS) + +#ifdef __cplusplus +#define C_LINKAGE "C" +#else +#define C_LINKAGE +#endif /* __cplusplus */ + +/** The application's main() function must be called with C linkage, + * and should be declared like this: + * @code + * #ifdef __cplusplus + * extern "C" + * #endif + * int main(int argc, char *argv[]) + * { + * } + * @endcode + */ +#define main SDL_main + +/** The prototype for the application's main() function */ +extern C_LINKAGE int SDL_main(int argc, char *argv[]); + + +/** @name From the SDL library code -- needed for registering the app on Win32 */ +/*@{*/ +#ifdef __WIN32__ + +#include "begin_code.h" +#ifdef __cplusplus +extern "C" { +#endif + +/** This should be called from your WinMain() function, if any */ +extern DECLSPEC void SDLCALL SDL_SetModuleHandle(void *hInst); +/** This can also be called, but is no longer necessary */ +extern DECLSPEC int SDLCALL SDL_RegisterApp(char *name, Uint32 style, void *hInst); +/** This can also be called, but is no longer necessary (SDL_Quit calls it) */ +extern DECLSPEC void SDLCALL SDL_UnregisterApp(void); +#ifdef __cplusplus +} +#endif +#include "close_code.h" +#endif +/*@}*/ + +/** @name From the SDL library code -- needed for registering QuickDraw on MacOS */ +/*@{*/ +#if defined(__MACOS__) + +#include "begin_code.h" +#ifdef __cplusplus +extern "C" { +#endif + +/** Forward declaration so we don't need to include QuickDraw.h */ +struct QDGlobals; + +/** This should be called from your main() function, if any */ +extern DECLSPEC void SDLCALL SDL_InitQuickDraw(struct QDGlobals *the_qd); + +#ifdef __cplusplus +} +#endif +#include "close_code.h" +#endif +/*@}*/ + +#endif /* Need to redefine main()? */ + +#endif /* _SDL_main_h */ diff --git a/apps/plugins/sdl/include/SDL_mixer.h b/apps/plugins/sdl/include/SDL_mixer.h new file mode 100644 index 0000000..9c25ef6 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_mixer.h @@ -0,0 +1,634 @@ +/* + SDL_mixer: An audio mixer library based on the SDL library + Copyright (C) 1997-2012 Sam Lantinga + + This software is provided 'as-is', without any express or implied + warranty. In no event will the authors be held liable for any damages + arising from the use of this software. + + Permission is granted to anyone to use this software for any purpose, + including commercial applications, and to alter it and redistribute it + freely, subject to the following restrictions: + + 1. The origin of this software must not be misrepresented; you must not + claim that you wrote the original software. If you use this software + in a product, an acknowledgment in the product documentation would be + appreciated but is not required. + 2. Altered source versions must be plainly marked as such, and must not be + misrepresented as being the original software. + 3. This notice may not be removed or altered from any source distribution. +*/ + +/* $Id$ */ + +#ifndef _SDL_MIXER_H +#define _SDL_MIXER_H + +#include "SDL_types.h" +#include "SDL_rwops.h" +#include "SDL_audio.h" +#include "SDL_endian.h" +#include "SDL_version.h" +#include "begin_code.h" + +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/* Printable format: "%d.%d.%d", MAJOR, MINOR, PATCHLEVEL +*/ +#define SDL_MIXER_MAJOR_VERSION 1 +#define SDL_MIXER_MINOR_VERSION 2 +#define SDL_MIXER_PATCHLEVEL 12 + +/* This macro can be used to fill a version structure with the compile-time + * version of the SDL_mixer library. + */ +#define SDL_MIXER_VERSION(X) \ +{ \ + (X)->major = SDL_MIXER_MAJOR_VERSION; \ + (X)->minor = SDL_MIXER_MINOR_VERSION; \ + (X)->patch = SDL_MIXER_PATCHLEVEL; \ +} + +/* Backwards compatibility */ +#define MIX_MAJOR_VERSION SDL_MIXER_MAJOR_VERSION +#define MIX_MINOR_VERSION SDL_MIXER_MINOR_VERSION +#define MIX_PATCHLEVEL SDL_MIXER_PATCHLEVEL +#define MIX_VERSION(X) SDL_MIXER_VERSION(X) + +/* This function gets the version of the dynamically linked SDL_mixer library. + it should NOT be used to fill a version structure, instead you should + use the SDL_MIXER_VERSION() macro. + */ +extern DECLSPEC const SDL_version * SDLCALL Mix_Linked_Version(void); + +typedef enum +{ + MIX_INIT_FLAC = 0x00000001, + MIX_INIT_MOD = 0x00000002, + MIX_INIT_MP3 = 0x00000004, + MIX_INIT_OGG = 0x00000008, + MIX_INIT_FLUIDSYNTH = 0x00000010 +} MIX_InitFlags; + +/* Loads dynamic libraries and prepares them for use. Flags should be + one or more flags from MIX_InitFlags OR'd together. + It returns the flags successfully initialized, or 0 on failure. + */ +extern DECLSPEC int SDLCALL Mix_Init(int flags); + +/* Unloads libraries loaded with Mix_Init */ +extern DECLSPEC void SDLCALL Mix_Quit(void); + + +/* The default mixer has 8 simultaneous mixing channels */ +#ifndef MIX_CHANNELS +#define MIX_CHANNELS 8 +#endif + +/* Good default values for a PC soundcard */ +#define MIX_DEFAULT_FREQUENCY 22050 +#if SDL_BYTEORDER == SDL_LIL_ENDIAN +#define MIX_DEFAULT_FORMAT AUDIO_S16LSB +#else +#define MIX_DEFAULT_FORMAT AUDIO_S16MSB +#endif +#define MIX_DEFAULT_CHANNELS 2 +#define MIX_MAX_VOLUME 128 /* Volume of a chunk */ + +/* The internal format for an audio chunk */ +typedef struct Mix_Chunk { + int allocated; + Uint8 *abuf; + Uint32 alen; + Uint8 volume; /* Per-sample volume, 0-128 */ +} Mix_Chunk; + +/* The different fading types supported */ +typedef enum { + MIX_NO_FADING, + MIX_FADING_OUT, + MIX_FADING_IN +} Mix_Fading; + +typedef enum { + MUS_NONE, + MUS_CMD, + MUS_WAV, + MUS_MOD, + MUS_MID, + MUS_OGG, + MUS_MP3, + MUS_MP3_MAD, + MUS_FLAC, + MUS_MODPLUG +} Mix_MusicType; + +/* The internal format for a music chunk interpreted via mikmod */ +typedef struct _Mix_Music Mix_Music; + +/* Open the mixer with a certain audio format */ +extern DECLSPEC int SDLCALL Mix_OpenAudio(int frequency, Uint16 format, int channels, + int chunksize); + +/* Dynamically change the number of channels managed by the mixer. + If decreasing the number of channels, the upper channels are + stopped. + This function returns the new number of allocated channels. + */ +extern DECLSPEC int SDLCALL Mix_AllocateChannels(int numchans); + +/* Find out what the actual audio device parameters are. + This function returns 1 if the audio has been opened, 0 otherwise. + */ +extern DECLSPEC int SDLCALL Mix_QuerySpec(int *frequency,Uint16 *format,int *channels); + +/* Load a wave file or a music (.mod .s3m .it .xm) file */ +extern DECLSPEC Mix_Chunk * SDLCALL Mix_LoadWAV_RW(SDL_RWops *src, int freesrc); +#define Mix_LoadWAV(file) Mix_LoadWAV_RW(SDL_RWFromFile(file, "rb"), 1) +extern DECLSPEC Mix_Music * SDLCALL Mix_LoadMUS(const char *file); + +/* Load a music file from an SDL_RWop object (Ogg and MikMod specific currently) + Matt Campbell (matt@campbellhome.dhs.org) April 2000 */ +extern DECLSPEC Mix_Music * SDLCALL Mix_LoadMUS_RW(SDL_RWops *rw); + +/* Load a music file from an SDL_RWop object assuming a specific format */ +extern DECLSPEC Mix_Music * SDLCALL Mix_LoadMUSType_RW(SDL_RWops *rw, Mix_MusicType type, int freesrc); + +/* Load a wave file of the mixer format from a memory buffer */ +extern DECLSPEC Mix_Chunk * SDLCALL Mix_QuickLoad_WAV(Uint8 *mem); + +/* Load raw audio data of the mixer format from a memory buffer */ +extern DECLSPEC Mix_Chunk * SDLCALL Mix_QuickLoad_RAW(Uint8 *mem, Uint32 len); + +/* Free an audio chunk previously loaded */ +extern DECLSPEC void SDLCALL Mix_FreeChunk(Mix_Chunk *chunk); +extern DECLSPEC void SDLCALL Mix_FreeMusic(Mix_Music *music); + +/* Get a list of chunk/music decoders that this build of SDL_mixer provides. + This list can change between builds AND runs of the program, if external + libraries that add functionality become available. + You must successfully call Mix_OpenAudio() before calling these functions. + This API is only available in SDL_mixer 1.2.9 and later. + + // usage... + int i; + const int total = Mix_GetNumChunkDecoders(); + for (i = 0; i < total; i++) + printf("Supported chunk decoder: [%s]\n", Mix_GetChunkDecoder(i)); + + Appearing in this list doesn't promise your specific audio file will + decode...but it's handy to know if you have, say, a functioning Timidity + install. + + These return values are static, read-only data; do not modify or free it. + The pointers remain valid until you call Mix_CloseAudio(). +*/ +extern DECLSPEC int SDLCALL Mix_GetNumChunkDecoders(void); +extern DECLSPEC const char * SDLCALL Mix_GetChunkDecoder(int index); +extern DECLSPEC int SDLCALL Mix_GetNumMusicDecoders(void); +extern DECLSPEC const char * SDLCALL Mix_GetMusicDecoder(int index); + +/* Find out the music format of a mixer music, or the currently playing + music, if 'music' is NULL. +*/ +extern DECLSPEC Mix_MusicType SDLCALL Mix_GetMusicType(const Mix_Music *music); + +/* Set a function that is called after all mixing is performed. + This can be used to provide real-time visual display of the audio stream + or add a custom mixer filter for the stream data. +*/ +extern DECLSPEC void SDLCALL Mix_SetPostMix(void (*mix_func) + (void *udata, Uint8 *stream, int len), void *arg); + +/* Add your own music player or additional mixer function. + If 'mix_func' is NULL, the default music player is re-enabled. + */ +extern DECLSPEC void SDLCALL Mix_HookMusic(void (*mix_func) + (void *udata, Uint8 *stream, int len), void *arg); + +/* Add your own callback when the music has finished playing. + This callback is only called if the music finishes naturally. + */ +extern DECLSPEC void SDLCALL Mix_HookMusicFinished(void (*music_finished)(void)); + +/* Get a pointer to the user data for the current music hook */ +extern DECLSPEC void * SDLCALL Mix_GetMusicHookData(void); + +/* + * Add your own callback when a channel has finished playing. NULL + * to disable callback. The callback may be called from the mixer's audio + * callback or it could be called as a result of Mix_HaltChannel(), etc. + * do not call SDL_LockAudio() from this callback; you will either be + * inside the audio callback, or SDL_mixer will explicitly lock the audio + * before calling your callback. + */ +extern DECLSPEC void SDLCALL Mix_ChannelFinished(void (*channel_finished)(int channel)); + + +/* Special Effects API by ryan c. gordon. (icculus@icculus.org) */ + +#define MIX_CHANNEL_POST -2 + +/* This is the format of a special effect callback: + * + * myeffect(int chan, void *stream, int len, void *udata); + * + * (chan) is the channel number that your effect is affecting. (stream) is + * the buffer of data to work upon. (len) is the size of (stream), and + * (udata) is a user-defined bit of data, which you pass as the last arg of + * Mix_RegisterEffect(), and is passed back unmolested to your callback. + * Your effect changes the contents of (stream) based on whatever parameters + * are significant, or just leaves it be, if you prefer. You can do whatever + * you like to the buffer, though, and it will continue in its changed state + * down the mixing pipeline, through any other effect functions, then finally + * to be mixed with the rest of the channels and music for the final output + * stream. + * + * DO NOT EVER call SDL_LockAudio() from your callback function! + */ +typedef void (*Mix_EffectFunc_t)(int chan, void *stream, int len, void *udata); + +/* + * This is a callback that signifies that a channel has finished all its + * loops and has completed playback. This gets called if the buffer + * plays out normally, or if you call Mix_HaltChannel(), implicitly stop + * a channel via Mix_AllocateChannels(), or unregister a callback while + * it's still playing. + * + * DO NOT EVER call SDL_LockAudio() from your callback function! + */ +typedef void (*Mix_EffectDone_t)(int chan, void *udata); + + +/* Register a special effect function. At mixing time, the channel data is + * copied into a buffer and passed through each registered effect function. + * After it passes through all the functions, it is mixed into the final + * output stream. The copy to buffer is performed once, then each effect + * function performs on the output of the previous effect. Understand that + * this extra copy to a buffer is not performed if there are no effects + * registered for a given chunk, which saves CPU cycles, and any given + * effect will be extra cycles, too, so it is crucial that your code run + * fast. Also note that the data that your function is given is in the + * format of the sound device, and not the format you gave to Mix_OpenAudio(), + * although they may in reality be the same. This is an unfortunate but + * necessary speed concern. Use Mix_QuerySpec() to determine if you can + * handle the data before you register your effect, and take appropriate + * actions. + * You may also specify a callback (Mix_EffectDone_t) that is called when + * the channel finishes playing. This gives you a more fine-grained control + * than Mix_ChannelFinished(), in case you need to free effect-specific + * resources, etc. If you don't need this, you can specify NULL. + * You may set the callbacks before or after calling Mix_PlayChannel(). + * Things like Mix_SetPanning() are just internal special effect functions, + * so if you are using that, you've already incurred the overhead of a copy + * to a separate buffer, and that these effects will be in the queue with + * any functions you've registered. The list of registered effects for a + * channel is reset when a chunk finishes playing, so you need to explicitly + * set them with each call to Mix_PlayChannel*(). + * You may also register a special effect function that is to be run after + * final mixing occurs. The rules for these callbacks are identical to those + * in Mix_RegisterEffect, but they are run after all the channels and the + * music have been mixed into a single stream, whereas channel-specific + * effects run on a given channel before any other mixing occurs. These + * global effect callbacks are call "posteffects". Posteffects only have + * their Mix_EffectDone_t function called when they are unregistered (since + * the main output stream is never "done" in the same sense as a channel). + * You must unregister them manually when you've had enough. Your callback + * will be told that the channel being mixed is (MIX_CHANNEL_POST) if the + * processing is considered a posteffect. + * + * After all these effects have finished processing, the callback registered + * through Mix_SetPostMix() runs, and then the stream goes to the audio + * device. + * + * DO NOT EVER call SDL_LockAudio() from your callback function! + * + * returns zero if error (no such channel), nonzero if added. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_RegisterEffect(int chan, Mix_EffectFunc_t f, + Mix_EffectDone_t d, void *arg); + + +/* You may not need to call this explicitly, unless you need to stop an + * effect from processing in the middle of a chunk's playback. + * Posteffects are never implicitly unregistered as they are for channels, + * but they may be explicitly unregistered through this function by + * specifying MIX_CHANNEL_POST for a channel. + * returns zero if error (no such channel or effect), nonzero if removed. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_UnregisterEffect(int channel, Mix_EffectFunc_t f); + + +/* You may not need to call this explicitly, unless you need to stop all + * effects from processing in the middle of a chunk's playback. Note that + * this will also shut off some internal effect processing, since + * Mix_SetPanning() and others may use this API under the hood. This is + * called internally when a channel completes playback. + * Posteffects are never implicitly unregistered as they are for channels, + * but they may be explicitly unregistered through this function by + * specifying MIX_CHANNEL_POST for a channel. + * returns zero if error (no such channel), nonzero if all effects removed. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_UnregisterAllEffects(int channel); + + +#define MIX_EFFECTSMAXSPEED "MIX_EFFECTSMAXSPEED" + +/* + * These are the internally-defined mixing effects. They use the same API that + * effects defined in the application use, but are provided here as a + * convenience. Some effects can reduce their quality or use more memory in + * the name of speed; to enable this, make sure the environment variable + * MIX_EFFECTSMAXSPEED (see above) is defined before you call + * Mix_OpenAudio(). + */ + + +/* Set the panning of a channel. The left and right channels are specified + * as integers between 0 and 255, quietest to loudest, respectively. + * + * Technically, this is just individual volume control for a sample with + * two (stereo) channels, so it can be used for more than just panning. + * If you want real panning, call it like this: + * + * Mix_SetPanning(channel, left, 255 - left); + * + * ...which isn't so hard. + * + * Setting (channel) to MIX_CHANNEL_POST registers this as a posteffect, and + * the panning will be done to the final mixed stream before passing it on + * to the audio device. + * + * This uses the Mix_RegisterEffect() API internally, and returns without + * registering the effect function if the audio device is not configured + * for stereo output. Setting both (left) and (right) to 255 causes this + * effect to be unregistered, since that is the data's normal state. + * + * returns zero if error (no such channel or Mix_RegisterEffect() fails), + * nonzero if panning effect enabled. Note that an audio device in mono + * mode is a no-op, but this call will return successful in that case. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_SetPanning(int channel, Uint8 left, Uint8 right); + + +/* Set the position of a channel. (angle) is an integer from 0 to 360, that + * specifies the location of the sound in relation to the listener. (angle) + * will be reduced as neccesary (540 becomes 180 degrees, -100 becomes 260). + * Angle 0 is due north, and rotates clockwise as the value increases. + * For efficiency, the precision of this effect may be limited (angles 1 + * through 7 might all produce the same effect, 8 through 15 are equal, etc). + * (distance) is an integer between 0 and 255 that specifies the space + * between the sound and the listener. The larger the number, the further + * away the sound is. Using 255 does not guarantee that the channel will be + * culled from the mixing process or be completely silent. For efficiency, + * the precision of this effect may be limited (distance 0 through 5 might + * all produce the same effect, 6 through 10 are equal, etc). Setting (angle) + * and (distance) to 0 unregisters this effect, since the data would be + * unchanged. + * + * If you need more precise positional audio, consider using OpenAL for + * spatialized effects instead of SDL_mixer. This is only meant to be a + * basic effect for simple "3D" games. + * + * If the audio device is configured for mono output, then you won't get + * any effectiveness from the angle; however, distance attenuation on the + * channel will still occur. While this effect will function with stereo + * voices, it makes more sense to use voices with only one channel of sound, + * so when they are mixed through this effect, the positioning will sound + * correct. You can convert them to mono through SDL before giving them to + * the mixer in the first place if you like. + * + * Setting (channel) to MIX_CHANNEL_POST registers this as a posteffect, and + * the positioning will be done to the final mixed stream before passing it + * on to the audio device. + * + * This is a convenience wrapper over Mix_SetDistance() and Mix_SetPanning(). + * + * returns zero if error (no such channel or Mix_RegisterEffect() fails), + * nonzero if position effect is enabled. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_SetPosition(int channel, Sint16 angle, Uint8 distance); + + +/* Set the "distance" of a channel. (distance) is an integer from 0 to 255 + * that specifies the location of the sound in relation to the listener. + * Distance 0 is overlapping the listener, and 255 is as far away as possible + * A distance of 255 does not guarantee silence; in such a case, you might + * want to try changing the chunk's volume, or just cull the sample from the + * mixing process with Mix_HaltChannel(). + * For efficiency, the precision of this effect may be limited (distances 1 + * through 7 might all produce the same effect, 8 through 15 are equal, etc). + * (distance) is an integer between 0 and 255 that specifies the space + * between the sound and the listener. The larger the number, the further + * away the sound is. + * Setting (distance) to 0 unregisters this effect, since the data would be + * unchanged. + * If you need more precise positional audio, consider using OpenAL for + * spatialized effects instead of SDL_mixer. This is only meant to be a + * basic effect for simple "3D" games. + * + * Setting (channel) to MIX_CHANNEL_POST registers this as a posteffect, and + * the distance attenuation will be done to the final mixed stream before + * passing it on to the audio device. + * + * This uses the Mix_RegisterEffect() API internally. + * + * returns zero if error (no such channel or Mix_RegisterEffect() fails), + * nonzero if position effect is enabled. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_SetDistance(int channel, Uint8 distance); + + +/* + * !!! FIXME : Haven't implemented, since the effect goes past the + * end of the sound buffer. Will have to think about this. + * --ryan. + */ +#if 0 +/* Causes an echo effect to be mixed into a sound. (echo) is the amount + * of echo to mix. 0 is no echo, 255 is infinite (and probably not + * what you want). + * + * Setting (channel) to MIX_CHANNEL_POST registers this as a posteffect, and + * the reverbing will be done to the final mixed stream before passing it on + * to the audio device. + * + * This uses the Mix_RegisterEffect() API internally. If you specify an echo + * of zero, the effect is unregistered, as the data is already in that state. + * + * returns zero if error (no such channel or Mix_RegisterEffect() fails), + * nonzero if reversing effect is enabled. + * Error messages can be retrieved from Mix_GetError(). + */ +extern no_parse_DECLSPEC int SDLCALL Mix_SetReverb(int channel, Uint8 echo); +#endif + +/* Causes a channel to reverse its stereo. This is handy if the user has his + * speakers hooked up backwards, or you would like to have a minor bit of + * psychedelia in your sound code. :) Calling this function with (flip) + * set to non-zero reverses the chunks's usual channels. If (flip) is zero, + * the effect is unregistered. + * + * This uses the Mix_RegisterEffect() API internally, and thus is probably + * more CPU intensive than having the user just plug in his speakers + * correctly. Mix_SetReverseStereo() returns without registering the effect + * function if the audio device is not configured for stereo output. + * + * If you specify MIX_CHANNEL_POST for (channel), then this the effect is used + * on the final mixed stream before sending it on to the audio device (a + * posteffect). + * + * returns zero if error (no such channel or Mix_RegisterEffect() fails), + * nonzero if reversing effect is enabled. Note that an audio device in mono + * mode is a no-op, but this call will return successful in that case. + * Error messages can be retrieved from Mix_GetError(). + */ +extern DECLSPEC int SDLCALL Mix_SetReverseStereo(int channel, int flip); + +/* end of effects API. --ryan. */ + + +/* Reserve the first channels (0 -> n-1) for the application, i.e. don't allocate + them dynamically to the next sample if requested with a -1 value below. + Returns the number of reserved channels. + */ +extern DECLSPEC int SDLCALL Mix_ReserveChannels(int num); + +/* Channel grouping functions */ + +/* Attach a tag to a channel. A tag can be assigned to several mixer + channels, to form groups of channels. + If 'tag' is -1, the tag is removed (actually -1 is the tag used to + represent the group of all the channels). + Returns true if everything was OK. + */ +extern DECLSPEC int SDLCALL Mix_GroupChannel(int which, int tag); +/* Assign several consecutive channels to a group */ +extern DECLSPEC int SDLCALL Mix_GroupChannels(int from, int to, int tag); +/* Finds the first available channel in a group of channels, + returning -1 if none are available. + */ +extern DECLSPEC int SDLCALL Mix_GroupAvailable(int tag); +/* Returns the number of channels in a group. This is also a subtle + way to get the total number of channels when 'tag' is -1 + */ +extern DECLSPEC int SDLCALL Mix_GroupCount(int tag); +/* Finds the "oldest" sample playing in a group of channels */ +extern DECLSPEC int SDLCALL Mix_GroupOldest(int tag); +/* Finds the "most recent" (i.e. last) sample playing in a group of channels */ +extern DECLSPEC int SDLCALL Mix_GroupNewer(int tag); + +/* Play an audio chunk on a specific channel. + If the specified channel is -1, play on the first free channel. + If 'loops' is greater than zero, loop the sound that many times. + If 'loops' is -1, loop inifinitely (~65000 times). + Returns which channel was used to play the sound. +*/ +#define Mix_PlayChannel(channel,chunk,loops) Mix_PlayChannelTimed(channel,chunk,loops,-1) +/* The same as above, but the sound is played at most 'ticks' milliseconds */ +extern DECLSPEC int SDLCALL Mix_PlayChannelTimed(int channel, Mix_Chunk *chunk, int loops, int ticks); +extern DECLSPEC int SDLCALL Mix_PlayMusic(Mix_Music *music, int loops); + +/* Fade in music or a channel over "ms" milliseconds, same semantics as the "Play" functions */ +extern DECLSPEC int SDLCALL Mix_FadeInMusic(Mix_Music *music, int loops, int ms); +extern DECLSPEC int SDLCALL Mix_FadeInMusicPos(Mix_Music *music, int loops, int ms, double position); +#define Mix_FadeInChannel(channel,chunk,loops,ms) Mix_FadeInChannelTimed(channel,chunk,loops,ms,-1) +extern DECLSPEC int SDLCALL Mix_FadeInChannelTimed(int channel, Mix_Chunk *chunk, int loops, int ms, int ticks); + +/* Set the volume in the range of 0-128 of a specific channel or chunk. + If the specified channel is -1, set volume for all channels. + Returns the original volume. + If the specified volume is -1, just return the current volume. +*/ +extern DECLSPEC int SDLCALL Mix_Volume(int channel, int volume); +extern DECLSPEC int SDLCALL Mix_VolumeChunk(Mix_Chunk *chunk, int volume); +extern DECLSPEC int SDLCALL Mix_VolumeMusic(int volume); + +/* Halt playing of a particular channel */ +extern DECLSPEC int SDLCALL Mix_HaltChannel(int channel); +extern DECLSPEC int SDLCALL Mix_HaltGroup(int tag); +extern DECLSPEC int SDLCALL Mix_HaltMusic(void); + +/* Change the expiration delay for a particular channel. + The sample will stop playing after the 'ticks' milliseconds have elapsed, + or remove the expiration if 'ticks' is -1 +*/ +extern DECLSPEC int SDLCALL Mix_ExpireChannel(int channel, int ticks); + +/* Halt a channel, fading it out progressively till it's silent + The ms parameter indicates the number of milliseconds the fading + will take. + */ +extern DECLSPEC int SDLCALL Mix_FadeOutChannel(int which, int ms); +extern DECLSPEC int SDLCALL Mix_FadeOutGroup(int tag, int ms); +extern DECLSPEC int SDLCALL Mix_FadeOutMusic(int ms); + +/* Query the fading status of a channel */ +extern DECLSPEC Mix_Fading SDLCALL Mix_FadingMusic(void); +extern DECLSPEC Mix_Fading SDLCALL Mix_FadingChannel(int which); + +/* Pause/Resume a particular channel */ +extern DECLSPEC void SDLCALL Mix_Pause(int channel); +extern DECLSPEC void SDLCALL Mix_Resume(int channel); +extern DECLSPEC int SDLCALL Mix_Paused(int channel); + +/* Pause/Resume the music stream */ +extern DECLSPEC void SDLCALL Mix_PauseMusic(void); +extern DECLSPEC void SDLCALL Mix_ResumeMusic(void); +extern DECLSPEC void SDLCALL Mix_RewindMusic(void); +extern DECLSPEC int SDLCALL Mix_PausedMusic(void); + +/* Set the current position in the music stream. + This returns 0 if successful, or -1 if it failed or isn't implemented. + This function is only implemented for MOD music formats (set pattern + order number) and for OGG, FLAC, MP3_MAD, and MODPLUG music (set + position in seconds), at the moment. +*/ +extern DECLSPEC int SDLCALL Mix_SetMusicPosition(double position); + +/* Check the status of a specific channel. + If the specified channel is -1, check all channels. +*/ +extern DECLSPEC int SDLCALL Mix_Playing(int channel); +extern DECLSPEC int SDLCALL Mix_PlayingMusic(void); + +/* Stop music and set external music playback command */ +extern DECLSPEC int SDLCALL Mix_SetMusicCMD(const char *command); + +/* Synchro value is set by MikMod from modules while playing */ +extern DECLSPEC int SDLCALL Mix_SetSynchroValue(int value); +extern DECLSPEC int SDLCALL Mix_GetSynchroValue(void); + +/* Set/Get/Iterate SoundFonts paths to use by supported MIDI backends */ +extern DECLSPEC int SDLCALL Mix_SetSoundFonts(const char *paths); +extern DECLSPEC const char* SDLCALL Mix_GetSoundFonts(void); +extern DECLSPEC int SDLCALL Mix_EachSoundFont(int (*function)(const char*, void*), void *data); + +/* Get the Mix_Chunk currently associated with a mixer channel + Returns NULL if it's an invalid channel, or there's no chunk associated. +*/ +extern DECLSPEC Mix_Chunk * SDLCALL Mix_GetChunk(int channel); + +/* Close the mixer, halting all playing audio */ +extern DECLSPEC void SDLCALL Mix_CloseAudio(void); + +/* We'll use SDL for reporting errors */ +#define Mix_SetError SDL_SetError +#define Mix_GetError SDL_GetError + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_MIXER_H */ diff --git a/apps/plugins/sdl/include/SDL_mouse.h b/apps/plugins/sdl/include/SDL_mouse.h new file mode 100644 index 0000000..7c563b9 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_mouse.h @@ -0,0 +1,143 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_mouse.h + * Include file for SDL mouse event handling + */ + +#ifndef _SDL_mouse_h +#define _SDL_mouse_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" +#include "SDL_video.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +typedef struct WMcursor WMcursor; /**< Implementation dependent */ +typedef struct SDL_Cursor { + SDL_Rect area; /**< The area of the mouse cursor */ + Sint16 hot_x, hot_y; /**< The "tip" of the cursor */ + Uint8 *data; /**< B/W cursor data */ + Uint8 *mask; /**< B/W cursor mask */ + Uint8 *save[2]; /**< Place to save cursor area */ + WMcursor *wm_cursor; /**< Window-manager cursor */ +} SDL_Cursor; + +/* Function prototypes */ +/** + * Retrieve the current state of the mouse. + * The current button state is returned as a button bitmask, which can + * be tested using the SDL_BUTTON(X) macros, and x and y are set to the + * current mouse cursor position. You can pass NULL for either x or y. + */ +extern DECLSPEC Uint8 SDLCALL SDL_GetMouseState(int *x, int *y); + +/** + * Retrieve the current state of the mouse. + * The current button state is returned as a button bitmask, which can + * be tested using the SDL_BUTTON(X) macros, and x and y are set to the + * mouse deltas since the last call to SDL_GetRelativeMouseState(). + */ +extern DECLSPEC Uint8 SDLCALL SDL_GetRelativeMouseState(int *x, int *y); + +/** + * Set the position of the mouse cursor (generates a mouse motion event) + */ +extern DECLSPEC void SDLCALL SDL_WarpMouse(Uint16 x, Uint16 y); + +/** + * Create a cursor using the specified data and mask (in MSB format). + * The cursor width must be a multiple of 8 bits. + * + * The cursor is created in black and white according to the following: + * data mask resulting pixel on screen + * 0 1 White + * 1 1 Black + * 0 0 Transparent + * 1 0 Inverted color if possible, black if not. + * + * Cursors created with this function must be freed with SDL_FreeCursor(). + */ +extern DECLSPEC SDL_Cursor * SDLCALL SDL_CreateCursor + (Uint8 *data, Uint8 *mask, int w, int h, int hot_x, int hot_y); + +/** + * Set the currently active cursor to the specified one. + * If the cursor is currently visible, the change will be immediately + * represented on the display. + */ +extern DECLSPEC void SDLCALL SDL_SetCursor(SDL_Cursor *cursor); + +/** + * Returns the currently active cursor. + */ +extern DECLSPEC SDL_Cursor * SDLCALL SDL_GetCursor(void); + +/** + * Deallocates a cursor created with SDL_CreateCursor(). + */ +extern DECLSPEC void SDLCALL SDL_FreeCursor(SDL_Cursor *cursor); + +/** + * Toggle whether or not the cursor is shown on the screen. + * The cursor start off displayed, but can be turned off. + * SDL_ShowCursor() returns 1 if the cursor was being displayed + * before the call, or 0 if it was not. You can query the current + * state by passing a 'toggle' value of -1. + */ +extern DECLSPEC int SDLCALL SDL_ShowCursor(int toggle); + +/*@{*/ +/** Used as a mask when testing buttons in buttonstate + * Button 1: Left mouse button + * Button 2: Middle mouse button + * Button 3: Right mouse button + * Button 4: Mouse wheel up (may also be a real button) + * Button 5: Mouse wheel down (may also be a real button) + */ +#define SDL_BUTTON(X) (1 << ((X)-1)) +#define SDL_BUTTON_LEFT 1 +#define SDL_BUTTON_MIDDLE 2 +#define SDL_BUTTON_RIGHT 3 +#define SDL_BUTTON_WHEELUP 4 +#define SDL_BUTTON_WHEELDOWN 5 +#define SDL_BUTTON_X1 6 +#define SDL_BUTTON_X2 7 +#define SDL_BUTTON_LMASK SDL_BUTTON(SDL_BUTTON_LEFT) +#define SDL_BUTTON_MMASK SDL_BUTTON(SDL_BUTTON_MIDDLE) +#define SDL_BUTTON_RMASK SDL_BUTTON(SDL_BUTTON_RIGHT) +#define SDL_BUTTON_X1MASK SDL_BUTTON(SDL_BUTTON_X1) +#define SDL_BUTTON_X2MASK SDL_BUTTON(SDL_BUTTON_X2) +/*@}*/ + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_mouse_h */ diff --git a/apps/plugins/sdl/include/SDL_mutex.h b/apps/plugins/sdl/include/SDL_mutex.h new file mode 100644 index 0000000..c8da9b1 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_mutex.h @@ -0,0 +1,177 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_mutex_h +#define _SDL_mutex_h + +/** @file SDL_mutex.h + * Functions to provide thread synchronization primitives + * + * @note These are independent of the other SDL routines. + */ + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** Synchronization functions which can time out return this value + * if they time out. + */ +#define SDL_MUTEX_TIMEDOUT 1 + +/** This is the timeout value which corresponds to never time out */ +#define SDL_MUTEX_MAXWAIT (~(Uint32)0) + + +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ +/** @name Mutex functions */ /*@{*/ +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ + +/** The SDL mutex structure, defined in SDL_mutex.c */ +struct SDL_mutex; +typedef struct SDL_mutex SDL_mutex; + +/** Create a mutex, initialized unlocked */ +extern DECLSPEC SDL_mutex * SDLCALL SDL_CreateMutex(void); + +#define SDL_LockMutex(m) SDL_mutexP(m) +/** Lock the mutex + * @return 0, or -1 on error + */ +extern DECLSPEC int SDLCALL SDL_mutexP(SDL_mutex *mutex); + +#define SDL_UnlockMutex(m) SDL_mutexV(m) +/** Unlock the mutex + * @return 0, or -1 on error + * + * It is an error to unlock a mutex that has not been locked by + * the current thread, and doing so results in undefined behavior. + */ +extern DECLSPEC int SDLCALL SDL_mutexV(SDL_mutex *mutex); + +/** Destroy a mutex */ +extern DECLSPEC void SDLCALL SDL_DestroyMutex(SDL_mutex *mutex); + +/*@}*/ + +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ +/** @name Semaphore functions */ /*@{*/ +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ + +/** The SDL semaphore structure, defined in SDL_sem.c */ +struct SDL_semaphore; +typedef struct SDL_semaphore SDL_sem; + +/** Create a semaphore, initialized with value, returns NULL on failure. */ +extern DECLSPEC SDL_sem * SDLCALL SDL_CreateSemaphore(Uint32 initial_value); + +/** Destroy a semaphore */ +extern DECLSPEC void SDLCALL SDL_DestroySemaphore(SDL_sem *sem); + +/** + * This function suspends the calling thread until the semaphore pointed + * to by sem has a positive count. It then atomically decreases the semaphore + * count. + */ +extern DECLSPEC int SDLCALL SDL_SemWait(SDL_sem *sem); + +/** Non-blocking variant of SDL_SemWait(). + * @return 0 if the wait succeeds, + * SDL_MUTEX_TIMEDOUT if the wait would block, and -1 on error. + */ +extern DECLSPEC int SDLCALL SDL_SemTryWait(SDL_sem *sem); + +/** Variant of SDL_SemWait() with a timeout in milliseconds, returns 0 if + * the wait succeeds, SDL_MUTEX_TIMEDOUT if the wait does not succeed in + * the allotted time, and -1 on error. + * + * On some platforms this function is implemented by looping with a delay + * of 1 ms, and so should be avoided if possible. + */ +extern DECLSPEC int SDLCALL SDL_SemWaitTimeout(SDL_sem *sem, Uint32 ms); + +/** Atomically increases the semaphore's count (not blocking). + * @return 0, or -1 on error. + */ +extern DECLSPEC int SDLCALL SDL_SemPost(SDL_sem *sem); + +/** Returns the current count of the semaphore */ +extern DECLSPEC Uint32 SDLCALL SDL_SemValue(SDL_sem *sem); + +/*@}*/ + +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ +/** @name Condition_variable_functions */ /*@{*/ +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ + +/*@{*/ +/** The SDL condition variable structure, defined in SDL_cond.c */ +struct SDL_cond; +typedef struct SDL_cond SDL_cond; +/*@}*/ + +/** Create a condition variable */ +extern DECLSPEC SDL_cond * SDLCALL SDL_CreateCond(void); + +/** Destroy a condition variable */ +extern DECLSPEC void SDLCALL SDL_DestroyCond(SDL_cond *cond); + +/** Restart one of the threads that are waiting on the condition variable, + * @return 0 or -1 on error. + */ +extern DECLSPEC int SDLCALL SDL_CondSignal(SDL_cond *cond); + +/** Restart all threads that are waiting on the condition variable, + * @return 0 or -1 on error. + */ +extern DECLSPEC int SDLCALL SDL_CondBroadcast(SDL_cond *cond); + +/** Wait on the condition variable, unlocking the provided mutex. + * The mutex must be locked before entering this function! + * The mutex is re-locked once the condition variable is signaled. + * @return 0 when it is signaled, or -1 on error. + */ +extern DECLSPEC int SDLCALL SDL_CondWait(SDL_cond *cond, SDL_mutex *mut); + +/** Waits for at most 'ms' milliseconds, and returns 0 if the condition + * variable is signaled, SDL_MUTEX_TIMEDOUT if the condition is not + * signaled in the allotted time, and -1 on error. + * On some platforms this function is implemented by looping with a delay + * of 1 ms, and so should be avoided if possible. + */ +extern DECLSPEC int SDLCALL SDL_CondWaitTimeout(SDL_cond *cond, SDL_mutex *mutex, Uint32 ms); + +/*@}*/ + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_mutex_h */ + diff --git a/apps/plugins/sdl/include/SDL_name.h b/apps/plugins/sdl/include/SDL_name.h new file mode 100644 index 0000000..511619a --- /dev/null +++ b/apps/plugins/sdl/include/SDL_name.h @@ -0,0 +1,11 @@ + +#ifndef _SDLname_h_ +#define _SDLname_h_ + +#if defined(__STDC__) || defined(__cplusplus) +#define NeedFunctionPrototypes 1 +#endif + +#define SDL_NAME(X) SDL_##X + +#endif /* _SDLname_h_ */ diff --git a/apps/plugins/sdl/include/SDL_opengl.h b/apps/plugins/sdl/include/SDL_opengl.h new file mode 100644 index 0000000..3d791d6 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_opengl.h @@ -0,0 +1,6570 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_opengl.h + * This is a simple file to encapsulate the OpenGL API headers + */ + +#include "SDL_config.h" + +#ifdef __WIN32__ +#define WIN32_LEAN_AND_MEAN +#ifndef NOMINMAX +#define NOMINMAX /* Don't defined min() and max() */ +#endif +#include +#endif +#ifndef NO_SDL_GLEXT +#define __glext_h_ /* Don't let gl.h include glext.h */ +#endif +#if defined(__MACOSX__) +#include /* Header File For The OpenGL Library */ +#include /* Header File For The GLU Library */ +#elif defined(__MACOS__) +#include /* Header File For The OpenGL Library */ +#include /* Header File For The GLU Library */ +#else +#include /* Header File For The OpenGL Library */ +#include /* Header File For The GLU Library */ +#endif +#ifndef NO_SDL_GLEXT +#undef __glext_h_ +#endif + +/** @name GLext.h + * This file taken from "GLext.h" from the Jeff Molofee OpenGL tutorials. + * It is included here because glext.h is not available on some systems. + * If you don't want this version included, simply define "NO_SDL_GLEXT" + */ +/*@{*/ +#ifndef NO_SDL_GLEXT +#if !defined(__glext_h_) && !defined(GL_GLEXT_LEGACY) +#define __glext_h_ + +#ifdef __cplusplus +extern "C" { +#endif + +/* +** License Applicability. Except to the extent portions of this file are +** made subject to an alternative license as permitted in the SGI Free +** Software License B, Version 1.1 (the "License"), the contents of this +** file are subject only to the provisions of the License. You may not use +** this file except in compliance with the License. You may obtain a copy +** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600 +** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at: +** +** http://oss.sgi.com/projects/FreeB +** +** Note that, as provided in the License, the Software is distributed on an +** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS +** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND +** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A +** PARTICULAR PURPOSE, AND NON-INFRINGEMENT. +** +** Original Code. The Original Code is: OpenGL Sample Implementation, +** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics, +** Inc. The Original Code is Copyright (c) 1991-2004 Silicon Graphics, Inc. +** Copyright in any portions created by third parties is as indicated +** elsewhere herein. All Rights Reserved. +** +** Additional Notice Provisions: This software was created using the +** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has +** not been independently verified as being compliant with the OpenGL(R) +** version 1.2.1 Specification. +*/ + +#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__) && !defined(__SCITECH_SNAP__) +#define WIN32_LEAN_AND_MEAN 1 +#include +#endif + +#ifndef APIENTRY +#define APIENTRY +#endif +#ifndef APIENTRYP +#define APIENTRYP APIENTRY * +#endif +#ifndef GLAPI +#define GLAPI extern +#endif + +/*************************************************************/ + +/* Header file version number, required by OpenGL ABI for Linux */ +/* glext.h last updated 2005/06/20 */ +/* Current version at http://oss.sgi.com/projects/ogl-sample/registry/ */ +#define GL_GLEXT_VERSION 29 + +#ifndef GL_VERSION_1_2 +#define GL_UNSIGNED_BYTE_3_3_2 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2 0x8036 +#define GL_RESCALE_NORMAL 0x803A +#define GL_TEXTURE_BINDING_3D 0x806A +#define GL_PACK_SKIP_IMAGES 0x806B +#define GL_PACK_IMAGE_HEIGHT 0x806C +#define GL_UNPACK_SKIP_IMAGES 0x806D +#define GL_UNPACK_IMAGE_HEIGHT 0x806E +#define GL_TEXTURE_3D 0x806F +#define GL_PROXY_TEXTURE_3D 0x8070 +#define GL_TEXTURE_DEPTH 0x8071 +#define GL_TEXTURE_WRAP_R 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE 0x8073 +#define GL_UNSIGNED_BYTE_2_3_3_REV 0x8362 +#define GL_UNSIGNED_SHORT_5_6_5 0x8363 +#define GL_UNSIGNED_SHORT_5_6_5_REV 0x8364 +#define GL_UNSIGNED_SHORT_4_4_4_4_REV 0x8365 +#define GL_UNSIGNED_SHORT_1_5_5_5_REV 0x8366 +#define GL_UNSIGNED_INT_8_8_8_8_REV 0x8367 +#define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 +#define GL_BGR 0x80E0 +#define GL_BGRA 0x80E1 +#define GL_MAX_ELEMENTS_VERTICES 0x80E8 +#define GL_MAX_ELEMENTS_INDICES 0x80E9 +#define GL_CLAMP_TO_EDGE 0x812F +#define GL_TEXTURE_MIN_LOD 0x813A +#define GL_TEXTURE_MAX_LOD 0x813B +#define GL_TEXTURE_BASE_LEVEL 0x813C +#define GL_TEXTURE_MAX_LEVEL 0x813D +#define GL_LIGHT_MODEL_COLOR_CONTROL 0x81F8 +#define GL_SINGLE_COLOR 0x81F9 +#define GL_SEPARATE_SPECULAR_COLOR 0x81FA +#define GL_SMOOTH_POINT_SIZE_RANGE 0x0B12 +#define GL_SMOOTH_POINT_SIZE_GRANULARITY 0x0B13 +#define GL_SMOOTH_LINE_WIDTH_RANGE 0x0B22 +#define GL_SMOOTH_LINE_WIDTH_GRANULARITY 0x0B23 +#define GL_ALIASED_POINT_SIZE_RANGE 0x846D +#define GL_ALIASED_LINE_WIDTH_RANGE 0x846E +#endif + +#ifndef GL_ARB_imaging +#define GL_CONSTANT_COLOR 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 +#define GL_CONSTANT_ALPHA 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_BLEND_COLOR 0x8005 +#define GL_FUNC_ADD 0x8006 +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 +#define GL_BLEND_EQUATION 0x8009 +#define GL_FUNC_SUBTRACT 0x800A +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_CONVOLUTION_1D 0x8010 +#define GL_CONVOLUTION_2D 0x8011 +#define GL_SEPARABLE_2D 0x8012 +#define GL_CONVOLUTION_BORDER_MODE 0x8013 +#define GL_CONVOLUTION_FILTER_SCALE 0x8014 +#define GL_CONVOLUTION_FILTER_BIAS 0x8015 +#define GL_REDUCE 0x8016 +#define GL_CONVOLUTION_FORMAT 0x8017 +#define GL_CONVOLUTION_WIDTH 0x8018 +#define GL_CONVOLUTION_HEIGHT 0x8019 +#define GL_MAX_CONVOLUTION_WIDTH 0x801A +#define GL_MAX_CONVOLUTION_HEIGHT 0x801B +#define GL_POST_CONVOLUTION_RED_SCALE 0x801C +#define GL_POST_CONVOLUTION_GREEN_SCALE 0x801D +#define GL_POST_CONVOLUTION_BLUE_SCALE 0x801E +#define GL_POST_CONVOLUTION_ALPHA_SCALE 0x801F +#define GL_POST_CONVOLUTION_RED_BIAS 0x8020 +#define GL_POST_CONVOLUTION_GREEN_BIAS 0x8021 +#define GL_POST_CONVOLUTION_BLUE_BIAS 0x8022 +#define GL_POST_CONVOLUTION_ALPHA_BIAS 0x8023 +#define GL_HISTOGRAM 0x8024 +#define GL_PROXY_HISTOGRAM 0x8025 +#define GL_HISTOGRAM_WIDTH 0x8026 +#define GL_HISTOGRAM_FORMAT 0x8027 +#define GL_HISTOGRAM_RED_SIZE 0x8028 +#define GL_HISTOGRAM_GREEN_SIZE 0x8029 +#define GL_HISTOGRAM_BLUE_SIZE 0x802A +#define GL_HISTOGRAM_ALPHA_SIZE 0x802B +#define GL_HISTOGRAM_LUMINANCE_SIZE 0x802C +#define GL_HISTOGRAM_SINK 0x802D +#define GL_MINMAX 0x802E +#define GL_MINMAX_FORMAT 0x802F +#define GL_MINMAX_SINK 0x8030 +#define GL_TABLE_TOO_LARGE 0x8031 +#define GL_COLOR_MATRIX 0x80B1 +#define GL_COLOR_MATRIX_STACK_DEPTH 0x80B2 +#define GL_MAX_COLOR_MATRIX_STACK_DEPTH 0x80B3 +#define GL_POST_COLOR_MATRIX_RED_SCALE 0x80B4 +#define GL_POST_COLOR_MATRIX_GREEN_SCALE 0x80B5 +#define GL_POST_COLOR_MATRIX_BLUE_SCALE 0x80B6 +#define GL_POST_COLOR_MATRIX_ALPHA_SCALE 0x80B7 +#define GL_POST_COLOR_MATRIX_RED_BIAS 0x80B8 +#define GL_POST_COLOR_MATRIX_GREEN_BIAS 0x80B9 +#define GL_POST_COLOR_MATRIX_BLUE_BIAS 0x80BA +#define GL_POST_COLOR_MATRIX_ALPHA_BIAS 0x80BB +#define GL_COLOR_TABLE 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE 0x80D2 +#define GL_PROXY_COLOR_TABLE 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5 +#define GL_COLOR_TABLE_SCALE 0x80D6 +#define GL_COLOR_TABLE_BIAS 0x80D7 +#define GL_COLOR_TABLE_FORMAT 0x80D8 +#define GL_COLOR_TABLE_WIDTH 0x80D9 +#define GL_COLOR_TABLE_RED_SIZE 0x80DA +#define GL_COLOR_TABLE_GREEN_SIZE 0x80DB +#define GL_COLOR_TABLE_BLUE_SIZE 0x80DC +#define GL_COLOR_TABLE_ALPHA_SIZE 0x80DD +#define GL_COLOR_TABLE_LUMINANCE_SIZE 0x80DE +#define GL_COLOR_TABLE_INTENSITY_SIZE 0x80DF +#define GL_CONSTANT_BORDER 0x8151 +#define GL_REPLICATE_BORDER 0x8153 +#define GL_CONVOLUTION_BORDER_COLOR 0x8154 +#endif + +#ifndef GL_VERSION_1_3 +#define GL_TEXTURE0 0x84C0 +#define GL_TEXTURE1 0x84C1 +#define GL_TEXTURE2 0x84C2 +#define GL_TEXTURE3 0x84C3 +#define GL_TEXTURE4 0x84C4 +#define GL_TEXTURE5 0x84C5 +#define GL_TEXTURE6 0x84C6 +#define GL_TEXTURE7 0x84C7 +#define GL_TEXTURE8 0x84C8 +#define GL_TEXTURE9 0x84C9 +#define GL_TEXTURE10 0x84CA +#define GL_TEXTURE11 0x84CB +#define GL_TEXTURE12 0x84CC +#define GL_TEXTURE13 0x84CD +#define GL_TEXTURE14 0x84CE +#define GL_TEXTURE15 0x84CF +#define GL_TEXTURE16 0x84D0 +#define GL_TEXTURE17 0x84D1 +#define GL_TEXTURE18 0x84D2 +#define GL_TEXTURE19 0x84D3 +#define GL_TEXTURE20 0x84D4 +#define GL_TEXTURE21 0x84D5 +#define GL_TEXTURE22 0x84D6 +#define GL_TEXTURE23 0x84D7 +#define GL_TEXTURE24 0x84D8 +#define GL_TEXTURE25 0x84D9 +#define GL_TEXTURE26 0x84DA +#define GL_TEXTURE27 0x84DB +#define GL_TEXTURE28 0x84DC +#define GL_TEXTURE29 0x84DD +#define GL_TEXTURE30 0x84DE +#define GL_TEXTURE31 0x84DF +#define GL_ACTIVE_TEXTURE 0x84E0 +#define GL_CLIENT_ACTIVE_TEXTURE 0x84E1 +#define GL_MAX_TEXTURE_UNITS 0x84E2 +#define GL_TRANSPOSE_MODELVIEW_MATRIX 0x84E3 +#define GL_TRANSPOSE_PROJECTION_MATRIX 0x84E4 +#define GL_TRANSPOSE_TEXTURE_MATRIX 0x84E5 +#define GL_TRANSPOSE_COLOR_MATRIX 0x84E6 +#define GL_MULTISAMPLE 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE 0x809F +#define GL_SAMPLE_COVERAGE 0x80A0 +#define GL_SAMPLE_BUFFERS 0x80A8 +#define GL_SAMPLES 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT 0x80AB +#define GL_MULTISAMPLE_BIT 0x20000000 +#define GL_NORMAL_MAP 0x8511 +#define GL_REFLECTION_MAP 0x8512 +#define GL_TEXTURE_CUBE_MAP 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE 0x851C +#define GL_COMPRESSED_ALPHA 0x84E9 +#define GL_COMPRESSED_LUMINANCE 0x84EA +#define GL_COMPRESSED_LUMINANCE_ALPHA 0x84EB +#define GL_COMPRESSED_INTENSITY 0x84EC +#define GL_COMPRESSED_RGB 0x84ED +#define GL_COMPRESSED_RGBA 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE 0x86A0 +#define GL_TEXTURE_COMPRESSED 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS 0x86A3 +#define GL_CLAMP_TO_BORDER 0x812D +#define GL_COMBINE 0x8570 +#define GL_COMBINE_RGB 0x8571 +#define GL_COMBINE_ALPHA 0x8572 +#define GL_SOURCE0_RGB 0x8580 +#define GL_SOURCE1_RGB 0x8581 +#define GL_SOURCE2_RGB 0x8582 +#define GL_SOURCE0_ALPHA 0x8588 +#define GL_SOURCE1_ALPHA 0x8589 +#define GL_SOURCE2_ALPHA 0x858A +#define GL_OPERAND0_RGB 0x8590 +#define GL_OPERAND1_RGB 0x8591 +#define GL_OPERAND2_RGB 0x8592 +#define GL_OPERAND0_ALPHA 0x8598 +#define GL_OPERAND1_ALPHA 0x8599 +#define GL_OPERAND2_ALPHA 0x859A +#define GL_RGB_SCALE 0x8573 +#define GL_ADD_SIGNED 0x8574 +#define GL_INTERPOLATE 0x8575 +#define GL_SUBTRACT 0x84E7 +#define GL_CONSTANT 0x8576 +#define GL_PRIMARY_COLOR 0x8577 +#define GL_PREVIOUS 0x8578 +#define GL_DOT3_RGB 0x86AE +#define GL_DOT3_RGBA 0x86AF +#endif + +#ifndef GL_VERSION_1_4 +#define GL_BLEND_DST_RGB 0x80C8 +#define GL_BLEND_SRC_RGB 0x80C9 +#define GL_BLEND_DST_ALPHA 0x80CA +#define GL_BLEND_SRC_ALPHA 0x80CB +#define GL_POINT_SIZE_MIN 0x8126 +#define GL_POINT_SIZE_MAX 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE 0x8128 +#define GL_POINT_DISTANCE_ATTENUATION 0x8129 +#define GL_GENERATE_MIPMAP 0x8191 +#define GL_GENERATE_MIPMAP_HINT 0x8192 +#define GL_DEPTH_COMPONENT16 0x81A5 +#define GL_DEPTH_COMPONENT24 0x81A6 +#define GL_DEPTH_COMPONENT32 0x81A7 +#define GL_MIRRORED_REPEAT 0x8370 +#define GL_FOG_COORDINATE_SOURCE 0x8450 +#define GL_FOG_COORDINATE 0x8451 +#define GL_FRAGMENT_DEPTH 0x8452 +#define GL_CURRENT_FOG_COORDINATE 0x8453 +#define GL_FOG_COORDINATE_ARRAY_TYPE 0x8454 +#define GL_FOG_COORDINATE_ARRAY_STRIDE 0x8455 +#define GL_FOG_COORDINATE_ARRAY_POINTER 0x8456 +#define GL_FOG_COORDINATE_ARRAY 0x8457 +#define GL_COLOR_SUM 0x8458 +#define GL_CURRENT_SECONDARY_COLOR 0x8459 +#define GL_SECONDARY_COLOR_ARRAY_SIZE 0x845A +#define GL_SECONDARY_COLOR_ARRAY_TYPE 0x845B +#define GL_SECONDARY_COLOR_ARRAY_STRIDE 0x845C +#define GL_SECONDARY_COLOR_ARRAY_POINTER 0x845D +#define GL_SECONDARY_COLOR_ARRAY 0x845E +#define GL_MAX_TEXTURE_LOD_BIAS 0x84FD +#define GL_TEXTURE_FILTER_CONTROL 0x8500 +#define GL_TEXTURE_LOD_BIAS 0x8501 +#define GL_INCR_WRAP 0x8507 +#define GL_DECR_WRAP 0x8508 +#define GL_TEXTURE_DEPTH_SIZE 0x884A +#define GL_DEPTH_TEXTURE_MODE 0x884B +#define GL_TEXTURE_COMPARE_MODE 0x884C +#define GL_TEXTURE_COMPARE_FUNC 0x884D +#define GL_COMPARE_R_TO_TEXTURE 0x884E +#endif + +#ifndef GL_VERSION_1_5 +#define GL_BUFFER_SIZE 0x8764 +#define GL_BUFFER_USAGE 0x8765 +#define GL_QUERY_COUNTER_BITS 0x8864 +#define GL_CURRENT_QUERY 0x8865 +#define GL_QUERY_RESULT 0x8866 +#define GL_QUERY_RESULT_AVAILABLE 0x8867 +#define GL_ARRAY_BUFFER 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER 0x8893 +#define GL_ARRAY_BUFFER_BINDING 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING 0x8895 +#define GL_VERTEX_ARRAY_BUFFER_BINDING 0x8896 +#define GL_NORMAL_ARRAY_BUFFER_BINDING 0x8897 +#define GL_COLOR_ARRAY_BUFFER_BINDING 0x8898 +#define GL_INDEX_ARRAY_BUFFER_BINDING 0x8899 +#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING 0x889A +#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING 0x889B +#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING 0x889C +#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING 0x889D +#define GL_WEIGHT_ARRAY_BUFFER_BINDING 0x889E +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING 0x889F +#define GL_READ_ONLY 0x88B8 +#define GL_WRITE_ONLY 0x88B9 +#define GL_READ_WRITE 0x88BA +#define GL_BUFFER_ACCESS 0x88BB +#define GL_BUFFER_MAPPED 0x88BC +#define GL_BUFFER_MAP_POINTER 0x88BD +#define GL_STREAM_DRAW 0x88E0 +#define GL_STREAM_READ 0x88E1 +#define GL_STREAM_COPY 0x88E2 +#define GL_STATIC_DRAW 0x88E4 +#define GL_STATIC_READ 0x88E5 +#define GL_STATIC_COPY 0x88E6 +#define GL_DYNAMIC_DRAW 0x88E8 +#define GL_DYNAMIC_READ 0x88E9 +#define GL_DYNAMIC_COPY 0x88EA +#define GL_SAMPLES_PASSED 0x8914 +#define GL_FOG_COORD_SRC GL_FOG_COORDINATE_SOURCE +#define GL_FOG_COORD GL_FOG_COORDINATE +#define GL_CURRENT_FOG_COORD GL_CURRENT_FOG_COORDINATE +#define GL_FOG_COORD_ARRAY_TYPE GL_FOG_COORDINATE_ARRAY_TYPE +#define GL_FOG_COORD_ARRAY_STRIDE GL_FOG_COORDINATE_ARRAY_STRIDE +#define GL_FOG_COORD_ARRAY_POINTER GL_FOG_COORDINATE_ARRAY_POINTER +#define GL_FOG_COORD_ARRAY GL_FOG_COORDINATE_ARRAY +#define GL_FOG_COORD_ARRAY_BUFFER_BINDING GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING +#define GL_SRC0_RGB GL_SOURCE0_RGB +#define GL_SRC1_RGB GL_SOURCE1_RGB +#define GL_SRC2_RGB GL_SOURCE2_RGB +#define GL_SRC0_ALPHA GL_SOURCE0_ALPHA +#define GL_SRC1_ALPHA GL_SOURCE1_ALPHA +#define GL_SRC2_ALPHA GL_SOURCE2_ALPHA +#endif + +#ifndef GL_VERSION_2_0 +#define GL_BLEND_EQUATION_RGB GL_BLEND_EQUATION +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB 0x8626 +#define GL_VERTEX_PROGRAM_POINT_SIZE 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE 0x8643 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER 0x8645 +#define GL_STENCIL_BACK_FUNC 0x8800 +#define GL_STENCIL_BACK_FAIL 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS 0x8803 +#define GL_MAX_DRAW_BUFFERS 0x8824 +#define GL_DRAW_BUFFER0 0x8825 +#define GL_DRAW_BUFFER1 0x8826 +#define GL_DRAW_BUFFER2 0x8827 +#define GL_DRAW_BUFFER3 0x8828 +#define GL_DRAW_BUFFER4 0x8829 +#define GL_DRAW_BUFFER5 0x882A +#define GL_DRAW_BUFFER6 0x882B +#define GL_DRAW_BUFFER7 0x882C +#define GL_DRAW_BUFFER8 0x882D +#define GL_DRAW_BUFFER9 0x882E +#define GL_DRAW_BUFFER10 0x882F +#define GL_DRAW_BUFFER11 0x8830 +#define GL_DRAW_BUFFER12 0x8831 +#define GL_DRAW_BUFFER13 0x8832 +#define GL_DRAW_BUFFER14 0x8833 +#define GL_DRAW_BUFFER15 0x8834 +#define GL_BLEND_EQUATION_ALPHA 0x883D +#define GL_POINT_SPRITE 0x8861 +#define GL_COORD_REPLACE 0x8862 +#define GL_MAX_VERTEX_ATTRIBS 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED 0x886A +#define GL_MAX_TEXTURE_COORDS 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS 0x8872 +#define GL_FRAGMENT_SHADER 0x8B30 +#define GL_VERTEX_SHADER 0x8B31 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS 0x8B49 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS 0x8B4A +#define GL_MAX_VARYING_FLOATS 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS 0x8B4D +#define GL_SHADER_TYPE 0x8B4F +#define GL_FLOAT_VEC2 0x8B50 +#define GL_FLOAT_VEC3 0x8B51 +#define GL_FLOAT_VEC4 0x8B52 +#define GL_INT_VEC2 0x8B53 +#define GL_INT_VEC3 0x8B54 +#define GL_INT_VEC4 0x8B55 +#define GL_BOOL 0x8B56 +#define GL_BOOL_VEC2 0x8B57 +#define GL_BOOL_VEC3 0x8B58 +#define GL_BOOL_VEC4 0x8B59 +#define GL_FLOAT_MAT2 0x8B5A +#define GL_FLOAT_MAT3 0x8B5B +#define GL_FLOAT_MAT4 0x8B5C +#define GL_SAMPLER_1D 0x8B5D +#define GL_SAMPLER_2D 0x8B5E +#define GL_SAMPLER_3D 0x8B5F +#define GL_SAMPLER_CUBE 0x8B60 +#define GL_SAMPLER_1D_SHADOW 0x8B61 +#define GL_SAMPLER_2D_SHADOW 0x8B62 +#define GL_DELETE_STATUS 0x8B80 +#define GL_COMPILE_STATUS 0x8B81 +#define GL_LINK_STATUS 0x8B82 +#define GL_VALIDATE_STATUS 0x8B83 +#define GL_INFO_LOG_LENGTH 0x8B84 +#define GL_ATTACHED_SHADERS 0x8B85 +#define GL_ACTIVE_UNIFORMS 0x8B86 +#define GL_ACTIVE_UNIFORM_MAX_LENGTH 0x8B87 +#define GL_SHADER_SOURCE_LENGTH 0x8B88 +#define GL_ACTIVE_ATTRIBUTES 0x8B89 +#define GL_ACTIVE_ATTRIBUTE_MAX_LENGTH 0x8B8A +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT 0x8B8B +#define GL_SHADING_LANGUAGE_VERSION 0x8B8C +#define GL_CURRENT_PROGRAM 0x8B8D +#define GL_POINT_SPRITE_COORD_ORIGIN 0x8CA0 +#define GL_LOWER_LEFT 0x8CA1 +#define GL_UPPER_LEFT 0x8CA2 +#define GL_STENCIL_BACK_REF 0x8CA3 +#define GL_STENCIL_BACK_VALUE_MASK 0x8CA4 +#define GL_STENCIL_BACK_WRITEMASK 0x8CA5 +#endif + +#ifndef GL_ARB_multitexture +#define GL_TEXTURE0_ARB 0x84C0 +#define GL_TEXTURE1_ARB 0x84C1 +#define GL_TEXTURE2_ARB 0x84C2 +#define GL_TEXTURE3_ARB 0x84C3 +#define GL_TEXTURE4_ARB 0x84C4 +#define GL_TEXTURE5_ARB 0x84C5 +#define GL_TEXTURE6_ARB 0x84C6 +#define GL_TEXTURE7_ARB 0x84C7 +#define GL_TEXTURE8_ARB 0x84C8 +#define GL_TEXTURE9_ARB 0x84C9 +#define GL_TEXTURE10_ARB 0x84CA +#define GL_TEXTURE11_ARB 0x84CB +#define GL_TEXTURE12_ARB 0x84CC +#define GL_TEXTURE13_ARB 0x84CD +#define GL_TEXTURE14_ARB 0x84CE +#define GL_TEXTURE15_ARB 0x84CF +#define GL_TEXTURE16_ARB 0x84D0 +#define GL_TEXTURE17_ARB 0x84D1 +#define GL_TEXTURE18_ARB 0x84D2 +#define GL_TEXTURE19_ARB 0x84D3 +#define GL_TEXTURE20_ARB 0x84D4 +#define GL_TEXTURE21_ARB 0x84D5 +#define GL_TEXTURE22_ARB 0x84D6 +#define GL_TEXTURE23_ARB 0x84D7 +#define GL_TEXTURE24_ARB 0x84D8 +#define GL_TEXTURE25_ARB 0x84D9 +#define GL_TEXTURE26_ARB 0x84DA +#define GL_TEXTURE27_ARB 0x84DB +#define GL_TEXTURE28_ARB 0x84DC +#define GL_TEXTURE29_ARB 0x84DD +#define GL_TEXTURE30_ARB 0x84DE +#define GL_TEXTURE31_ARB 0x84DF +#define GL_ACTIVE_TEXTURE_ARB 0x84E0 +#define GL_CLIENT_ACTIVE_TEXTURE_ARB 0x84E1 +#define GL_MAX_TEXTURE_UNITS_ARB 0x84E2 +#endif + +#ifndef GL_ARB_transpose_matrix +#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3 +#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4 +#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB 0x84E5 +#define GL_TRANSPOSE_COLOR_MATRIX_ARB 0x84E6 +#endif + +#ifndef GL_ARB_multisample +#define GL_MULTISAMPLE_ARB 0x809D +#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_ARB 0x809F +#define GL_SAMPLE_COVERAGE_ARB 0x80A0 +#define GL_SAMPLE_BUFFERS_ARB 0x80A8 +#define GL_SAMPLES_ARB 0x80A9 +#define GL_SAMPLE_COVERAGE_VALUE_ARB 0x80AA +#define GL_SAMPLE_COVERAGE_INVERT_ARB 0x80AB +#define GL_MULTISAMPLE_BIT_ARB 0x20000000 +#endif + +#ifndef GL_ARB_texture_env_add +#endif + +#ifndef GL_ARB_texture_cube_map +#define GL_NORMAL_MAP_ARB 0x8511 +#define GL_REFLECTION_MAP_ARB 0x8512 +#define GL_TEXTURE_CUBE_MAP_ARB 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP_ARB 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP_ARB 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB 0x851C +#endif + +#ifndef GL_ARB_texture_compression +#define GL_COMPRESSED_ALPHA_ARB 0x84E9 +#define GL_COMPRESSED_LUMINANCE_ARB 0x84EA +#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB +#define GL_COMPRESSED_INTENSITY_ARB 0x84EC +#define GL_COMPRESSED_RGB_ARB 0x84ED +#define GL_COMPRESSED_RGBA_ARB 0x84EE +#define GL_TEXTURE_COMPRESSION_HINT_ARB 0x84EF +#define GL_TEXTURE_COMPRESSED_IMAGE_SIZE_ARB 0x86A0 +#define GL_TEXTURE_COMPRESSED_ARB 0x86A1 +#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2 +#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3 +#endif + +#ifndef GL_ARB_texture_border_clamp +#define GL_CLAMP_TO_BORDER_ARB 0x812D +#endif + +#ifndef GL_ARB_point_parameters +#define GL_POINT_SIZE_MIN_ARB 0x8126 +#define GL_POINT_SIZE_MAX_ARB 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_ARB 0x8128 +#define GL_POINT_DISTANCE_ATTENUATION_ARB 0x8129 +#endif + +#ifndef GL_ARB_vertex_blend +#define GL_MAX_VERTEX_UNITS_ARB 0x86A4 +#define GL_ACTIVE_VERTEX_UNITS_ARB 0x86A5 +#define GL_WEIGHT_SUM_UNITY_ARB 0x86A6 +#define GL_VERTEX_BLEND_ARB 0x86A7 +#define GL_CURRENT_WEIGHT_ARB 0x86A8 +#define GL_WEIGHT_ARRAY_TYPE_ARB 0x86A9 +#define GL_WEIGHT_ARRAY_STRIDE_ARB 0x86AA +#define GL_WEIGHT_ARRAY_SIZE_ARB 0x86AB +#define GL_WEIGHT_ARRAY_POINTER_ARB 0x86AC +#define GL_WEIGHT_ARRAY_ARB 0x86AD +#define GL_MODELVIEW0_ARB 0x1700 +#define GL_MODELVIEW1_ARB 0x850A +#define GL_MODELVIEW2_ARB 0x8722 +#define GL_MODELVIEW3_ARB 0x8723 +#define GL_MODELVIEW4_ARB 0x8724 +#define GL_MODELVIEW5_ARB 0x8725 +#define GL_MODELVIEW6_ARB 0x8726 +#define GL_MODELVIEW7_ARB 0x8727 +#define GL_MODELVIEW8_ARB 0x8728 +#define GL_MODELVIEW9_ARB 0x8729 +#define GL_MODELVIEW10_ARB 0x872A +#define GL_MODELVIEW11_ARB 0x872B +#define GL_MODELVIEW12_ARB 0x872C +#define GL_MODELVIEW13_ARB 0x872D +#define GL_MODELVIEW14_ARB 0x872E +#define GL_MODELVIEW15_ARB 0x872F +#define GL_MODELVIEW16_ARB 0x8730 +#define GL_MODELVIEW17_ARB 0x8731 +#define GL_MODELVIEW18_ARB 0x8732 +#define GL_MODELVIEW19_ARB 0x8733 +#define GL_MODELVIEW20_ARB 0x8734 +#define GL_MODELVIEW21_ARB 0x8735 +#define GL_MODELVIEW22_ARB 0x8736 +#define GL_MODELVIEW23_ARB 0x8737 +#define GL_MODELVIEW24_ARB 0x8738 +#define GL_MODELVIEW25_ARB 0x8739 +#define GL_MODELVIEW26_ARB 0x873A +#define GL_MODELVIEW27_ARB 0x873B +#define GL_MODELVIEW28_ARB 0x873C +#define GL_MODELVIEW29_ARB 0x873D +#define GL_MODELVIEW30_ARB 0x873E +#define GL_MODELVIEW31_ARB 0x873F +#endif + +#ifndef GL_ARB_matrix_palette +#define GL_MATRIX_PALETTE_ARB 0x8840 +#define GL_MAX_MATRIX_PALETTE_STACK_DEPTH_ARB 0x8841 +#define GL_MAX_PALETTE_MATRICES_ARB 0x8842 +#define GL_CURRENT_PALETTE_MATRIX_ARB 0x8843 +#define GL_MATRIX_INDEX_ARRAY_ARB 0x8844 +#define GL_CURRENT_MATRIX_INDEX_ARB 0x8845 +#define GL_MATRIX_INDEX_ARRAY_SIZE_ARB 0x8846 +#define GL_MATRIX_INDEX_ARRAY_TYPE_ARB 0x8847 +#define GL_MATRIX_INDEX_ARRAY_STRIDE_ARB 0x8848 +#define GL_MATRIX_INDEX_ARRAY_POINTER_ARB 0x8849 +#endif + +#ifndef GL_ARB_texture_env_combine +#define GL_COMBINE_ARB 0x8570 +#define GL_COMBINE_RGB_ARB 0x8571 +#define GL_COMBINE_ALPHA_ARB 0x8572 +#define GL_SOURCE0_RGB_ARB 0x8580 +#define GL_SOURCE1_RGB_ARB 0x8581 +#define GL_SOURCE2_RGB_ARB 0x8582 +#define GL_SOURCE0_ALPHA_ARB 0x8588 +#define GL_SOURCE1_ALPHA_ARB 0x8589 +#define GL_SOURCE2_ALPHA_ARB 0x858A +#define GL_OPERAND0_RGB_ARB 0x8590 +#define GL_OPERAND1_RGB_ARB 0x8591 +#define GL_OPERAND2_RGB_ARB 0x8592 +#define GL_OPERAND0_ALPHA_ARB 0x8598 +#define GL_OPERAND1_ALPHA_ARB 0x8599 +#define GL_OPERAND2_ALPHA_ARB 0x859A +#define GL_RGB_SCALE_ARB 0x8573 +#define GL_ADD_SIGNED_ARB 0x8574 +#define GL_INTERPOLATE_ARB 0x8575 +#define GL_SUBTRACT_ARB 0x84E7 +#define GL_CONSTANT_ARB 0x8576 +#define GL_PRIMARY_COLOR_ARB 0x8577 +#define GL_PREVIOUS_ARB 0x8578 +#endif + +#ifndef GL_ARB_texture_env_crossbar +#endif + +#ifndef GL_ARB_texture_env_dot3 +#define GL_DOT3_RGB_ARB 0x86AE +#define GL_DOT3_RGBA_ARB 0x86AF +#endif + +#ifndef GL_ARB_texture_mirrored_repeat +#define GL_MIRRORED_REPEAT_ARB 0x8370 +#endif + +#ifndef GL_ARB_depth_texture +#define GL_DEPTH_COMPONENT16_ARB 0x81A5 +#define GL_DEPTH_COMPONENT24_ARB 0x81A6 +#define GL_DEPTH_COMPONENT32_ARB 0x81A7 +#define GL_TEXTURE_DEPTH_SIZE_ARB 0x884A +#define GL_DEPTH_TEXTURE_MODE_ARB 0x884B +#endif + +#ifndef GL_ARB_shadow +#define GL_TEXTURE_COMPARE_MODE_ARB 0x884C +#define GL_TEXTURE_COMPARE_FUNC_ARB 0x884D +#define GL_COMPARE_R_TO_TEXTURE_ARB 0x884E +#endif + +#ifndef GL_ARB_shadow_ambient +#define GL_TEXTURE_COMPARE_FAIL_VALUE_ARB 0x80BF +#endif + +#ifndef GL_ARB_window_pos +#endif + +#ifndef GL_ARB_vertex_program +#define GL_COLOR_SUM_ARB 0x8458 +#define GL_VERTEX_PROGRAM_ARB 0x8620 +#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB 0x8622 +#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB 0x8623 +#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB 0x8624 +#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB 0x8625 +#define GL_CURRENT_VERTEX_ATTRIB_ARB 0x8626 +#define GL_PROGRAM_LENGTH_ARB 0x8627 +#define GL_PROGRAM_STRING_ARB 0x8628 +#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB 0x862E +#define GL_MAX_PROGRAM_MATRICES_ARB 0x862F +#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB 0x8640 +#define GL_CURRENT_MATRIX_ARB 0x8641 +#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB 0x8643 +#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB 0x8645 +#define GL_PROGRAM_ERROR_POSITION_ARB 0x864B +#define GL_PROGRAM_BINDING_ARB 0x8677 +#define GL_MAX_VERTEX_ATTRIBS_ARB 0x8869 +#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB 0x886A +#define GL_PROGRAM_ERROR_STRING_ARB 0x8874 +#define GL_PROGRAM_FORMAT_ASCII_ARB 0x8875 +#define GL_PROGRAM_FORMAT_ARB 0x8876 +#define GL_PROGRAM_INSTRUCTIONS_ARB 0x88A0 +#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB 0x88A1 +#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A2 +#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB 0x88A3 +#define GL_PROGRAM_TEMPORARIES_ARB 0x88A4 +#define GL_MAX_PROGRAM_TEMPORARIES_ARB 0x88A5 +#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A6 +#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB 0x88A7 +#define GL_PROGRAM_PARAMETERS_ARB 0x88A8 +#define GL_MAX_PROGRAM_PARAMETERS_ARB 0x88A9 +#define GL_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AA +#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB 0x88AB +#define GL_PROGRAM_ATTRIBS_ARB 0x88AC +#define GL_MAX_PROGRAM_ATTRIBS_ARB 0x88AD +#define GL_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AE +#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB 0x88AF +#define GL_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B0 +#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB 0x88B1 +#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B2 +#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3 +#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB 0x88B4 +#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB 0x88B5 +#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB 0x88B6 +#define GL_TRANSPOSE_CURRENT_MATRIX_ARB 0x88B7 +#define GL_MATRIX0_ARB 0x88C0 +#define GL_MATRIX1_ARB 0x88C1 +#define GL_MATRIX2_ARB 0x88C2 +#define GL_MATRIX3_ARB 0x88C3 +#define GL_MATRIX4_ARB 0x88C4 +#define GL_MATRIX5_ARB 0x88C5 +#define GL_MATRIX6_ARB 0x88C6 +#define GL_MATRIX7_ARB 0x88C7 +#define GL_MATRIX8_ARB 0x88C8 +#define GL_MATRIX9_ARB 0x88C9 +#define GL_MATRIX10_ARB 0x88CA +#define GL_MATRIX11_ARB 0x88CB +#define GL_MATRIX12_ARB 0x88CC +#define GL_MATRIX13_ARB 0x88CD +#define GL_MATRIX14_ARB 0x88CE +#define GL_MATRIX15_ARB 0x88CF +#define GL_MATRIX16_ARB 0x88D0 +#define GL_MATRIX17_ARB 0x88D1 +#define GL_MATRIX18_ARB 0x88D2 +#define GL_MATRIX19_ARB 0x88D3 +#define GL_MATRIX20_ARB 0x88D4 +#define GL_MATRIX21_ARB 0x88D5 +#define GL_MATRIX22_ARB 0x88D6 +#define GL_MATRIX23_ARB 0x88D7 +#define GL_MATRIX24_ARB 0x88D8 +#define GL_MATRIX25_ARB 0x88D9 +#define GL_MATRIX26_ARB 0x88DA +#define GL_MATRIX27_ARB 0x88DB +#define GL_MATRIX28_ARB 0x88DC +#define GL_MATRIX29_ARB 0x88DD +#define GL_MATRIX30_ARB 0x88DE +#define GL_MATRIX31_ARB 0x88DF +#endif + +#ifndef GL_ARB_fragment_program +#define GL_FRAGMENT_PROGRAM_ARB 0x8804 +#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB 0x8805 +#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB 0x8806 +#define GL_PROGRAM_TEX_INDIRECTIONS_ARB 0x8807 +#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x8808 +#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x8809 +#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x880A +#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB 0x880B +#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB 0x880C +#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB 0x880D +#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB 0x880E +#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB 0x880F +#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB 0x8810 +#define GL_MAX_TEXTURE_COORDS_ARB 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB 0x8872 +#endif + +#ifndef GL_ARB_vertex_buffer_object +#define GL_BUFFER_SIZE_ARB 0x8764 +#define GL_BUFFER_USAGE_ARB 0x8765 +#define GL_ARRAY_BUFFER_ARB 0x8892 +#define GL_ELEMENT_ARRAY_BUFFER_ARB 0x8893 +#define GL_ARRAY_BUFFER_BINDING_ARB 0x8894 +#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB 0x8895 +#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB 0x8896 +#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB 0x8897 +#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB 0x8898 +#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB 0x8899 +#define GL_TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB 0x889A +#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB 0x889B +#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB 0x889C +#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB 0x889D +#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB 0x889E +#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB 0x889F +#define GL_READ_ONLY_ARB 0x88B8 +#define GL_WRITE_ONLY_ARB 0x88B9 +#define GL_READ_WRITE_ARB 0x88BA +#define GL_BUFFER_ACCESS_ARB 0x88BB +#define GL_BUFFER_MAPPED_ARB 0x88BC +#define GL_BUFFER_MAP_POINTER_ARB 0x88BD +#define GL_STREAM_DRAW_ARB 0x88E0 +#define GL_STREAM_READ_ARB 0x88E1 +#define GL_STREAM_COPY_ARB 0x88E2 +#define GL_STATIC_DRAW_ARB 0x88E4 +#define GL_STATIC_READ_ARB 0x88E5 +#define GL_STATIC_COPY_ARB 0x88E6 +#define GL_DYNAMIC_DRAW_ARB 0x88E8 +#define GL_DYNAMIC_READ_ARB 0x88E9 +#define GL_DYNAMIC_COPY_ARB 0x88EA +#endif + +#ifndef GL_ARB_occlusion_query +#define GL_QUERY_COUNTER_BITS_ARB 0x8864 +#define GL_CURRENT_QUERY_ARB 0x8865 +#define GL_QUERY_RESULT_ARB 0x8866 +#define GL_QUERY_RESULT_AVAILABLE_ARB 0x8867 +#define GL_SAMPLES_PASSED_ARB 0x8914 +#endif + +#ifndef GL_ARB_shader_objects +#define GL_PROGRAM_OBJECT_ARB 0x8B40 +#define GL_SHADER_OBJECT_ARB 0x8B48 +#define GL_OBJECT_TYPE_ARB 0x8B4E +#define GL_OBJECT_SUBTYPE_ARB 0x8B4F +#define GL_FLOAT_VEC2_ARB 0x8B50 +#define GL_FLOAT_VEC3_ARB 0x8B51 +#define GL_FLOAT_VEC4_ARB 0x8B52 +#define GL_INT_VEC2_ARB 0x8B53 +#define GL_INT_VEC3_ARB 0x8B54 +#define GL_INT_VEC4_ARB 0x8B55 +#define GL_BOOL_ARB 0x8B56 +#define GL_BOOL_VEC2_ARB 0x8B57 +#define GL_BOOL_VEC3_ARB 0x8B58 +#define GL_BOOL_VEC4_ARB 0x8B59 +#define GL_FLOAT_MAT2_ARB 0x8B5A +#define GL_FLOAT_MAT3_ARB 0x8B5B +#define GL_FLOAT_MAT4_ARB 0x8B5C +#define GL_SAMPLER_1D_ARB 0x8B5D +#define GL_SAMPLER_2D_ARB 0x8B5E +#define GL_SAMPLER_3D_ARB 0x8B5F +#define GL_SAMPLER_CUBE_ARB 0x8B60 +#define GL_SAMPLER_1D_SHADOW_ARB 0x8B61 +#define GL_SAMPLER_2D_SHADOW_ARB 0x8B62 +#define GL_SAMPLER_2D_RECT_ARB 0x8B63 +#define GL_SAMPLER_2D_RECT_SHADOW_ARB 0x8B64 +#define GL_OBJECT_DELETE_STATUS_ARB 0x8B80 +#define GL_OBJECT_COMPILE_STATUS_ARB 0x8B81 +#define GL_OBJECT_LINK_STATUS_ARB 0x8B82 +#define GL_OBJECT_VALIDATE_STATUS_ARB 0x8B83 +#define GL_OBJECT_INFO_LOG_LENGTH_ARB 0x8B84 +#define GL_OBJECT_ATTACHED_OBJECTS_ARB 0x8B85 +#define GL_OBJECT_ACTIVE_UNIFORMS_ARB 0x8B86 +#define GL_OBJECT_ACTIVE_UNIFORM_MAX_LENGTH_ARB 0x8B87 +#define GL_OBJECT_SHADER_SOURCE_LENGTH_ARB 0x8B88 +#endif + +#ifndef GL_ARB_vertex_shader +#define GL_VERTEX_SHADER_ARB 0x8B31 +#define GL_MAX_VERTEX_UNIFORM_COMPONENTS_ARB 0x8B4A +#define GL_MAX_VARYING_FLOATS_ARB 0x8B4B +#define GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB 0x8B4C +#define GL_MAX_COMBINED_TEXTURE_IMAGE_UNITS_ARB 0x8B4D +#define GL_OBJECT_ACTIVE_ATTRIBUTES_ARB 0x8B89 +#define GL_OBJECT_ACTIVE_ATTRIBUTE_MAX_LENGTH_ARB 0x8B8A +#endif + +#ifndef GL_ARB_fragment_shader +#define GL_FRAGMENT_SHADER_ARB 0x8B30 +#define GL_MAX_FRAGMENT_UNIFORM_COMPONENTS_ARB 0x8B49 +#define GL_FRAGMENT_SHADER_DERIVATIVE_HINT_ARB 0x8B8B +#endif + +#ifndef GL_ARB_shading_language_100 +#define GL_SHADING_LANGUAGE_VERSION_ARB 0x8B8C +#endif + +#ifndef GL_ARB_texture_non_power_of_two +#endif + +#ifndef GL_ARB_point_sprite +#define GL_POINT_SPRITE_ARB 0x8861 +#define GL_COORD_REPLACE_ARB 0x8862 +#endif + +#ifndef GL_ARB_fragment_program_shadow +#endif + +#ifndef GL_ARB_draw_buffers +#define GL_MAX_DRAW_BUFFERS_ARB 0x8824 +#define GL_DRAW_BUFFER0_ARB 0x8825 +#define GL_DRAW_BUFFER1_ARB 0x8826 +#define GL_DRAW_BUFFER2_ARB 0x8827 +#define GL_DRAW_BUFFER3_ARB 0x8828 +#define GL_DRAW_BUFFER4_ARB 0x8829 +#define GL_DRAW_BUFFER5_ARB 0x882A +#define GL_DRAW_BUFFER6_ARB 0x882B +#define GL_DRAW_BUFFER7_ARB 0x882C +#define GL_DRAW_BUFFER8_ARB 0x882D +#define GL_DRAW_BUFFER9_ARB 0x882E +#define GL_DRAW_BUFFER10_ARB 0x882F +#define GL_DRAW_BUFFER11_ARB 0x8830 +#define GL_DRAW_BUFFER12_ARB 0x8831 +#define GL_DRAW_BUFFER13_ARB 0x8832 +#define GL_DRAW_BUFFER14_ARB 0x8833 +#define GL_DRAW_BUFFER15_ARB 0x8834 +#endif + +#ifndef GL_ARB_texture_rectangle +#define GL_TEXTURE_RECTANGLE_ARB 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE_ARB 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE_ARB 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE_ARB 0x84F8 +#endif + +#ifndef GL_ARB_color_buffer_float +#define GL_RGBA_FLOAT_MODE_ARB 0x8820 +#define GL_CLAMP_VERTEX_COLOR_ARB 0x891A +#define GL_CLAMP_FRAGMENT_COLOR_ARB 0x891B +#define GL_CLAMP_READ_COLOR_ARB 0x891C +#define GL_FIXED_ONLY_ARB 0x891D +#endif + +#ifndef GL_ARB_half_float_pixel +#define GL_HALF_FLOAT_ARB 0x140B +#endif + +#ifndef GL_ARB_texture_float +#define GL_TEXTURE_RED_TYPE_ARB 0x8C10 +#define GL_TEXTURE_GREEN_TYPE_ARB 0x8C11 +#define GL_TEXTURE_BLUE_TYPE_ARB 0x8C12 +#define GL_TEXTURE_ALPHA_TYPE_ARB 0x8C13 +#define GL_TEXTURE_LUMINANCE_TYPE_ARB 0x8C14 +#define GL_TEXTURE_INTENSITY_TYPE_ARB 0x8C15 +#define GL_TEXTURE_DEPTH_TYPE_ARB 0x8C16 +#define GL_UNSIGNED_NORMALIZED_ARB 0x8C17 +#define GL_RGBA32F_ARB 0x8814 +#define GL_RGB32F_ARB 0x8815 +#define GL_ALPHA32F_ARB 0x8816 +#define GL_INTENSITY32F_ARB 0x8817 +#define GL_LUMINANCE32F_ARB 0x8818 +#define GL_LUMINANCE_ALPHA32F_ARB 0x8819 +#define GL_RGBA16F_ARB 0x881A +#define GL_RGB16F_ARB 0x881B +#define GL_ALPHA16F_ARB 0x881C +#define GL_INTENSITY16F_ARB 0x881D +#define GL_LUMINANCE16F_ARB 0x881E +#define GL_LUMINANCE_ALPHA16F_ARB 0x881F +#endif + +#ifndef GL_ARB_pixel_buffer_object +#define GL_PIXEL_PACK_BUFFER_ARB 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_ARB 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_ARB 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_ARB 0x88EF +#endif + +#ifndef GL_EXT_abgr +#define GL_ABGR_EXT 0x8000 +#endif + +#ifndef GL_EXT_blend_color +#define GL_CONSTANT_COLOR_EXT 0x8001 +#define GL_ONE_MINUS_CONSTANT_COLOR_EXT 0x8002 +#define GL_CONSTANT_ALPHA_EXT 0x8003 +#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT 0x8004 +#define GL_BLEND_COLOR_EXT 0x8005 +#endif + +#ifndef GL_EXT_polygon_offset +#define GL_POLYGON_OFFSET_EXT 0x8037 +#define GL_POLYGON_OFFSET_FACTOR_EXT 0x8038 +#define GL_POLYGON_OFFSET_BIAS_EXT 0x8039 +#endif + +#ifndef GL_EXT_texture +#define GL_ALPHA4_EXT 0x803B +#define GL_ALPHA8_EXT 0x803C +#define GL_ALPHA12_EXT 0x803D +#define GL_ALPHA16_EXT 0x803E +#define GL_LUMINANCE4_EXT 0x803F +#define GL_LUMINANCE8_EXT 0x8040 +#define GL_LUMINANCE12_EXT 0x8041 +#define GL_LUMINANCE16_EXT 0x8042 +#define GL_LUMINANCE4_ALPHA4_EXT 0x8043 +#define GL_LUMINANCE6_ALPHA2_EXT 0x8044 +#define GL_LUMINANCE8_ALPHA8_EXT 0x8045 +#define GL_LUMINANCE12_ALPHA4_EXT 0x8046 +#define GL_LUMINANCE12_ALPHA12_EXT 0x8047 +#define GL_LUMINANCE16_ALPHA16_EXT 0x8048 +#define GL_INTENSITY_EXT 0x8049 +#define GL_INTENSITY4_EXT 0x804A +#define GL_INTENSITY8_EXT 0x804B +#define GL_INTENSITY12_EXT 0x804C +#define GL_INTENSITY16_EXT 0x804D +#define GL_RGB2_EXT 0x804E +#define GL_RGB4_EXT 0x804F +#define GL_RGB5_EXT 0x8050 +#define GL_RGB8_EXT 0x8051 +#define GL_RGB10_EXT 0x8052 +#define GL_RGB12_EXT 0x8053 +#define GL_RGB16_EXT 0x8054 +#define GL_RGBA2_EXT 0x8055 +#define GL_RGBA4_EXT 0x8056 +#define GL_RGB5_A1_EXT 0x8057 +#define GL_RGBA8_EXT 0x8058 +#define GL_RGB10_A2_EXT 0x8059 +#define GL_RGBA12_EXT 0x805A +#define GL_RGBA16_EXT 0x805B +#define GL_TEXTURE_RED_SIZE_EXT 0x805C +#define GL_TEXTURE_GREEN_SIZE_EXT 0x805D +#define GL_TEXTURE_BLUE_SIZE_EXT 0x805E +#define GL_TEXTURE_ALPHA_SIZE_EXT 0x805F +#define GL_TEXTURE_LUMINANCE_SIZE_EXT 0x8060 +#define GL_TEXTURE_INTENSITY_SIZE_EXT 0x8061 +#define GL_REPLACE_EXT 0x8062 +#define GL_PROXY_TEXTURE_1D_EXT 0x8063 +#define GL_PROXY_TEXTURE_2D_EXT 0x8064 +#define GL_TEXTURE_TOO_LARGE_EXT 0x8065 +#endif + +#ifndef GL_EXT_texture3D +#define GL_PACK_SKIP_IMAGES_EXT 0x806B +#define GL_PACK_IMAGE_HEIGHT_EXT 0x806C +#define GL_UNPACK_SKIP_IMAGES_EXT 0x806D +#define GL_UNPACK_IMAGE_HEIGHT_EXT 0x806E +#define GL_TEXTURE_3D_EXT 0x806F +#define GL_PROXY_TEXTURE_3D_EXT 0x8070 +#define GL_TEXTURE_DEPTH_EXT 0x8071 +#define GL_TEXTURE_WRAP_R_EXT 0x8072 +#define GL_MAX_3D_TEXTURE_SIZE_EXT 0x8073 +#endif + +#ifndef GL_SGIS_texture_filter4 +#define GL_FILTER4_SGIS 0x8146 +#define GL_TEXTURE_FILTER4_SIZE_SGIS 0x8147 +#endif + +#ifndef GL_EXT_subtexture +#endif + +#ifndef GL_EXT_copy_texture +#endif + +#ifndef GL_EXT_histogram +#define GL_HISTOGRAM_EXT 0x8024 +#define GL_PROXY_HISTOGRAM_EXT 0x8025 +#define GL_HISTOGRAM_WIDTH_EXT 0x8026 +#define GL_HISTOGRAM_FORMAT_EXT 0x8027 +#define GL_HISTOGRAM_RED_SIZE_EXT 0x8028 +#define GL_HISTOGRAM_GREEN_SIZE_EXT 0x8029 +#define GL_HISTOGRAM_BLUE_SIZE_EXT 0x802A +#define GL_HISTOGRAM_ALPHA_SIZE_EXT 0x802B +#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT 0x802C +#define GL_HISTOGRAM_SINK_EXT 0x802D +#define GL_MINMAX_EXT 0x802E +#define GL_MINMAX_FORMAT_EXT 0x802F +#define GL_MINMAX_SINK_EXT 0x8030 +#define GL_TABLE_TOO_LARGE_EXT 0x8031 +#endif + +#ifndef GL_EXT_convolution +#define GL_CONVOLUTION_1D_EXT 0x8010 +#define GL_CONVOLUTION_2D_EXT 0x8011 +#define GL_SEPARABLE_2D_EXT 0x8012 +#define GL_CONVOLUTION_BORDER_MODE_EXT 0x8013 +#define GL_CONVOLUTION_FILTER_SCALE_EXT 0x8014 +#define GL_CONVOLUTION_FILTER_BIAS_EXT 0x8015 +#define GL_REDUCE_EXT 0x8016 +#define GL_CONVOLUTION_FORMAT_EXT 0x8017 +#define GL_CONVOLUTION_WIDTH_EXT 0x8018 +#define GL_CONVOLUTION_HEIGHT_EXT 0x8019 +#define GL_MAX_CONVOLUTION_WIDTH_EXT 0x801A +#define GL_MAX_CONVOLUTION_HEIGHT_EXT 0x801B +#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C +#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D +#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E +#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F +#define GL_POST_CONVOLUTION_RED_BIAS_EXT 0x8020 +#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021 +#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022 +#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023 +#endif + +#ifndef GL_SGI_color_matrix +#define GL_COLOR_MATRIX_SGI 0x80B1 +#define GL_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B2 +#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3 +#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4 +#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5 +#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6 +#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7 +#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8 +#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9 +#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA +#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB +#endif + +#ifndef GL_SGI_color_table +#define GL_COLOR_TABLE_SGI 0x80D0 +#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1 +#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2 +#define GL_PROXY_COLOR_TABLE_SGI 0x80D3 +#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4 +#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5 +#define GL_COLOR_TABLE_SCALE_SGI 0x80D6 +#define GL_COLOR_TABLE_BIAS_SGI 0x80D7 +#define GL_COLOR_TABLE_FORMAT_SGI 0x80D8 +#define GL_COLOR_TABLE_WIDTH_SGI 0x80D9 +#define GL_COLOR_TABLE_RED_SIZE_SGI 0x80DA +#define GL_COLOR_TABLE_GREEN_SIZE_SGI 0x80DB +#define GL_COLOR_TABLE_BLUE_SIZE_SGI 0x80DC +#define GL_COLOR_TABLE_ALPHA_SIZE_SGI 0x80DD +#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE +#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF +#endif + +#ifndef GL_SGIS_pixel_texture +#define GL_PIXEL_TEXTURE_SGIS 0x8353 +#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354 +#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355 +#define GL_PIXEL_GROUP_COLOR_SGIS 0x8356 +#endif + +#ifndef GL_SGIX_pixel_texture +#define GL_PIXEL_TEX_GEN_SGIX 0x8139 +#define GL_PIXEL_TEX_GEN_MODE_SGIX 0x832B +#endif + +#ifndef GL_SGIS_texture4D +#define GL_PACK_SKIP_VOLUMES_SGIS 0x8130 +#define GL_PACK_IMAGE_DEPTH_SGIS 0x8131 +#define GL_UNPACK_SKIP_VOLUMES_SGIS 0x8132 +#define GL_UNPACK_IMAGE_DEPTH_SGIS 0x8133 +#define GL_TEXTURE_4D_SGIS 0x8134 +#define GL_PROXY_TEXTURE_4D_SGIS 0x8135 +#define GL_TEXTURE_4DSIZE_SGIS 0x8136 +#define GL_TEXTURE_WRAP_Q_SGIS 0x8137 +#define GL_MAX_4D_TEXTURE_SIZE_SGIS 0x8138 +#define GL_TEXTURE_4D_BINDING_SGIS 0x814F +#endif + +#ifndef GL_SGI_texture_color_table +#define GL_TEXTURE_COLOR_TABLE_SGI 0x80BC +#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI 0x80BD +#endif + +#ifndef GL_EXT_cmyka +#define GL_CMYK_EXT 0x800C +#define GL_CMYKA_EXT 0x800D +#define GL_PACK_CMYK_HINT_EXT 0x800E +#define GL_UNPACK_CMYK_HINT_EXT 0x800F +#endif + +#ifndef GL_EXT_texture_object +#define GL_TEXTURE_PRIORITY_EXT 0x8066 +#define GL_TEXTURE_RESIDENT_EXT 0x8067 +#define GL_TEXTURE_1D_BINDING_EXT 0x8068 +#define GL_TEXTURE_2D_BINDING_EXT 0x8069 +#define GL_TEXTURE_3D_BINDING_EXT 0x806A +#endif + +#ifndef GL_SGIS_detail_texture +#define GL_DETAIL_TEXTURE_2D_SGIS 0x8095 +#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096 +#define GL_LINEAR_DETAIL_SGIS 0x8097 +#define GL_LINEAR_DETAIL_ALPHA_SGIS 0x8098 +#define GL_LINEAR_DETAIL_COLOR_SGIS 0x8099 +#define GL_DETAIL_TEXTURE_LEVEL_SGIS 0x809A +#define GL_DETAIL_TEXTURE_MODE_SGIS 0x809B +#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C +#endif + +#ifndef GL_SGIS_sharpen_texture +#define GL_LINEAR_SHARPEN_SGIS 0x80AD +#define GL_LINEAR_SHARPEN_ALPHA_SGIS 0x80AE +#define GL_LINEAR_SHARPEN_COLOR_SGIS 0x80AF +#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0 +#endif + +#ifndef GL_EXT_packed_pixels +#define GL_UNSIGNED_BYTE_3_3_2_EXT 0x8032 +#define GL_UNSIGNED_SHORT_4_4_4_4_EXT 0x8033 +#define GL_UNSIGNED_SHORT_5_5_5_1_EXT 0x8034 +#define GL_UNSIGNED_INT_8_8_8_8_EXT 0x8035 +#define GL_UNSIGNED_INT_10_10_10_2_EXT 0x8036 +#endif + +#ifndef GL_SGIS_texture_lod +#define GL_TEXTURE_MIN_LOD_SGIS 0x813A +#define GL_TEXTURE_MAX_LOD_SGIS 0x813B +#define GL_TEXTURE_BASE_LEVEL_SGIS 0x813C +#define GL_TEXTURE_MAX_LEVEL_SGIS 0x813D +#endif + +#ifndef GL_SGIS_multisample +#define GL_MULTISAMPLE_SGIS 0x809D +#define GL_SAMPLE_ALPHA_TO_MASK_SGIS 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_SGIS 0x809F +#define GL_SAMPLE_MASK_SGIS 0x80A0 +#define GL_1PASS_SGIS 0x80A1 +#define GL_2PASS_0_SGIS 0x80A2 +#define GL_2PASS_1_SGIS 0x80A3 +#define GL_4PASS_0_SGIS 0x80A4 +#define GL_4PASS_1_SGIS 0x80A5 +#define GL_4PASS_2_SGIS 0x80A6 +#define GL_4PASS_3_SGIS 0x80A7 +#define GL_SAMPLE_BUFFERS_SGIS 0x80A8 +#define GL_SAMPLES_SGIS 0x80A9 +#define GL_SAMPLE_MASK_VALUE_SGIS 0x80AA +#define GL_SAMPLE_MASK_INVERT_SGIS 0x80AB +#define GL_SAMPLE_PATTERN_SGIS 0x80AC +#endif + +#ifndef GL_EXT_rescale_normal +#define GL_RESCALE_NORMAL_EXT 0x803A +#endif + +#ifndef GL_EXT_vertex_array +#define GL_VERTEX_ARRAY_EXT 0x8074 +#define GL_NORMAL_ARRAY_EXT 0x8075 +#define GL_COLOR_ARRAY_EXT 0x8076 +#define GL_INDEX_ARRAY_EXT 0x8077 +#define GL_TEXTURE_COORD_ARRAY_EXT 0x8078 +#define GL_EDGE_FLAG_ARRAY_EXT 0x8079 +#define GL_VERTEX_ARRAY_SIZE_EXT 0x807A +#define GL_VERTEX_ARRAY_TYPE_EXT 0x807B +#define GL_VERTEX_ARRAY_STRIDE_EXT 0x807C +#define GL_VERTEX_ARRAY_COUNT_EXT 0x807D +#define GL_NORMAL_ARRAY_TYPE_EXT 0x807E +#define GL_NORMAL_ARRAY_STRIDE_EXT 0x807F +#define GL_NORMAL_ARRAY_COUNT_EXT 0x8080 +#define GL_COLOR_ARRAY_SIZE_EXT 0x8081 +#define GL_COLOR_ARRAY_TYPE_EXT 0x8082 +#define GL_COLOR_ARRAY_STRIDE_EXT 0x8083 +#define GL_COLOR_ARRAY_COUNT_EXT 0x8084 +#define GL_INDEX_ARRAY_TYPE_EXT 0x8085 +#define GL_INDEX_ARRAY_STRIDE_EXT 0x8086 +#define GL_INDEX_ARRAY_COUNT_EXT 0x8087 +#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT 0x8088 +#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT 0x8089 +#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A +#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT 0x808B +#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT 0x808C +#define GL_EDGE_FLAG_ARRAY_COUNT_EXT 0x808D +#define GL_VERTEX_ARRAY_POINTER_EXT 0x808E +#define GL_NORMAL_ARRAY_POINTER_EXT 0x808F +#define GL_COLOR_ARRAY_POINTER_EXT 0x8090 +#define GL_INDEX_ARRAY_POINTER_EXT 0x8091 +#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092 +#define GL_EDGE_FLAG_ARRAY_POINTER_EXT 0x8093 +#endif + +#ifndef GL_EXT_misc_attribute +#endif + +#ifndef GL_SGIS_generate_mipmap +#define GL_GENERATE_MIPMAP_SGIS 0x8191 +#define GL_GENERATE_MIPMAP_HINT_SGIS 0x8192 +#endif + +#ifndef GL_SGIX_clipmap +#define GL_LINEAR_CLIPMAP_LINEAR_SGIX 0x8170 +#define GL_TEXTURE_CLIPMAP_CENTER_SGIX 0x8171 +#define GL_TEXTURE_CLIPMAP_FRAME_SGIX 0x8172 +#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX 0x8173 +#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174 +#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175 +#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX 0x8176 +#define GL_MAX_CLIPMAP_DEPTH_SGIX 0x8177 +#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178 +#define GL_NEAREST_CLIPMAP_NEAREST_SGIX 0x844D +#define GL_NEAREST_CLIPMAP_LINEAR_SGIX 0x844E +#define GL_LINEAR_CLIPMAP_NEAREST_SGIX 0x844F +#endif + +#ifndef GL_SGIX_shadow +#define GL_TEXTURE_COMPARE_SGIX 0x819A +#define GL_TEXTURE_COMPARE_OPERATOR_SGIX 0x819B +#define GL_TEXTURE_LEQUAL_R_SGIX 0x819C +#define GL_TEXTURE_GEQUAL_R_SGIX 0x819D +#endif + +#ifndef GL_SGIS_texture_edge_clamp +#define GL_CLAMP_TO_EDGE_SGIS 0x812F +#endif + +#ifndef GL_SGIS_texture_border_clamp +#define GL_CLAMP_TO_BORDER_SGIS 0x812D +#endif + +#ifndef GL_EXT_blend_minmax +#define GL_FUNC_ADD_EXT 0x8006 +#define GL_MIN_EXT 0x8007 +#define GL_MAX_EXT 0x8008 +#define GL_BLEND_EQUATION_EXT 0x8009 +#endif + +#ifndef GL_EXT_blend_subtract +#define GL_FUNC_SUBTRACT_EXT 0x800A +#define GL_FUNC_REVERSE_SUBTRACT_EXT 0x800B +#endif + +#ifndef GL_EXT_blend_logic_op +#endif + +#ifndef GL_SGIX_interlace +#define GL_INTERLACE_SGIX 0x8094 +#endif + +#ifndef GL_SGIX_pixel_tiles +#define GL_PIXEL_TILE_BEST_ALIGNMENT_SGIX 0x813E +#define GL_PIXEL_TILE_CACHE_INCREMENT_SGIX 0x813F +#define GL_PIXEL_TILE_WIDTH_SGIX 0x8140 +#define GL_PIXEL_TILE_HEIGHT_SGIX 0x8141 +#define GL_PIXEL_TILE_GRID_WIDTH_SGIX 0x8142 +#define GL_PIXEL_TILE_GRID_HEIGHT_SGIX 0x8143 +#define GL_PIXEL_TILE_GRID_DEPTH_SGIX 0x8144 +#define GL_PIXEL_TILE_CACHE_SIZE_SGIX 0x8145 +#endif + +#ifndef GL_SGIS_texture_select +#define GL_DUAL_ALPHA4_SGIS 0x8110 +#define GL_DUAL_ALPHA8_SGIS 0x8111 +#define GL_DUAL_ALPHA12_SGIS 0x8112 +#define GL_DUAL_ALPHA16_SGIS 0x8113 +#define GL_DUAL_LUMINANCE4_SGIS 0x8114 +#define GL_DUAL_LUMINANCE8_SGIS 0x8115 +#define GL_DUAL_LUMINANCE12_SGIS 0x8116 +#define GL_DUAL_LUMINANCE16_SGIS 0x8117 +#define GL_DUAL_INTENSITY4_SGIS 0x8118 +#define GL_DUAL_INTENSITY8_SGIS 0x8119 +#define GL_DUAL_INTENSITY12_SGIS 0x811A +#define GL_DUAL_INTENSITY16_SGIS 0x811B +#define GL_DUAL_LUMINANCE_ALPHA4_SGIS 0x811C +#define GL_DUAL_LUMINANCE_ALPHA8_SGIS 0x811D +#define GL_QUAD_ALPHA4_SGIS 0x811E +#define GL_QUAD_ALPHA8_SGIS 0x811F +#define GL_QUAD_LUMINANCE4_SGIS 0x8120 +#define GL_QUAD_LUMINANCE8_SGIS 0x8121 +#define GL_QUAD_INTENSITY4_SGIS 0x8122 +#define GL_QUAD_INTENSITY8_SGIS 0x8123 +#define GL_DUAL_TEXTURE_SELECT_SGIS 0x8124 +#define GL_QUAD_TEXTURE_SELECT_SGIS 0x8125 +#endif + +#ifndef GL_SGIX_sprite +#define GL_SPRITE_SGIX 0x8148 +#define GL_SPRITE_MODE_SGIX 0x8149 +#define GL_SPRITE_AXIS_SGIX 0x814A +#define GL_SPRITE_TRANSLATION_SGIX 0x814B +#define GL_SPRITE_AXIAL_SGIX 0x814C +#define GL_SPRITE_OBJECT_ALIGNED_SGIX 0x814D +#define GL_SPRITE_EYE_ALIGNED_SGIX 0x814E +#endif + +#ifndef GL_SGIX_texture_multi_buffer +#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E +#endif + +#ifndef GL_EXT_point_parameters +#define GL_POINT_SIZE_MIN_EXT 0x8126 +#define GL_POINT_SIZE_MAX_EXT 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_EXT 0x8128 +#define GL_DISTANCE_ATTENUATION_EXT 0x8129 +#endif + +#ifndef GL_SGIS_point_parameters +#define GL_POINT_SIZE_MIN_SGIS 0x8126 +#define GL_POINT_SIZE_MAX_SGIS 0x8127 +#define GL_POINT_FADE_THRESHOLD_SIZE_SGIS 0x8128 +#define GL_DISTANCE_ATTENUATION_SGIS 0x8129 +#endif + +#ifndef GL_SGIX_instruments +#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180 +#define GL_INSTRUMENT_MEASUREMENTS_SGIX 0x8181 +#endif + +#ifndef GL_SGIX_texture_scale_bias +#define GL_POST_TEXTURE_FILTER_BIAS_SGIX 0x8179 +#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A +#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B +#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C +#endif + +#ifndef GL_SGIX_framezoom +#define GL_FRAMEZOOM_SGIX 0x818B +#define GL_FRAMEZOOM_FACTOR_SGIX 0x818C +#define GL_MAX_FRAMEZOOM_FACTOR_SGIX 0x818D +#endif + +#ifndef GL_SGIX_tag_sample_buffer +#endif + +#ifndef GL_FfdMaskSGIX +#define GL_TEXTURE_DEFORMATION_BIT_SGIX 0x00000001 +#define GL_GEOMETRY_DEFORMATION_BIT_SGIX 0x00000002 +#endif + +#ifndef GL_SGIX_polynomial_ffd +#define GL_GEOMETRY_DEFORMATION_SGIX 0x8194 +#define GL_TEXTURE_DEFORMATION_SGIX 0x8195 +#define GL_DEFORMATIONS_MASK_SGIX 0x8196 +#define GL_MAX_DEFORMATION_ORDER_SGIX 0x8197 +#endif + +#ifndef GL_SGIX_reference_plane +#define GL_REFERENCE_PLANE_SGIX 0x817D +#define GL_REFERENCE_PLANE_EQUATION_SGIX 0x817E +#endif + +#ifndef GL_SGIX_flush_raster +#endif + +#ifndef GL_SGIX_depth_texture +#define GL_DEPTH_COMPONENT16_SGIX 0x81A5 +#define GL_DEPTH_COMPONENT24_SGIX 0x81A6 +#define GL_DEPTH_COMPONENT32_SGIX 0x81A7 +#endif + +#ifndef GL_SGIS_fog_function +#define GL_FOG_FUNC_SGIS 0x812A +#define GL_FOG_FUNC_POINTS_SGIS 0x812B +#define GL_MAX_FOG_FUNC_POINTS_SGIS 0x812C +#endif + +#ifndef GL_SGIX_fog_offset +#define GL_FOG_OFFSET_SGIX 0x8198 +#define GL_FOG_OFFSET_VALUE_SGIX 0x8199 +#endif + +#ifndef GL_HP_image_transform +#define GL_IMAGE_SCALE_X_HP 0x8155 +#define GL_IMAGE_SCALE_Y_HP 0x8156 +#define GL_IMAGE_TRANSLATE_X_HP 0x8157 +#define GL_IMAGE_TRANSLATE_Y_HP 0x8158 +#define GL_IMAGE_ROTATE_ANGLE_HP 0x8159 +#define GL_IMAGE_ROTATE_ORIGIN_X_HP 0x815A +#define GL_IMAGE_ROTATE_ORIGIN_Y_HP 0x815B +#define GL_IMAGE_MAG_FILTER_HP 0x815C +#define GL_IMAGE_MIN_FILTER_HP 0x815D +#define GL_IMAGE_CUBIC_WEIGHT_HP 0x815E +#define GL_CUBIC_HP 0x815F +#define GL_AVERAGE_HP 0x8160 +#define GL_IMAGE_TRANSFORM_2D_HP 0x8161 +#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162 +#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163 +#endif + +#ifndef GL_HP_convolution_border_modes +#define GL_IGNORE_BORDER_HP 0x8150 +#define GL_CONSTANT_BORDER_HP 0x8151 +#define GL_REPLICATE_BORDER_HP 0x8153 +#define GL_CONVOLUTION_BORDER_COLOR_HP 0x8154 +#endif + +#ifndef GL_INGR_palette_buffer +#endif + +#ifndef GL_SGIX_texture_add_env +#define GL_TEXTURE_ENV_BIAS_SGIX 0x80BE +#endif + +#ifndef GL_EXT_color_subtable +#endif + +#ifndef GL_PGI_vertex_hints +#define GL_VERTEX_DATA_HINT_PGI 0x1A22A +#define GL_VERTEX_CONSISTENT_HINT_PGI 0x1A22B +#define GL_MATERIAL_SIDE_HINT_PGI 0x1A22C +#define GL_MAX_VERTEX_HINT_PGI 0x1A22D +#define GL_COLOR3_BIT_PGI 0x00010000 +#define GL_COLOR4_BIT_PGI 0x00020000 +#define GL_EDGEFLAG_BIT_PGI 0x00040000 +#define GL_INDEX_BIT_PGI 0x00080000 +#define GL_MAT_AMBIENT_BIT_PGI 0x00100000 +#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000 +#define GL_MAT_DIFFUSE_BIT_PGI 0x00400000 +#define GL_MAT_EMISSION_BIT_PGI 0x00800000 +#define GL_MAT_COLOR_INDEXES_BIT_PGI 0x01000000 +#define GL_MAT_SHININESS_BIT_PGI 0x02000000 +#define GL_MAT_SPECULAR_BIT_PGI 0x04000000 +#define GL_NORMAL_BIT_PGI 0x08000000 +#define GL_TEXCOORD1_BIT_PGI 0x10000000 +#define GL_TEXCOORD2_BIT_PGI 0x20000000 +#define GL_TEXCOORD3_BIT_PGI 0x40000000 +#define GL_TEXCOORD4_BIT_PGI 0x80000000 +#define GL_VERTEX23_BIT_PGI 0x00000004 +#define GL_VERTEX4_BIT_PGI 0x00000008 +#endif + +#ifndef GL_PGI_misc_hints +#define GL_PREFER_DOUBLEBUFFER_HINT_PGI 0x1A1F8 +#define GL_CONSERVE_MEMORY_HINT_PGI 0x1A1FD +#define GL_RECLAIM_MEMORY_HINT_PGI 0x1A1FE +#define GL_NATIVE_GRAPHICS_HANDLE_PGI 0x1A202 +#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203 +#define GL_NATIVE_GRAPHICS_END_HINT_PGI 0x1A204 +#define GL_ALWAYS_FAST_HINT_PGI 0x1A20C +#define GL_ALWAYS_SOFT_HINT_PGI 0x1A20D +#define GL_ALLOW_DRAW_OBJ_HINT_PGI 0x1A20E +#define GL_ALLOW_DRAW_WIN_HINT_PGI 0x1A20F +#define GL_ALLOW_DRAW_FRG_HINT_PGI 0x1A210 +#define GL_ALLOW_DRAW_MEM_HINT_PGI 0x1A211 +#define GL_STRICT_DEPTHFUNC_HINT_PGI 0x1A216 +#define GL_STRICT_LIGHTING_HINT_PGI 0x1A217 +#define GL_STRICT_SCISSOR_HINT_PGI 0x1A218 +#define GL_FULL_STIPPLE_HINT_PGI 0x1A219 +#define GL_CLIP_NEAR_HINT_PGI 0x1A220 +#define GL_CLIP_FAR_HINT_PGI 0x1A221 +#define GL_WIDE_LINE_HINT_PGI 0x1A222 +#define GL_BACK_NORMALS_HINT_PGI 0x1A223 +#endif + +#ifndef GL_EXT_paletted_texture +#define GL_COLOR_INDEX1_EXT 0x80E2 +#define GL_COLOR_INDEX2_EXT 0x80E3 +#define GL_COLOR_INDEX4_EXT 0x80E4 +#define GL_COLOR_INDEX8_EXT 0x80E5 +#define GL_COLOR_INDEX12_EXT 0x80E6 +#define GL_COLOR_INDEX16_EXT 0x80E7 +#define GL_TEXTURE_INDEX_SIZE_EXT 0x80ED +#endif + +#ifndef GL_EXT_clip_volume_hint +#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT 0x80F0 +#endif + +#ifndef GL_SGIX_list_priority +#define GL_LIST_PRIORITY_SGIX 0x8182 +#endif + +#ifndef GL_SGIX_ir_instrument1 +#define GL_IR_INSTRUMENT1_SGIX 0x817F +#endif + +#ifndef GL_SGIX_calligraphic_fragment +#define GL_CALLIGRAPHIC_FRAGMENT_SGIX 0x8183 +#endif + +#ifndef GL_SGIX_texture_lod_bias +#define GL_TEXTURE_LOD_BIAS_S_SGIX 0x818E +#define GL_TEXTURE_LOD_BIAS_T_SGIX 0x818F +#define GL_TEXTURE_LOD_BIAS_R_SGIX 0x8190 +#endif + +#ifndef GL_SGIX_shadow_ambient +#define GL_SHADOW_AMBIENT_SGIX 0x80BF +#endif + +#ifndef GL_EXT_index_texture +#endif + +#ifndef GL_EXT_index_material +#define GL_INDEX_MATERIAL_EXT 0x81B8 +#define GL_INDEX_MATERIAL_PARAMETER_EXT 0x81B9 +#define GL_INDEX_MATERIAL_FACE_EXT 0x81BA +#endif + +#ifndef GL_EXT_index_func +#define GL_INDEX_TEST_EXT 0x81B5 +#define GL_INDEX_TEST_FUNC_EXT 0x81B6 +#define GL_INDEX_TEST_REF_EXT 0x81B7 +#endif + +#ifndef GL_EXT_index_array_formats +#define GL_IUI_V2F_EXT 0x81AD +#define GL_IUI_V3F_EXT 0x81AE +#define GL_IUI_N3F_V2F_EXT 0x81AF +#define GL_IUI_N3F_V3F_EXT 0x81B0 +#define GL_T2F_IUI_V2F_EXT 0x81B1 +#define GL_T2F_IUI_V3F_EXT 0x81B2 +#define GL_T2F_IUI_N3F_V2F_EXT 0x81B3 +#define GL_T2F_IUI_N3F_V3F_EXT 0x81B4 +#endif + +#ifndef GL_EXT_compiled_vertex_array +#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT 0x81A8 +#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT 0x81A9 +#endif + +#ifndef GL_EXT_cull_vertex +#define GL_CULL_VERTEX_EXT 0x81AA +#define GL_CULL_VERTEX_EYE_POSITION_EXT 0x81AB +#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC +#endif + +#ifndef GL_SGIX_ycrcb +#define GL_YCRCB_422_SGIX 0x81BB +#define GL_YCRCB_444_SGIX 0x81BC +#endif + +#ifndef GL_SGIX_fragment_lighting +#define GL_FRAGMENT_LIGHTING_SGIX 0x8400 +#define GL_FRAGMENT_COLOR_MATERIAL_SGIX 0x8401 +#define GL_FRAGMENT_COLOR_MATERIAL_FACE_SGIX 0x8402 +#define GL_FRAGMENT_COLOR_MATERIAL_PARAMETER_SGIX 0x8403 +#define GL_MAX_FRAGMENT_LIGHTS_SGIX 0x8404 +#define GL_MAX_ACTIVE_LIGHTS_SGIX 0x8405 +#define GL_CURRENT_RASTER_NORMAL_SGIX 0x8406 +#define GL_LIGHT_ENV_MODE_SGIX 0x8407 +#define GL_FRAGMENT_LIGHT_MODEL_LOCAL_VIEWER_SGIX 0x8408 +#define GL_FRAGMENT_LIGHT_MODEL_TWO_SIDE_SGIX 0x8409 +#define GL_FRAGMENT_LIGHT_MODEL_AMBIENT_SGIX 0x840A +#define GL_FRAGMENT_LIGHT_MODEL_NORMAL_INTERPOLATION_SGIX 0x840B +#define GL_FRAGMENT_LIGHT0_SGIX 0x840C +#define GL_FRAGMENT_LIGHT1_SGIX 0x840D +#define GL_FRAGMENT_LIGHT2_SGIX 0x840E +#define GL_FRAGMENT_LIGHT3_SGIX 0x840F +#define GL_FRAGMENT_LIGHT4_SGIX 0x8410 +#define GL_FRAGMENT_LIGHT5_SGIX 0x8411 +#define GL_FRAGMENT_LIGHT6_SGIX 0x8412 +#define GL_FRAGMENT_LIGHT7_SGIX 0x8413 +#endif + +#ifndef GL_IBM_rasterpos_clip +#define GL_RASTER_POSITION_UNCLIPPED_IBM 0x19262 +#endif + +#ifndef GL_HP_texture_lighting +#define GL_TEXTURE_LIGHTING_MODE_HP 0x8167 +#define GL_TEXTURE_POST_SPECULAR_HP 0x8168 +#define GL_TEXTURE_PRE_SPECULAR_HP 0x8169 +#endif + +#ifndef GL_EXT_draw_range_elements +#define GL_MAX_ELEMENTS_VERTICES_EXT 0x80E8 +#define GL_MAX_ELEMENTS_INDICES_EXT 0x80E9 +#endif + +#ifndef GL_WIN_phong_shading +#define GL_PHONG_WIN 0x80EA +#define GL_PHONG_HINT_WIN 0x80EB +#endif + +#ifndef GL_WIN_specular_fog +#define GL_FOG_SPECULAR_TEXTURE_WIN 0x80EC +#endif + +#ifndef GL_EXT_light_texture +#define GL_FRAGMENT_MATERIAL_EXT 0x8349 +#define GL_FRAGMENT_NORMAL_EXT 0x834A +#define GL_FRAGMENT_COLOR_EXT 0x834C +#define GL_ATTENUATION_EXT 0x834D +#define GL_SHADOW_ATTENUATION_EXT 0x834E +#define GL_TEXTURE_APPLICATION_MODE_EXT 0x834F +#define GL_TEXTURE_LIGHT_EXT 0x8350 +#define GL_TEXTURE_MATERIAL_FACE_EXT 0x8351 +#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352 +/* reuse GL_FRAGMENT_DEPTH_EXT */ +#endif + +#ifndef GL_SGIX_blend_alpha_minmax +#define GL_ALPHA_MIN_SGIX 0x8320 +#define GL_ALPHA_MAX_SGIX 0x8321 +#endif + +#ifndef GL_SGIX_impact_pixel_texture +#define GL_PIXEL_TEX_GEN_Q_CEILING_SGIX 0x8184 +#define GL_PIXEL_TEX_GEN_Q_ROUND_SGIX 0x8185 +#define GL_PIXEL_TEX_GEN_Q_FLOOR_SGIX 0x8186 +#define GL_PIXEL_TEX_GEN_ALPHA_REPLACE_SGIX 0x8187 +#define GL_PIXEL_TEX_GEN_ALPHA_NO_REPLACE_SGIX 0x8188 +#define GL_PIXEL_TEX_GEN_ALPHA_LS_SGIX 0x8189 +#define GL_PIXEL_TEX_GEN_ALPHA_MS_SGIX 0x818A +#endif + +#ifndef GL_EXT_bgra +#define GL_BGR_EXT 0x80E0 +#define GL_BGRA_EXT 0x80E1 +#endif + +#ifndef GL_SGIX_async +#define GL_ASYNC_MARKER_SGIX 0x8329 +#endif + +#ifndef GL_SGIX_async_pixel +#define GL_ASYNC_TEX_IMAGE_SGIX 0x835C +#define GL_ASYNC_DRAW_PIXELS_SGIX 0x835D +#define GL_ASYNC_READ_PIXELS_SGIX 0x835E +#define GL_MAX_ASYNC_TEX_IMAGE_SGIX 0x835F +#define GL_MAX_ASYNC_DRAW_PIXELS_SGIX 0x8360 +#define GL_MAX_ASYNC_READ_PIXELS_SGIX 0x8361 +#endif + +#ifndef GL_SGIX_async_histogram +#define GL_ASYNC_HISTOGRAM_SGIX 0x832C +#define GL_MAX_ASYNC_HISTOGRAM_SGIX 0x832D +#endif + +#ifndef GL_INTEL_texture_scissor +#endif + +#ifndef GL_INTEL_parallel_arrays +#define GL_PARALLEL_ARRAYS_INTEL 0x83F4 +#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5 +#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6 +#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7 +#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8 +#endif + +#ifndef GL_HP_occlusion_test +#define GL_OCCLUSION_TEST_HP 0x8165 +#define GL_OCCLUSION_TEST_RESULT_HP 0x8166 +#endif + +#ifndef GL_EXT_pixel_transform +#define GL_PIXEL_TRANSFORM_2D_EXT 0x8330 +#define GL_PIXEL_MAG_FILTER_EXT 0x8331 +#define GL_PIXEL_MIN_FILTER_EXT 0x8332 +#define GL_PIXEL_CUBIC_WEIGHT_EXT 0x8333 +#define GL_CUBIC_EXT 0x8334 +#define GL_AVERAGE_EXT 0x8335 +#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336 +#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337 +#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT 0x8338 +#endif + +#ifndef GL_EXT_pixel_transform_color_table +#endif + +#ifndef GL_EXT_shared_texture_palette +#define GL_SHARED_TEXTURE_PALETTE_EXT 0x81FB +#endif + +#ifndef GL_EXT_separate_specular_color +#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT 0x81F8 +#define GL_SINGLE_COLOR_EXT 0x81F9 +#define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA +#endif + +#ifndef GL_EXT_secondary_color +#define GL_COLOR_SUM_EXT 0x8458 +#define GL_CURRENT_SECONDARY_COLOR_EXT 0x8459 +#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A +#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B +#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C +#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D +#define GL_SECONDARY_COLOR_ARRAY_EXT 0x845E +#endif + +#ifndef GL_EXT_texture_perturb_normal +#define GL_PERTURB_EXT 0x85AE +#define GL_TEXTURE_NORMAL_EXT 0x85AF +#endif + +#ifndef GL_EXT_multi_draw_arrays +#endif + +#ifndef GL_EXT_fog_coord +#define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 +#define GL_FOG_COORDINATE_EXT 0x8451 +#define GL_FRAGMENT_DEPTH_EXT 0x8452 +#define GL_CURRENT_FOG_COORDINATE_EXT 0x8453 +#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT 0x8454 +#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455 +#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456 +#define GL_FOG_COORDINATE_ARRAY_EXT 0x8457 +#endif + +#ifndef GL_REND_screen_coordinates +#define GL_SCREEN_COORDINATES_REND 0x8490 +#define GL_INVERTED_SCREEN_W_REND 0x8491 +#endif + +#ifndef GL_EXT_coordinate_frame +#define GL_TANGENT_ARRAY_EXT 0x8439 +#define GL_BINORMAL_ARRAY_EXT 0x843A +#define GL_CURRENT_TANGENT_EXT 0x843B +#define GL_CURRENT_BINORMAL_EXT 0x843C +#define GL_TANGENT_ARRAY_TYPE_EXT 0x843E +#define GL_TANGENT_ARRAY_STRIDE_EXT 0x843F +#define GL_BINORMAL_ARRAY_TYPE_EXT 0x8440 +#define GL_BINORMAL_ARRAY_STRIDE_EXT 0x8441 +#define GL_TANGENT_ARRAY_POINTER_EXT 0x8442 +#define GL_BINORMAL_ARRAY_POINTER_EXT 0x8443 +#define GL_MAP1_TANGENT_EXT 0x8444 +#define GL_MAP2_TANGENT_EXT 0x8445 +#define GL_MAP1_BINORMAL_EXT 0x8446 +#define GL_MAP2_BINORMAL_EXT 0x8447 +#endif + +#ifndef GL_EXT_texture_env_combine +#define GL_COMBINE_EXT 0x8570 +#define GL_COMBINE_RGB_EXT 0x8571 +#define GL_COMBINE_ALPHA_EXT 0x8572 +#define GL_RGB_SCALE_EXT 0x8573 +#define GL_ADD_SIGNED_EXT 0x8574 +#define GL_INTERPOLATE_EXT 0x8575 +#define GL_CONSTANT_EXT 0x8576 +#define GL_PRIMARY_COLOR_EXT 0x8577 +#define GL_PREVIOUS_EXT 0x8578 +#define GL_SOURCE0_RGB_EXT 0x8580 +#define GL_SOURCE1_RGB_EXT 0x8581 +#define GL_SOURCE2_RGB_EXT 0x8582 +#define GL_SOURCE0_ALPHA_EXT 0x8588 +#define GL_SOURCE1_ALPHA_EXT 0x8589 +#define GL_SOURCE2_ALPHA_EXT 0x858A +#define GL_OPERAND0_RGB_EXT 0x8590 +#define GL_OPERAND1_RGB_EXT 0x8591 +#define GL_OPERAND2_RGB_EXT 0x8592 +#define GL_OPERAND0_ALPHA_EXT 0x8598 +#define GL_OPERAND1_ALPHA_EXT 0x8599 +#define GL_OPERAND2_ALPHA_EXT 0x859A +#endif + +#ifndef GL_APPLE_specular_vector +#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0 +#endif + +#ifndef GL_APPLE_transform_hint +#define GL_TRANSFORM_HINT_APPLE 0x85B1 +#endif + +#ifndef GL_SGIX_fog_scale +#define GL_FOG_SCALE_SGIX 0x81FC +#define GL_FOG_SCALE_VALUE_SGIX 0x81FD +#endif + +#ifndef GL_SUNX_constant_data +#define GL_UNPACK_CONSTANT_DATA_SUNX 0x81D5 +#define GL_TEXTURE_CONSTANT_DATA_SUNX 0x81D6 +#endif + +#ifndef GL_SUN_global_alpha +#define GL_GLOBAL_ALPHA_SUN 0x81D9 +#define GL_GLOBAL_ALPHA_FACTOR_SUN 0x81DA +#endif + +#ifndef GL_SUN_triangle_list +#define GL_RESTART_SUN 0x0001 +#define GL_REPLACE_MIDDLE_SUN 0x0002 +#define GL_REPLACE_OLDEST_SUN 0x0003 +#define GL_TRIANGLE_LIST_SUN 0x81D7 +#define GL_REPLACEMENT_CODE_SUN 0x81D8 +#define GL_REPLACEMENT_CODE_ARRAY_SUN 0x85C0 +#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1 +#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2 +#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3 +#define GL_R1UI_V3F_SUN 0x85C4 +#define GL_R1UI_C4UB_V3F_SUN 0x85C5 +#define GL_R1UI_C3F_V3F_SUN 0x85C6 +#define GL_R1UI_N3F_V3F_SUN 0x85C7 +#define GL_R1UI_C4F_N3F_V3F_SUN 0x85C8 +#define GL_R1UI_T2F_V3F_SUN 0x85C9 +#define GL_R1UI_T2F_N3F_V3F_SUN 0x85CA +#define GL_R1UI_T2F_C4F_N3F_V3F_SUN 0x85CB +#endif + +#ifndef GL_SUN_vertex +#endif + +#ifndef GL_EXT_blend_func_separate +#define GL_BLEND_DST_RGB_EXT 0x80C8 +#define GL_BLEND_SRC_RGB_EXT 0x80C9 +#define GL_BLEND_DST_ALPHA_EXT 0x80CA +#define GL_BLEND_SRC_ALPHA_EXT 0x80CB +#endif + +#ifndef GL_INGR_color_clamp +#define GL_RED_MIN_CLAMP_INGR 0x8560 +#define GL_GREEN_MIN_CLAMP_INGR 0x8561 +#define GL_BLUE_MIN_CLAMP_INGR 0x8562 +#define GL_ALPHA_MIN_CLAMP_INGR 0x8563 +#define GL_RED_MAX_CLAMP_INGR 0x8564 +#define GL_GREEN_MAX_CLAMP_INGR 0x8565 +#define GL_BLUE_MAX_CLAMP_INGR 0x8566 +#define GL_ALPHA_MAX_CLAMP_INGR 0x8567 +#endif + +#ifndef GL_INGR_interlace_read +#define GL_INTERLACE_READ_INGR 0x8568 +#endif + +#ifndef GL_EXT_stencil_wrap +#define GL_INCR_WRAP_EXT 0x8507 +#define GL_DECR_WRAP_EXT 0x8508 +#endif + +#ifndef GL_EXT_422_pixels +#define GL_422_EXT 0x80CC +#define GL_422_REV_EXT 0x80CD +#define GL_422_AVERAGE_EXT 0x80CE +#define GL_422_REV_AVERAGE_EXT 0x80CF +#endif + +#ifndef GL_NV_texgen_reflection +#define GL_NORMAL_MAP_NV 0x8511 +#define GL_REFLECTION_MAP_NV 0x8512 +#endif + +#ifndef GL_EXT_texture_cube_map +#define GL_NORMAL_MAP_EXT 0x8511 +#define GL_REFLECTION_MAP_EXT 0x8512 +#define GL_TEXTURE_CUBE_MAP_EXT 0x8513 +#define GL_TEXTURE_BINDING_CUBE_MAP_EXT 0x8514 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518 +#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519 +#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A +#define GL_PROXY_TEXTURE_CUBE_MAP_EXT 0x851B +#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT 0x851C +#endif + +#ifndef GL_SUN_convolution_border_modes +#define GL_WRAP_BORDER_SUN 0x81D4 +#endif + +#ifndef GL_EXT_texture_env_add +#endif + +#ifndef GL_EXT_texture_lod_bias +#define GL_MAX_TEXTURE_LOD_BIAS_EXT 0x84FD +#define GL_TEXTURE_FILTER_CONTROL_EXT 0x8500 +#define GL_TEXTURE_LOD_BIAS_EXT 0x8501 +#endif + +#ifndef GL_EXT_texture_filter_anisotropic +#define GL_TEXTURE_MAX_ANISOTROPY_EXT 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF +#endif + +#ifndef GL_EXT_vertex_weighting +#define GL_MODELVIEW0_STACK_DEPTH_EXT GL_MODELVIEW_STACK_DEPTH +#define GL_MODELVIEW1_STACK_DEPTH_EXT 0x8502 +#define GL_MODELVIEW0_MATRIX_EXT GL_MODELVIEW_MATRIX +#define GL_MODELVIEW1_MATRIX_EXT 0x8506 +#define GL_VERTEX_WEIGHTING_EXT 0x8509 +#define GL_MODELVIEW0_EXT GL_MODELVIEW +#define GL_MODELVIEW1_EXT 0x850A +#define GL_CURRENT_VERTEX_WEIGHT_EXT 0x850B +#define GL_VERTEX_WEIGHT_ARRAY_EXT 0x850C +#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT 0x850D +#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT 0x850E +#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F +#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510 +#endif + +#ifndef GL_NV_light_max_exponent +#define GL_MAX_SHININESS_NV 0x8504 +#define GL_MAX_SPOT_EXPONENT_NV 0x8505 +#endif + +#ifndef GL_NV_vertex_array_range +#define GL_VERTEX_ARRAY_RANGE_NV 0x851D +#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV 0x851E +#define GL_VERTEX_ARRAY_RANGE_VALID_NV 0x851F +#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520 +#define GL_VERTEX_ARRAY_RANGE_POINTER_NV 0x8521 +#endif + +#ifndef GL_NV_register_combiners +#define GL_REGISTER_COMBINERS_NV 0x8522 +#define GL_VARIABLE_A_NV 0x8523 +#define GL_VARIABLE_B_NV 0x8524 +#define GL_VARIABLE_C_NV 0x8525 +#define GL_VARIABLE_D_NV 0x8526 +#define GL_VARIABLE_E_NV 0x8527 +#define GL_VARIABLE_F_NV 0x8528 +#define GL_VARIABLE_G_NV 0x8529 +#define GL_CONSTANT_COLOR0_NV 0x852A +#define GL_CONSTANT_COLOR1_NV 0x852B +#define GL_PRIMARY_COLOR_NV 0x852C +#define GL_SECONDARY_COLOR_NV 0x852D +#define GL_SPARE0_NV 0x852E +#define GL_SPARE1_NV 0x852F +#define GL_DISCARD_NV 0x8530 +#define GL_E_TIMES_F_NV 0x8531 +#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532 +#define GL_UNSIGNED_IDENTITY_NV 0x8536 +#define GL_UNSIGNED_INVERT_NV 0x8537 +#define GL_EXPAND_NORMAL_NV 0x8538 +#define GL_EXPAND_NEGATE_NV 0x8539 +#define GL_HALF_BIAS_NORMAL_NV 0x853A +#define GL_HALF_BIAS_NEGATE_NV 0x853B +#define GL_SIGNED_IDENTITY_NV 0x853C +#define GL_SIGNED_NEGATE_NV 0x853D +#define GL_SCALE_BY_TWO_NV 0x853E +#define GL_SCALE_BY_FOUR_NV 0x853F +#define GL_SCALE_BY_ONE_HALF_NV 0x8540 +#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV 0x8541 +#define GL_COMBINER_INPUT_NV 0x8542 +#define GL_COMBINER_MAPPING_NV 0x8543 +#define GL_COMBINER_COMPONENT_USAGE_NV 0x8544 +#define GL_COMBINER_AB_DOT_PRODUCT_NV 0x8545 +#define GL_COMBINER_CD_DOT_PRODUCT_NV 0x8546 +#define GL_COMBINER_MUX_SUM_NV 0x8547 +#define GL_COMBINER_SCALE_NV 0x8548 +#define GL_COMBINER_BIAS_NV 0x8549 +#define GL_COMBINER_AB_OUTPUT_NV 0x854A +#define GL_COMBINER_CD_OUTPUT_NV 0x854B +#define GL_COMBINER_SUM_OUTPUT_NV 0x854C +#define GL_MAX_GENERAL_COMBINERS_NV 0x854D +#define GL_NUM_GENERAL_COMBINERS_NV 0x854E +#define GL_COLOR_SUM_CLAMP_NV 0x854F +#define GL_COMBINER0_NV 0x8550 +#define GL_COMBINER1_NV 0x8551 +#define GL_COMBINER2_NV 0x8552 +#define GL_COMBINER3_NV 0x8553 +#define GL_COMBINER4_NV 0x8554 +#define GL_COMBINER5_NV 0x8555 +#define GL_COMBINER6_NV 0x8556 +#define GL_COMBINER7_NV 0x8557 +/* reuse GL_TEXTURE0_ARB */ +/* reuse GL_TEXTURE1_ARB */ +/* reuse GL_ZERO */ +/* reuse GL_NONE */ +/* reuse GL_FOG */ +#endif + +#ifndef GL_NV_fog_distance +#define GL_FOG_DISTANCE_MODE_NV 0x855A +#define GL_EYE_RADIAL_NV 0x855B +#define GL_EYE_PLANE_ABSOLUTE_NV 0x855C +/* reuse GL_EYE_PLANE */ +#endif + +#ifndef GL_NV_texgen_emboss +#define GL_EMBOSS_LIGHT_NV 0x855D +#define GL_EMBOSS_CONSTANT_NV 0x855E +#define GL_EMBOSS_MAP_NV 0x855F +#endif + +#ifndef GL_NV_blend_square +#endif + +#ifndef GL_NV_texture_env_combine4 +#define GL_COMBINE4_NV 0x8503 +#define GL_SOURCE3_RGB_NV 0x8583 +#define GL_SOURCE3_ALPHA_NV 0x858B +#define GL_OPERAND3_RGB_NV 0x8593 +#define GL_OPERAND3_ALPHA_NV 0x859B +#endif + +#ifndef GL_MESA_resize_buffers +#endif + +#ifndef GL_MESA_window_pos +#endif + +#ifndef GL_EXT_texture_compression_s3tc +#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 +#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 +#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 +#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 +#endif + +#ifndef GL_IBM_cull_vertex +#define GL_CULL_VERTEX_IBM 103050 +#endif + +#ifndef GL_IBM_multimode_draw_arrays +#endif + +#ifndef GL_IBM_vertex_array_lists +#define GL_VERTEX_ARRAY_LIST_IBM 103070 +#define GL_NORMAL_ARRAY_LIST_IBM 103071 +#define GL_COLOR_ARRAY_LIST_IBM 103072 +#define GL_INDEX_ARRAY_LIST_IBM 103073 +#define GL_TEXTURE_COORD_ARRAY_LIST_IBM 103074 +#define GL_EDGE_FLAG_ARRAY_LIST_IBM 103075 +#define GL_FOG_COORDINATE_ARRAY_LIST_IBM 103076 +#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077 +#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM 103080 +#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM 103081 +#define GL_COLOR_ARRAY_LIST_STRIDE_IBM 103082 +#define GL_INDEX_ARRAY_LIST_STRIDE_IBM 103083 +#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084 +#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085 +#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086 +#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087 +#endif + +#ifndef GL_SGIX_subsample +#define GL_PACK_SUBSAMPLE_RATE_SGIX 0x85A0 +#define GL_UNPACK_SUBSAMPLE_RATE_SGIX 0x85A1 +#define GL_PIXEL_SUBSAMPLE_4444_SGIX 0x85A2 +#define GL_PIXEL_SUBSAMPLE_2424_SGIX 0x85A3 +#define GL_PIXEL_SUBSAMPLE_4242_SGIX 0x85A4 +#endif + +#ifndef GL_SGIX_ycrcb_subsample +#endif + +#ifndef GL_SGIX_ycrcba +#define GL_YCRCB_SGIX 0x8318 +#define GL_YCRCBA_SGIX 0x8319 +#endif + +#ifndef GL_SGI_depth_pass_instrument +#define GL_DEPTH_PASS_INSTRUMENT_SGIX 0x8310 +#define GL_DEPTH_PASS_INSTRUMENT_COUNTERS_SGIX 0x8311 +#define GL_DEPTH_PASS_INSTRUMENT_MAX_SGIX 0x8312 +#endif + +#ifndef GL_3DFX_texture_compression_FXT1 +#define GL_COMPRESSED_RGB_FXT1_3DFX 0x86B0 +#define GL_COMPRESSED_RGBA_FXT1_3DFX 0x86B1 +#endif + +#ifndef GL_3DFX_multisample +#define GL_MULTISAMPLE_3DFX 0x86B2 +#define GL_SAMPLE_BUFFERS_3DFX 0x86B3 +#define GL_SAMPLES_3DFX 0x86B4 +#define GL_MULTISAMPLE_BIT_3DFX 0x20000000 +#endif + +#ifndef GL_3DFX_tbuffer +#endif + +#ifndef GL_EXT_multisample +#define GL_MULTISAMPLE_EXT 0x809D +#define GL_SAMPLE_ALPHA_TO_MASK_EXT 0x809E +#define GL_SAMPLE_ALPHA_TO_ONE_EXT 0x809F +#define GL_SAMPLE_MASK_EXT 0x80A0 +#define GL_1PASS_EXT 0x80A1 +#define GL_2PASS_0_EXT 0x80A2 +#define GL_2PASS_1_EXT 0x80A3 +#define GL_4PASS_0_EXT 0x80A4 +#define GL_4PASS_1_EXT 0x80A5 +#define GL_4PASS_2_EXT 0x80A6 +#define GL_4PASS_3_EXT 0x80A7 +#define GL_SAMPLE_BUFFERS_EXT 0x80A8 +#define GL_SAMPLES_EXT 0x80A9 +#define GL_SAMPLE_MASK_VALUE_EXT 0x80AA +#define GL_SAMPLE_MASK_INVERT_EXT 0x80AB +#define GL_SAMPLE_PATTERN_EXT 0x80AC +#define GL_MULTISAMPLE_BIT_EXT 0x20000000 +#endif + +#ifndef GL_SGIX_vertex_preclip +#define GL_VERTEX_PRECLIP_SGIX 0x83EE +#define GL_VERTEX_PRECLIP_HINT_SGIX 0x83EF +#endif + +#ifndef GL_SGIX_convolution_accuracy +#define GL_CONVOLUTION_HINT_SGIX 0x8316 +#endif + +#ifndef GL_SGIX_resample +#define GL_PACK_RESAMPLE_SGIX 0x842C +#define GL_UNPACK_RESAMPLE_SGIX 0x842D +#define GL_RESAMPLE_REPLICATE_SGIX 0x842E +#define GL_RESAMPLE_ZERO_FILL_SGIX 0x842F +#define GL_RESAMPLE_DECIMATE_SGIX 0x8430 +#endif + +#ifndef GL_SGIS_point_line_texgen +#define GL_EYE_DISTANCE_TO_POINT_SGIS 0x81F0 +#define GL_OBJECT_DISTANCE_TO_POINT_SGIS 0x81F1 +#define GL_EYE_DISTANCE_TO_LINE_SGIS 0x81F2 +#define GL_OBJECT_DISTANCE_TO_LINE_SGIS 0x81F3 +#define GL_EYE_POINT_SGIS 0x81F4 +#define GL_OBJECT_POINT_SGIS 0x81F5 +#define GL_EYE_LINE_SGIS 0x81F6 +#define GL_OBJECT_LINE_SGIS 0x81F7 +#endif + +#ifndef GL_SGIS_texture_color_mask +#define GL_TEXTURE_COLOR_WRITEMASK_SGIS 0x81EF +#endif + +#ifndef GL_EXT_texture_env_dot3 +#define GL_DOT3_RGB_EXT 0x8740 +#define GL_DOT3_RGBA_EXT 0x8741 +#endif + +#ifndef GL_ATI_texture_mirror_once +#define GL_MIRROR_CLAMP_ATI 0x8742 +#define GL_MIRROR_CLAMP_TO_EDGE_ATI 0x8743 +#endif + +#ifndef GL_NV_fence +#define GL_ALL_COMPLETED_NV 0x84F2 +#define GL_FENCE_STATUS_NV 0x84F3 +#define GL_FENCE_CONDITION_NV 0x84F4 +#endif + +#ifndef GL_IBM_texture_mirrored_repeat +#define GL_MIRRORED_REPEAT_IBM 0x8370 +#endif + +#ifndef GL_NV_evaluators +#define GL_EVAL_2D_NV 0x86C0 +#define GL_EVAL_TRIANGULAR_2D_NV 0x86C1 +#define GL_MAP_TESSELLATION_NV 0x86C2 +#define GL_MAP_ATTRIB_U_ORDER_NV 0x86C3 +#define GL_MAP_ATTRIB_V_ORDER_NV 0x86C4 +#define GL_EVAL_FRACTIONAL_TESSELLATION_NV 0x86C5 +#define GL_EVAL_VERTEX_ATTRIB0_NV 0x86C6 +#define GL_EVAL_VERTEX_ATTRIB1_NV 0x86C7 +#define GL_EVAL_VERTEX_ATTRIB2_NV 0x86C8 +#define GL_EVAL_VERTEX_ATTRIB3_NV 0x86C9 +#define GL_EVAL_VERTEX_ATTRIB4_NV 0x86CA +#define GL_EVAL_VERTEX_ATTRIB5_NV 0x86CB +#define GL_EVAL_VERTEX_ATTRIB6_NV 0x86CC +#define GL_EVAL_VERTEX_ATTRIB7_NV 0x86CD +#define GL_EVAL_VERTEX_ATTRIB8_NV 0x86CE +#define GL_EVAL_VERTEX_ATTRIB9_NV 0x86CF +#define GL_EVAL_VERTEX_ATTRIB10_NV 0x86D0 +#define GL_EVAL_VERTEX_ATTRIB11_NV 0x86D1 +#define GL_EVAL_VERTEX_ATTRIB12_NV 0x86D2 +#define GL_EVAL_VERTEX_ATTRIB13_NV 0x86D3 +#define GL_EVAL_VERTEX_ATTRIB14_NV 0x86D4 +#define GL_EVAL_VERTEX_ATTRIB15_NV 0x86D5 +#define GL_MAX_MAP_TESSELLATION_NV 0x86D6 +#define GL_MAX_RATIONAL_EVAL_ORDER_NV 0x86D7 +#endif + +#ifndef GL_NV_packed_depth_stencil +#define GL_DEPTH_STENCIL_NV 0x84F9 +#define GL_UNSIGNED_INT_24_8_NV 0x84FA +#endif + +#ifndef GL_NV_register_combiners2 +#define GL_PER_STAGE_CONSTANTS_NV 0x8535 +#endif + +#ifndef GL_NV_texture_compression_vtc +#endif + +#ifndef GL_NV_texture_rectangle +#define GL_TEXTURE_RECTANGLE_NV 0x84F5 +#define GL_TEXTURE_BINDING_RECTANGLE_NV 0x84F6 +#define GL_PROXY_TEXTURE_RECTANGLE_NV 0x84F7 +#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 +#endif + +#ifndef GL_NV_texture_shader +#define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C +#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D +#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E +#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9 +#define GL_UNSIGNED_INT_S8_S8_8_8_NV 0x86DA +#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV 0x86DB +#define GL_DSDT_MAG_INTENSITY_NV 0x86DC +#define GL_SHADER_CONSISTENT_NV 0x86DD +#define GL_TEXTURE_SHADER_NV 0x86DE +#define GL_SHADER_OPERATION_NV 0x86DF +#define GL_CULL_MODES_NV 0x86E0 +#define GL_OFFSET_TEXTURE_MATRIX_NV 0x86E1 +#define GL_OFFSET_TEXTURE_SCALE_NV 0x86E2 +#define GL_OFFSET_TEXTURE_BIAS_NV 0x86E3 +#define GL_OFFSET_TEXTURE_2D_MATRIX_NV GL_OFFSET_TEXTURE_MATRIX_NV +#define GL_OFFSET_TEXTURE_2D_SCALE_NV GL_OFFSET_TEXTURE_SCALE_NV +#define GL_OFFSET_TEXTURE_2D_BIAS_NV GL_OFFSET_TEXTURE_BIAS_NV +#define GL_PREVIOUS_TEXTURE_INPUT_NV 0x86E4 +#define GL_CONST_EYE_NV 0x86E5 +#define GL_PASS_THROUGH_NV 0x86E6 +#define GL_CULL_FRAGMENT_NV 0x86E7 +#define GL_OFFSET_TEXTURE_2D_NV 0x86E8 +#define GL_DEPENDENT_AR_TEXTURE_2D_NV 0x86E9 +#define GL_DEPENDENT_GB_TEXTURE_2D_NV 0x86EA +#define GL_DOT_PRODUCT_NV 0x86EC +#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV 0x86ED +#define GL_DOT_PRODUCT_TEXTURE_2D_NV 0x86EE +#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0 +#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1 +#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2 +#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3 +#define GL_HILO_NV 0x86F4 +#define GL_DSDT_NV 0x86F5 +#define GL_DSDT_MAG_NV 0x86F6 +#define GL_DSDT_MAG_VIB_NV 0x86F7 +#define GL_HILO16_NV 0x86F8 +#define GL_SIGNED_HILO_NV 0x86F9 +#define GL_SIGNED_HILO16_NV 0x86FA +#define GL_SIGNED_RGBA_NV 0x86FB +#define GL_SIGNED_RGBA8_NV 0x86FC +#define GL_SIGNED_RGB_NV 0x86FE +#define GL_SIGNED_RGB8_NV 0x86FF +#define GL_SIGNED_LUMINANCE_NV 0x8701 +#define GL_SIGNED_LUMINANCE8_NV 0x8702 +#define GL_SIGNED_LUMINANCE_ALPHA_NV 0x8703 +#define GL_SIGNED_LUMINANCE8_ALPHA8_NV 0x8704 +#define GL_SIGNED_ALPHA_NV 0x8705 +#define GL_SIGNED_ALPHA8_NV 0x8706 +#define GL_SIGNED_INTENSITY_NV 0x8707 +#define GL_SIGNED_INTENSITY8_NV 0x8708 +#define GL_DSDT8_NV 0x8709 +#define GL_DSDT8_MAG8_NV 0x870A +#define GL_DSDT8_MAG8_INTENSITY8_NV 0x870B +#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV 0x870C +#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D +#define GL_HI_SCALE_NV 0x870E +#define GL_LO_SCALE_NV 0x870F +#define GL_DS_SCALE_NV 0x8710 +#define GL_DT_SCALE_NV 0x8711 +#define GL_MAGNITUDE_SCALE_NV 0x8712 +#define GL_VIBRANCE_SCALE_NV 0x8713 +#define GL_HI_BIAS_NV 0x8714 +#define GL_LO_BIAS_NV 0x8715 +#define GL_DS_BIAS_NV 0x8716 +#define GL_DT_BIAS_NV 0x8717 +#define GL_MAGNITUDE_BIAS_NV 0x8718 +#define GL_VIBRANCE_BIAS_NV 0x8719 +#define GL_TEXTURE_BORDER_VALUES_NV 0x871A +#define GL_TEXTURE_HI_SIZE_NV 0x871B +#define GL_TEXTURE_LO_SIZE_NV 0x871C +#define GL_TEXTURE_DS_SIZE_NV 0x871D +#define GL_TEXTURE_DT_SIZE_NV 0x871E +#define GL_TEXTURE_MAG_SIZE_NV 0x871F +#endif + +#ifndef GL_NV_texture_shader2 +#define GL_DOT_PRODUCT_TEXTURE_3D_NV 0x86EF +#endif + +#ifndef GL_NV_vertex_array_range2 +#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533 +#endif + +#ifndef GL_NV_vertex_program +#define GL_VERTEX_PROGRAM_NV 0x8620 +#define GL_VERTEX_STATE_PROGRAM_NV 0x8621 +#define GL_ATTRIB_ARRAY_SIZE_NV 0x8623 +#define GL_ATTRIB_ARRAY_STRIDE_NV 0x8624 +#define GL_ATTRIB_ARRAY_TYPE_NV 0x8625 +#define GL_CURRENT_ATTRIB_NV 0x8626 +#define GL_PROGRAM_LENGTH_NV 0x8627 +#define GL_PROGRAM_STRING_NV 0x8628 +#define GL_MODELVIEW_PROJECTION_NV 0x8629 +#define GL_IDENTITY_NV 0x862A +#define GL_INVERSE_NV 0x862B +#define GL_TRANSPOSE_NV 0x862C +#define GL_INVERSE_TRANSPOSE_NV 0x862D +#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E +#define GL_MAX_TRACK_MATRICES_NV 0x862F +#define GL_MATRIX0_NV 0x8630 +#define GL_MATRIX1_NV 0x8631 +#define GL_MATRIX2_NV 0x8632 +#define GL_MATRIX3_NV 0x8633 +#define GL_MATRIX4_NV 0x8634 +#define GL_MATRIX5_NV 0x8635 +#define GL_MATRIX6_NV 0x8636 +#define GL_MATRIX7_NV 0x8637 +#define GL_CURRENT_MATRIX_STACK_DEPTH_NV 0x8640 +#define GL_CURRENT_MATRIX_NV 0x8641 +#define GL_VERTEX_PROGRAM_POINT_SIZE_NV 0x8642 +#define GL_VERTEX_PROGRAM_TWO_SIDE_NV 0x8643 +#define GL_PROGRAM_PARAMETER_NV 0x8644 +#define GL_ATTRIB_ARRAY_POINTER_NV 0x8645 +#define GL_PROGRAM_TARGET_NV 0x8646 +#define GL_PROGRAM_RESIDENT_NV 0x8647 +#define GL_TRACK_MATRIX_NV 0x8648 +#define GL_TRACK_MATRIX_TRANSFORM_NV 0x8649 +#define GL_VERTEX_PROGRAM_BINDING_NV 0x864A +#define GL_PROGRAM_ERROR_POSITION_NV 0x864B +#define GL_VERTEX_ATTRIB_ARRAY0_NV 0x8650 +#define GL_VERTEX_ATTRIB_ARRAY1_NV 0x8651 +#define GL_VERTEX_ATTRIB_ARRAY2_NV 0x8652 +#define GL_VERTEX_ATTRIB_ARRAY3_NV 0x8653 +#define GL_VERTEX_ATTRIB_ARRAY4_NV 0x8654 +#define GL_VERTEX_ATTRIB_ARRAY5_NV 0x8655 +#define GL_VERTEX_ATTRIB_ARRAY6_NV 0x8656 +#define GL_VERTEX_ATTRIB_ARRAY7_NV 0x8657 +#define GL_VERTEX_ATTRIB_ARRAY8_NV 0x8658 +#define GL_VERTEX_ATTRIB_ARRAY9_NV 0x8659 +#define GL_VERTEX_ATTRIB_ARRAY10_NV 0x865A +#define GL_VERTEX_ATTRIB_ARRAY11_NV 0x865B +#define GL_VERTEX_ATTRIB_ARRAY12_NV 0x865C +#define GL_VERTEX_ATTRIB_ARRAY13_NV 0x865D +#define GL_VERTEX_ATTRIB_ARRAY14_NV 0x865E +#define GL_VERTEX_ATTRIB_ARRAY15_NV 0x865F +#define GL_MAP1_VERTEX_ATTRIB0_4_NV 0x8660 +#define GL_MAP1_VERTEX_ATTRIB1_4_NV 0x8661 +#define GL_MAP1_VERTEX_ATTRIB2_4_NV 0x8662 +#define GL_MAP1_VERTEX_ATTRIB3_4_NV 0x8663 +#define GL_MAP1_VERTEX_ATTRIB4_4_NV 0x8664 +#define GL_MAP1_VERTEX_ATTRIB5_4_NV 0x8665 +#define GL_MAP1_VERTEX_ATTRIB6_4_NV 0x8666 +#define GL_MAP1_VERTEX_ATTRIB7_4_NV 0x8667 +#define GL_MAP1_VERTEX_ATTRIB8_4_NV 0x8668 +#define GL_MAP1_VERTEX_ATTRIB9_4_NV 0x8669 +#define GL_MAP1_VERTEX_ATTRIB10_4_NV 0x866A +#define GL_MAP1_VERTEX_ATTRIB11_4_NV 0x866B +#define GL_MAP1_VERTEX_ATTRIB12_4_NV 0x866C +#define GL_MAP1_VERTEX_ATTRIB13_4_NV 0x866D +#define GL_MAP1_VERTEX_ATTRIB14_4_NV 0x866E +#define GL_MAP1_VERTEX_ATTRIB15_4_NV 0x866F +#define GL_MAP2_VERTEX_ATTRIB0_4_NV 0x8670 +#define GL_MAP2_VERTEX_ATTRIB1_4_NV 0x8671 +#define GL_MAP2_VERTEX_ATTRIB2_4_NV 0x8672 +#define GL_MAP2_VERTEX_ATTRIB3_4_NV 0x8673 +#define GL_MAP2_VERTEX_ATTRIB4_4_NV 0x8674 +#define GL_MAP2_VERTEX_ATTRIB5_4_NV 0x8675 +#define GL_MAP2_VERTEX_ATTRIB6_4_NV 0x8676 +#define GL_MAP2_VERTEX_ATTRIB7_4_NV 0x8677 +#define GL_MAP2_VERTEX_ATTRIB8_4_NV 0x8678 +#define GL_MAP2_VERTEX_ATTRIB9_4_NV 0x8679 +#define GL_MAP2_VERTEX_ATTRIB10_4_NV 0x867A +#define GL_MAP2_VERTEX_ATTRIB11_4_NV 0x867B +#define GL_MAP2_VERTEX_ATTRIB12_4_NV 0x867C +#define GL_MAP2_VERTEX_ATTRIB13_4_NV 0x867D +#define GL_MAP2_VERTEX_ATTRIB14_4_NV 0x867E +#define GL_MAP2_VERTEX_ATTRIB15_4_NV 0x867F +#endif + +#ifndef GL_SGIX_texture_coordinate_clamp +#define GL_TEXTURE_MAX_CLAMP_S_SGIX 0x8369 +#define GL_TEXTURE_MAX_CLAMP_T_SGIX 0x836A +#define GL_TEXTURE_MAX_CLAMP_R_SGIX 0x836B +#endif + +#ifndef GL_SGIX_scalebias_hint +#define GL_SCALEBIAS_HINT_SGIX 0x8322 +#endif + +#ifndef GL_OML_interlace +#define GL_INTERLACE_OML 0x8980 +#define GL_INTERLACE_READ_OML 0x8981 +#endif + +#ifndef GL_OML_subsample +#define GL_FORMAT_SUBSAMPLE_24_24_OML 0x8982 +#define GL_FORMAT_SUBSAMPLE_244_244_OML 0x8983 +#endif + +#ifndef GL_OML_resample +#define GL_PACK_RESAMPLE_OML 0x8984 +#define GL_UNPACK_RESAMPLE_OML 0x8985 +#define GL_RESAMPLE_REPLICATE_OML 0x8986 +#define GL_RESAMPLE_ZERO_FILL_OML 0x8987 +#define GL_RESAMPLE_AVERAGE_OML 0x8988 +#define GL_RESAMPLE_DECIMATE_OML 0x8989 +#endif + +#ifndef GL_NV_copy_depth_to_color +#define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E +#define GL_DEPTH_STENCIL_TO_BGRA_NV 0x886F +#endif + +#ifndef GL_ATI_envmap_bumpmap +#define GL_BUMP_ROT_MATRIX_ATI 0x8775 +#define GL_BUMP_ROT_MATRIX_SIZE_ATI 0x8776 +#define GL_BUMP_NUM_TEX_UNITS_ATI 0x8777 +#define GL_BUMP_TEX_UNITS_ATI 0x8778 +#define GL_DUDV_ATI 0x8779 +#define GL_DU8DV8_ATI 0x877A +#define GL_BUMP_ENVMAP_ATI 0x877B +#define GL_BUMP_TARGET_ATI 0x877C +#endif + +#ifndef GL_ATI_fragment_shader +#define GL_FRAGMENT_SHADER_ATI 0x8920 +#define GL_REG_0_ATI 0x8921 +#define GL_REG_1_ATI 0x8922 +#define GL_REG_2_ATI 0x8923 +#define GL_REG_3_ATI 0x8924 +#define GL_REG_4_ATI 0x8925 +#define GL_REG_5_ATI 0x8926 +#define GL_REG_6_ATI 0x8927 +#define GL_REG_7_ATI 0x8928 +#define GL_REG_8_ATI 0x8929 +#define GL_REG_9_ATI 0x892A +#define GL_REG_10_ATI 0x892B +#define GL_REG_11_ATI 0x892C +#define GL_REG_12_ATI 0x892D +#define GL_REG_13_ATI 0x892E +#define GL_REG_14_ATI 0x892F +#define GL_REG_15_ATI 0x8930 +#define GL_REG_16_ATI 0x8931 +#define GL_REG_17_ATI 0x8932 +#define GL_REG_18_ATI 0x8933 +#define GL_REG_19_ATI 0x8934 +#define GL_REG_20_ATI 0x8935 +#define GL_REG_21_ATI 0x8936 +#define GL_REG_22_ATI 0x8937 +#define GL_REG_23_ATI 0x8938 +#define GL_REG_24_ATI 0x8939 +#define GL_REG_25_ATI 0x893A +#define GL_REG_26_ATI 0x893B +#define GL_REG_27_ATI 0x893C +#define GL_REG_28_ATI 0x893D +#define GL_REG_29_ATI 0x893E +#define GL_REG_30_ATI 0x893F +#define GL_REG_31_ATI 0x8940 +#define GL_CON_0_ATI 0x8941 +#define GL_CON_1_ATI 0x8942 +#define GL_CON_2_ATI 0x8943 +#define GL_CON_3_ATI 0x8944 +#define GL_CON_4_ATI 0x8945 +#define GL_CON_5_ATI 0x8946 +#define GL_CON_6_ATI 0x8947 +#define GL_CON_7_ATI 0x8948 +#define GL_CON_8_ATI 0x8949 +#define GL_CON_9_ATI 0x894A +#define GL_CON_10_ATI 0x894B +#define GL_CON_11_ATI 0x894C +#define GL_CON_12_ATI 0x894D +#define GL_CON_13_ATI 0x894E +#define GL_CON_14_ATI 0x894F +#define GL_CON_15_ATI 0x8950 +#define GL_CON_16_ATI 0x8951 +#define GL_CON_17_ATI 0x8952 +#define GL_CON_18_ATI 0x8953 +#define GL_CON_19_ATI 0x8954 +#define GL_CON_20_ATI 0x8955 +#define GL_CON_21_ATI 0x8956 +#define GL_CON_22_ATI 0x8957 +#define GL_CON_23_ATI 0x8958 +#define GL_CON_24_ATI 0x8959 +#define GL_CON_25_ATI 0x895A +#define GL_CON_26_ATI 0x895B +#define GL_CON_27_ATI 0x895C +#define GL_CON_28_ATI 0x895D +#define GL_CON_29_ATI 0x895E +#define GL_CON_30_ATI 0x895F +#define GL_CON_31_ATI 0x8960 +#define GL_MOV_ATI 0x8961 +#define GL_ADD_ATI 0x8963 +#define GL_MUL_ATI 0x8964 +#define GL_SUB_ATI 0x8965 +#define GL_DOT3_ATI 0x8966 +#define GL_DOT4_ATI 0x8967 +#define GL_MAD_ATI 0x8968 +#define GL_LERP_ATI 0x8969 +#define GL_CND_ATI 0x896A +#define GL_CND0_ATI 0x896B +#define GL_DOT2_ADD_ATI 0x896C +#define GL_SECONDARY_INTERPOLATOR_ATI 0x896D +#define GL_NUM_FRAGMENT_REGISTERS_ATI 0x896E +#define GL_NUM_FRAGMENT_CONSTANTS_ATI 0x896F +#define GL_NUM_PASSES_ATI 0x8970 +#define GL_NUM_INSTRUCTIONS_PER_PASS_ATI 0x8971 +#define GL_NUM_INSTRUCTIONS_TOTAL_ATI 0x8972 +#define GL_NUM_INPUT_INTERPOLATOR_COMPONENTS_ATI 0x8973 +#define GL_NUM_LOOPBACK_COMPONENTS_ATI 0x8974 +#define GL_COLOR_ALPHA_PAIRING_ATI 0x8975 +#define GL_SWIZZLE_STR_ATI 0x8976 +#define GL_SWIZZLE_STQ_ATI 0x8977 +#define GL_SWIZZLE_STR_DR_ATI 0x8978 +#define GL_SWIZZLE_STQ_DQ_ATI 0x8979 +#define GL_SWIZZLE_STRQ_ATI 0x897A +#define GL_SWIZZLE_STRQ_DQ_ATI 0x897B +#define GL_RED_BIT_ATI 0x00000001 +#define GL_GREEN_BIT_ATI 0x00000002 +#define GL_BLUE_BIT_ATI 0x00000004 +#define GL_2X_BIT_ATI 0x00000001 +#define GL_4X_BIT_ATI 0x00000002 +#define GL_8X_BIT_ATI 0x00000004 +#define GL_HALF_BIT_ATI 0x00000008 +#define GL_QUARTER_BIT_ATI 0x00000010 +#define GL_EIGHTH_BIT_ATI 0x00000020 +#define GL_SATURATE_BIT_ATI 0x00000040 +#define GL_COMP_BIT_ATI 0x00000002 +#define GL_NEGATE_BIT_ATI 0x00000004 +#define GL_BIAS_BIT_ATI 0x00000008 +#endif + +#ifndef GL_ATI_pn_triangles +#define GL_PN_TRIANGLES_ATI 0x87F0 +#define GL_MAX_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F1 +#define GL_PN_TRIANGLES_POINT_MODE_ATI 0x87F2 +#define GL_PN_TRIANGLES_NORMAL_MODE_ATI 0x87F3 +#define GL_PN_TRIANGLES_TESSELATION_LEVEL_ATI 0x87F4 +#define GL_PN_TRIANGLES_POINT_MODE_LINEAR_ATI 0x87F5 +#define GL_PN_TRIANGLES_POINT_MODE_CUBIC_ATI 0x87F6 +#define GL_PN_TRIANGLES_NORMAL_MODE_LINEAR_ATI 0x87F7 +#define GL_PN_TRIANGLES_NORMAL_MODE_QUADRATIC_ATI 0x87F8 +#endif + +#ifndef GL_ATI_vertex_array_object +#define GL_STATIC_ATI 0x8760 +#define GL_DYNAMIC_ATI 0x8761 +#define GL_PRESERVE_ATI 0x8762 +#define GL_DISCARD_ATI 0x8763 +#define GL_OBJECT_BUFFER_SIZE_ATI 0x8764 +#define GL_OBJECT_BUFFER_USAGE_ATI 0x8765 +#define GL_ARRAY_OBJECT_BUFFER_ATI 0x8766 +#define GL_ARRAY_OBJECT_OFFSET_ATI 0x8767 +#endif + +#ifndef GL_EXT_vertex_shader +#define GL_VERTEX_SHADER_EXT 0x8780 +#define GL_VERTEX_SHADER_BINDING_EXT 0x8781 +#define GL_OP_INDEX_EXT 0x8782 +#define GL_OP_NEGATE_EXT 0x8783 +#define GL_OP_DOT3_EXT 0x8784 +#define GL_OP_DOT4_EXT 0x8785 +#define GL_OP_MUL_EXT 0x8786 +#define GL_OP_ADD_EXT 0x8787 +#define GL_OP_MADD_EXT 0x8788 +#define GL_OP_FRAC_EXT 0x8789 +#define GL_OP_MAX_EXT 0x878A +#define GL_OP_MIN_EXT 0x878B +#define GL_OP_SET_GE_EXT 0x878C +#define GL_OP_SET_LT_EXT 0x878D +#define GL_OP_CLAMP_EXT 0x878E +#define GL_OP_FLOOR_EXT 0x878F +#define GL_OP_ROUND_EXT 0x8790 +#define GL_OP_EXP_BASE_2_EXT 0x8791 +#define GL_OP_LOG_BASE_2_EXT 0x8792 +#define GL_OP_POWER_EXT 0x8793 +#define GL_OP_RECIP_EXT 0x8794 +#define GL_OP_RECIP_SQRT_EXT 0x8795 +#define GL_OP_SUB_EXT 0x8796 +#define GL_OP_CROSS_PRODUCT_EXT 0x8797 +#define GL_OP_MULTIPLY_MATRIX_EXT 0x8798 +#define GL_OP_MOV_EXT 0x8799 +#define GL_OUTPUT_VERTEX_EXT 0x879A +#define GL_OUTPUT_COLOR0_EXT 0x879B +#define GL_OUTPUT_COLOR1_EXT 0x879C +#define GL_OUTPUT_TEXTURE_COORD0_EXT 0x879D +#define GL_OUTPUT_TEXTURE_COORD1_EXT 0x879E +#define GL_OUTPUT_TEXTURE_COORD2_EXT 0x879F +#define GL_OUTPUT_TEXTURE_COORD3_EXT 0x87A0 +#define GL_OUTPUT_TEXTURE_COORD4_EXT 0x87A1 +#define GL_OUTPUT_TEXTURE_COORD5_EXT 0x87A2 +#define GL_OUTPUT_TEXTURE_COORD6_EXT 0x87A3 +#define GL_OUTPUT_TEXTURE_COORD7_EXT 0x87A4 +#define GL_OUTPUT_TEXTURE_COORD8_EXT 0x87A5 +#define GL_OUTPUT_TEXTURE_COORD9_EXT 0x87A6 +#define GL_OUTPUT_TEXTURE_COORD10_EXT 0x87A7 +#define GL_OUTPUT_TEXTURE_COORD11_EXT 0x87A8 +#define GL_OUTPUT_TEXTURE_COORD12_EXT 0x87A9 +#define GL_OUTPUT_TEXTURE_COORD13_EXT 0x87AA +#define GL_OUTPUT_TEXTURE_COORD14_EXT 0x87AB +#define GL_OUTPUT_TEXTURE_COORD15_EXT 0x87AC +#define GL_OUTPUT_TEXTURE_COORD16_EXT 0x87AD +#define GL_OUTPUT_TEXTURE_COORD17_EXT 0x87AE +#define GL_OUTPUT_TEXTURE_COORD18_EXT 0x87AF +#define GL_OUTPUT_TEXTURE_COORD19_EXT 0x87B0 +#define GL_OUTPUT_TEXTURE_COORD20_EXT 0x87B1 +#define GL_OUTPUT_TEXTURE_COORD21_EXT 0x87B2 +#define GL_OUTPUT_TEXTURE_COORD22_EXT 0x87B3 +#define GL_OUTPUT_TEXTURE_COORD23_EXT 0x87B4 +#define GL_OUTPUT_TEXTURE_COORD24_EXT 0x87B5 +#define GL_OUTPUT_TEXTURE_COORD25_EXT 0x87B6 +#define GL_OUTPUT_TEXTURE_COORD26_EXT 0x87B7 +#define GL_OUTPUT_TEXTURE_COORD27_EXT 0x87B8 +#define GL_OUTPUT_TEXTURE_COORD28_EXT 0x87B9 +#define GL_OUTPUT_TEXTURE_COORD29_EXT 0x87BA +#define GL_OUTPUT_TEXTURE_COORD30_EXT 0x87BB +#define GL_OUTPUT_TEXTURE_COORD31_EXT 0x87BC +#define GL_OUTPUT_FOG_EXT 0x87BD +#define GL_SCALAR_EXT 0x87BE +#define GL_VECTOR_EXT 0x87BF +#define GL_MATRIX_EXT 0x87C0 +#define GL_VARIANT_EXT 0x87C1 +#define GL_INVARIANT_EXT 0x87C2 +#define GL_LOCAL_CONSTANT_EXT 0x87C3 +#define GL_LOCAL_EXT 0x87C4 +#define GL_MAX_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87C5 +#define GL_MAX_VERTEX_SHADER_VARIANTS_EXT 0x87C6 +#define GL_MAX_VERTEX_SHADER_INVARIANTS_EXT 0x87C7 +#define GL_MAX_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87C8 +#define GL_MAX_VERTEX_SHADER_LOCALS_EXT 0x87C9 +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CA +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_VARIANTS_EXT 0x87CB +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87CC +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_INVARIANTS_EXT 0x87CD +#define GL_MAX_OPTIMIZED_VERTEX_SHADER_LOCALS_EXT 0x87CE +#define GL_VERTEX_SHADER_INSTRUCTIONS_EXT 0x87CF +#define GL_VERTEX_SHADER_VARIANTS_EXT 0x87D0 +#define GL_VERTEX_SHADER_INVARIANTS_EXT 0x87D1 +#define GL_VERTEX_SHADER_LOCAL_CONSTANTS_EXT 0x87D2 +#define GL_VERTEX_SHADER_LOCALS_EXT 0x87D3 +#define GL_VERTEX_SHADER_OPTIMIZED_EXT 0x87D4 +#define GL_X_EXT 0x87D5 +#define GL_Y_EXT 0x87D6 +#define GL_Z_EXT 0x87D7 +#define GL_W_EXT 0x87D8 +#define GL_NEGATIVE_X_EXT 0x87D9 +#define GL_NEGATIVE_Y_EXT 0x87DA +#define GL_NEGATIVE_Z_EXT 0x87DB +#define GL_NEGATIVE_W_EXT 0x87DC +#define GL_ZERO_EXT 0x87DD +#define GL_ONE_EXT 0x87DE +#define GL_NEGATIVE_ONE_EXT 0x87DF +#define GL_NORMALIZED_RANGE_EXT 0x87E0 +#define GL_FULL_RANGE_EXT 0x87E1 +#define GL_CURRENT_VERTEX_EXT 0x87E2 +#define GL_MVP_MATRIX_EXT 0x87E3 +#define GL_VARIANT_VALUE_EXT 0x87E4 +#define GL_VARIANT_DATATYPE_EXT 0x87E5 +#define GL_VARIANT_ARRAY_STRIDE_EXT 0x87E6 +#define GL_VARIANT_ARRAY_TYPE_EXT 0x87E7 +#define GL_VARIANT_ARRAY_EXT 0x87E8 +#define GL_VARIANT_ARRAY_POINTER_EXT 0x87E9 +#define GL_INVARIANT_VALUE_EXT 0x87EA +#define GL_INVARIANT_DATATYPE_EXT 0x87EB +#define GL_LOCAL_CONSTANT_VALUE_EXT 0x87EC +#define GL_LOCAL_CONSTANT_DATATYPE_EXT 0x87ED +#endif + +#ifndef GL_ATI_vertex_streams +#define GL_MAX_VERTEX_STREAMS_ATI 0x876B +#define GL_VERTEX_STREAM0_ATI 0x876C +#define GL_VERTEX_STREAM1_ATI 0x876D +#define GL_VERTEX_STREAM2_ATI 0x876E +#define GL_VERTEX_STREAM3_ATI 0x876F +#define GL_VERTEX_STREAM4_ATI 0x8770 +#define GL_VERTEX_STREAM5_ATI 0x8771 +#define GL_VERTEX_STREAM6_ATI 0x8772 +#define GL_VERTEX_STREAM7_ATI 0x8773 +#define GL_VERTEX_SOURCE_ATI 0x8774 +#endif + +#ifndef GL_ATI_element_array +#define GL_ELEMENT_ARRAY_ATI 0x8768 +#define GL_ELEMENT_ARRAY_TYPE_ATI 0x8769 +#define GL_ELEMENT_ARRAY_POINTER_ATI 0x876A +#endif + +#ifndef GL_SUN_mesh_array +#define GL_QUAD_MESH_SUN 0x8614 +#define GL_TRIANGLE_MESH_SUN 0x8615 +#endif + +#ifndef GL_SUN_slice_accum +#define GL_SLICE_ACCUM_SUN 0x85CC +#endif + +#ifndef GL_NV_multisample_filter_hint +#define GL_MULTISAMPLE_FILTER_HINT_NV 0x8534 +#endif + +#ifndef GL_NV_depth_clamp +#define GL_DEPTH_CLAMP_NV 0x864F +#endif + +#ifndef GL_NV_occlusion_query +#define GL_PIXEL_COUNTER_BITS_NV 0x8864 +#define GL_CURRENT_OCCLUSION_QUERY_ID_NV 0x8865 +#define GL_PIXEL_COUNT_NV 0x8866 +#define GL_PIXEL_COUNT_AVAILABLE_NV 0x8867 +#endif + +#ifndef GL_NV_point_sprite +#define GL_POINT_SPRITE_NV 0x8861 +#define GL_COORD_REPLACE_NV 0x8862 +#define GL_POINT_SPRITE_R_MODE_NV 0x8863 +#endif + +#ifndef GL_NV_texture_shader3 +#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850 +#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851 +#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852 +#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853 +#define GL_OFFSET_HILO_TEXTURE_2D_NV 0x8854 +#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855 +#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856 +#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857 +#define GL_DEPENDENT_HILO_TEXTURE_2D_NV 0x8858 +#define GL_DEPENDENT_RGB_TEXTURE_3D_NV 0x8859 +#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A +#define GL_DOT_PRODUCT_PASS_THROUGH_NV 0x885B +#define GL_DOT_PRODUCT_TEXTURE_1D_NV 0x885C +#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D +#define GL_HILO8_NV 0x885E +#define GL_SIGNED_HILO8_NV 0x885F +#define GL_FORCE_BLUE_TO_ONE_NV 0x8860 +#endif + +#ifndef GL_NV_vertex_program1_1 +#endif + +#ifndef GL_EXT_shadow_funcs +#endif + +#ifndef GL_EXT_stencil_two_side +#define GL_STENCIL_TEST_TWO_SIDE_EXT 0x8910 +#define GL_ACTIVE_STENCIL_FACE_EXT 0x8911 +#endif + +#ifndef GL_ATI_text_fragment_shader +#define GL_TEXT_FRAGMENT_SHADER_ATI 0x8200 +#endif + +#ifndef GL_APPLE_client_storage +#define GL_UNPACK_CLIENT_STORAGE_APPLE 0x85B2 +#endif + +#ifndef GL_APPLE_element_array +#define GL_ELEMENT_ARRAY_APPLE 0x8768 +#define GL_ELEMENT_ARRAY_TYPE_APPLE 0x8769 +#define GL_ELEMENT_ARRAY_POINTER_APPLE 0x876A +#endif + +#ifndef GL_APPLE_fence +#define GL_DRAW_PIXELS_APPLE 0x8A0A +#define GL_FENCE_APPLE 0x8A0B +#endif + +#ifndef GL_APPLE_vertex_array_object +#define GL_VERTEX_ARRAY_BINDING_APPLE 0x85B5 +#endif + +#ifndef GL_APPLE_vertex_array_range +#define GL_VERTEX_ARRAY_RANGE_APPLE 0x851D +#define GL_VERTEX_ARRAY_RANGE_LENGTH_APPLE 0x851E +#define GL_VERTEX_ARRAY_STORAGE_HINT_APPLE 0x851F +#define GL_VERTEX_ARRAY_RANGE_POINTER_APPLE 0x8521 +#define GL_STORAGE_CACHED_APPLE 0x85BE +#define GL_STORAGE_SHARED_APPLE 0x85BF +#endif + +#ifndef GL_APPLE_ycbcr_422 +#define GL_YCBCR_422_APPLE 0x85B9 +#define GL_UNSIGNED_SHORT_8_8_APPLE 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_APPLE 0x85BB +#endif + +#ifndef GL_S3_s3tc +#define GL_RGB_S3TC 0x83A0 +#define GL_RGB4_S3TC 0x83A1 +#define GL_RGBA_S3TC 0x83A2 +#define GL_RGBA4_S3TC 0x83A3 +#endif + +#ifndef GL_ATI_draw_buffers +#define GL_MAX_DRAW_BUFFERS_ATI 0x8824 +#define GL_DRAW_BUFFER0_ATI 0x8825 +#define GL_DRAW_BUFFER1_ATI 0x8826 +#define GL_DRAW_BUFFER2_ATI 0x8827 +#define GL_DRAW_BUFFER3_ATI 0x8828 +#define GL_DRAW_BUFFER4_ATI 0x8829 +#define GL_DRAW_BUFFER5_ATI 0x882A +#define GL_DRAW_BUFFER6_ATI 0x882B +#define GL_DRAW_BUFFER7_ATI 0x882C +#define GL_DRAW_BUFFER8_ATI 0x882D +#define GL_DRAW_BUFFER9_ATI 0x882E +#define GL_DRAW_BUFFER10_ATI 0x882F +#define GL_DRAW_BUFFER11_ATI 0x8830 +#define GL_DRAW_BUFFER12_ATI 0x8831 +#define GL_DRAW_BUFFER13_ATI 0x8832 +#define GL_DRAW_BUFFER14_ATI 0x8833 +#define GL_DRAW_BUFFER15_ATI 0x8834 +#endif + +#ifndef GL_ATI_pixel_format_float +#define GL_TYPE_RGBA_FLOAT_ATI 0x8820 +#define GL_COLOR_CLEAR_UNCLAMPED_VALUE_ATI 0x8835 +#endif + +#ifndef GL_ATI_texture_env_combine3 +#define GL_MODULATE_ADD_ATI 0x8744 +#define GL_MODULATE_SIGNED_ADD_ATI 0x8745 +#define GL_MODULATE_SUBTRACT_ATI 0x8746 +#endif + +#ifndef GL_ATI_texture_float +#define GL_RGBA_FLOAT32_ATI 0x8814 +#define GL_RGB_FLOAT32_ATI 0x8815 +#define GL_ALPHA_FLOAT32_ATI 0x8816 +#define GL_INTENSITY_FLOAT32_ATI 0x8817 +#define GL_LUMINANCE_FLOAT32_ATI 0x8818 +#define GL_LUMINANCE_ALPHA_FLOAT32_ATI 0x8819 +#define GL_RGBA_FLOAT16_ATI 0x881A +#define GL_RGB_FLOAT16_ATI 0x881B +#define GL_ALPHA_FLOAT16_ATI 0x881C +#define GL_INTENSITY_FLOAT16_ATI 0x881D +#define GL_LUMINANCE_FLOAT16_ATI 0x881E +#define GL_LUMINANCE_ALPHA_FLOAT16_ATI 0x881F +#endif + +#ifndef GL_NV_float_buffer +#define GL_FLOAT_R_NV 0x8880 +#define GL_FLOAT_RG_NV 0x8881 +#define GL_FLOAT_RGB_NV 0x8882 +#define GL_FLOAT_RGBA_NV 0x8883 +#define GL_FLOAT_R16_NV 0x8884 +#define GL_FLOAT_R32_NV 0x8885 +#define GL_FLOAT_RG16_NV 0x8886 +#define GL_FLOAT_RG32_NV 0x8887 +#define GL_FLOAT_RGB16_NV 0x8888 +#define GL_FLOAT_RGB32_NV 0x8889 +#define GL_FLOAT_RGBA16_NV 0x888A +#define GL_FLOAT_RGBA32_NV 0x888B +#define GL_TEXTURE_FLOAT_COMPONENTS_NV 0x888C +#define GL_FLOAT_CLEAR_COLOR_VALUE_NV 0x888D +#define GL_FLOAT_RGBA_MODE_NV 0x888E +#endif + +#ifndef GL_NV_fragment_program +#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868 +#define GL_FRAGMENT_PROGRAM_NV 0x8870 +#define GL_MAX_TEXTURE_COORDS_NV 0x8871 +#define GL_MAX_TEXTURE_IMAGE_UNITS_NV 0x8872 +#define GL_FRAGMENT_PROGRAM_BINDING_NV 0x8873 +#define GL_PROGRAM_ERROR_STRING_NV 0x8874 +#endif + +#ifndef GL_NV_half_float +#define GL_HALF_FLOAT_NV 0x140B +#endif + +#ifndef GL_NV_pixel_data_range +#define GL_WRITE_PIXEL_DATA_RANGE_NV 0x8878 +#define GL_READ_PIXEL_DATA_RANGE_NV 0x8879 +#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A +#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B +#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C +#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D +#endif + +#ifndef GL_NV_primitive_restart +#define GL_PRIMITIVE_RESTART_NV 0x8558 +#define GL_PRIMITIVE_RESTART_INDEX_NV 0x8559 +#endif + +#ifndef GL_NV_texture_expand_normal +#define GL_TEXTURE_UNSIGNED_REMAP_MODE_NV 0x888F +#endif + +#ifndef GL_NV_vertex_program2 +#endif + +#ifndef GL_ATI_map_object_buffer +#endif + +#ifndef GL_ATI_separate_stencil +#define GL_STENCIL_BACK_FUNC_ATI 0x8800 +#define GL_STENCIL_BACK_FAIL_ATI 0x8801 +#define GL_STENCIL_BACK_PASS_DEPTH_FAIL_ATI 0x8802 +#define GL_STENCIL_BACK_PASS_DEPTH_PASS_ATI 0x8803 +#endif + +#ifndef GL_ATI_vertex_attrib_array_object +#endif + +#ifndef GL_OES_read_format +#define GL_IMPLEMENTATION_COLOR_READ_TYPE_OES 0x8B9A +#define GL_IMPLEMENTATION_COLOR_READ_FORMAT_OES 0x8B9B +#endif + +#ifndef GL_EXT_depth_bounds_test +#define GL_DEPTH_BOUNDS_TEST_EXT 0x8890 +#define GL_DEPTH_BOUNDS_EXT 0x8891 +#endif + +#ifndef GL_EXT_texture_mirror_clamp +#define GL_MIRROR_CLAMP_EXT 0x8742 +#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 +#define GL_MIRROR_CLAMP_TO_BORDER_EXT 0x8912 +#endif + +#ifndef GL_EXT_blend_equation_separate +#define GL_BLEND_EQUATION_RGB_EXT GL_BLEND_EQUATION +#define GL_BLEND_EQUATION_ALPHA_EXT 0x883D +#endif + +#ifndef GL_MESA_pack_invert +#define GL_PACK_INVERT_MESA 0x8758 +#endif + +#ifndef GL_MESA_ycbcr_texture +#define GL_UNSIGNED_SHORT_8_8_MESA 0x85BA +#define GL_UNSIGNED_SHORT_8_8_REV_MESA 0x85BB +#define GL_YCBCR_MESA 0x8757 +#endif + +#ifndef GL_EXT_pixel_buffer_object +#define GL_PIXEL_PACK_BUFFER_EXT 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_EXT 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_EXT 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_EXT 0x88EF +#endif + +#ifndef GL_NV_fragment_program_option +#endif + +#ifndef GL_NV_fragment_program2 +#define GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV 0x88F4 +#define GL_MAX_PROGRAM_CALL_DEPTH_NV 0x88F5 +#define GL_MAX_PROGRAM_IF_DEPTH_NV 0x88F6 +#define GL_MAX_PROGRAM_LOOP_DEPTH_NV 0x88F7 +#define GL_MAX_PROGRAM_LOOP_COUNT_NV 0x88F8 +#endif + +#ifndef GL_NV_vertex_program2_option +/* reuse GL_MAX_PROGRAM_EXEC_INSTRUCTIONS_NV */ +/* reuse GL_MAX_PROGRAM_CALL_DEPTH_NV */ +#endif + +#ifndef GL_NV_vertex_program3 +/* reuse GL_MAX_VERTEX_TEXTURE_IMAGE_UNITS_ARB */ +#endif + +#ifndef GL_EXT_framebuffer_object +#define GL_INVALID_FRAMEBUFFER_OPERATION_EXT 0x0506 +#define GL_MAX_RENDERBUFFER_SIZE_EXT 0x84E8 +#define GL_FRAMEBUFFER_BINDING_EXT 0x8CA6 +#define GL_RENDERBUFFER_BINDING_EXT 0x8CA7 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_TYPE_EXT 0x8CD0 +#define GL_FRAMEBUFFER_ATTACHMENT_OBJECT_NAME_EXT 0x8CD1 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_LEVEL_EXT 0x8CD2 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_CUBE_MAP_FACE_EXT 0x8CD3 +#define GL_FRAMEBUFFER_ATTACHMENT_TEXTURE_3D_ZOFFSET_EXT 0x8CD4 +#define GL_FRAMEBUFFER_COMPLETE_EXT 0x8CD5 +#define GL_FRAMEBUFFER_INCOMPLETE_ATTACHMENT_EXT 0x8CD6 +#define GL_FRAMEBUFFER_INCOMPLETE_MISSING_ATTACHMENT_EXT 0x8CD7 +#define GL_FRAMEBUFFER_INCOMPLETE_DUPLICATE_ATTACHMENT_EXT 0x8CD8 +#define GL_FRAMEBUFFER_INCOMPLETE_DIMENSIONS_EXT 0x8CD9 +#define GL_FRAMEBUFFER_INCOMPLETE_FORMATS_EXT 0x8CDA +#define GL_FRAMEBUFFER_INCOMPLETE_DRAW_BUFFER_EXT 0x8CDB +#define GL_FRAMEBUFFER_INCOMPLETE_READ_BUFFER_EXT 0x8CDC +#define GL_FRAMEBUFFER_UNSUPPORTED_EXT 0x8CDD +#define GL_MAX_COLOR_ATTACHMENTS_EXT 0x8CDF +#define GL_COLOR_ATTACHMENT0_EXT 0x8CE0 +#define GL_COLOR_ATTACHMENT1_EXT 0x8CE1 +#define GL_COLOR_ATTACHMENT2_EXT 0x8CE2 +#define GL_COLOR_ATTACHMENT3_EXT 0x8CE3 +#define GL_COLOR_ATTACHMENT4_EXT 0x8CE4 +#define GL_COLOR_ATTACHMENT5_EXT 0x8CE5 +#define GL_COLOR_ATTACHMENT6_EXT 0x8CE6 +#define GL_COLOR_ATTACHMENT7_EXT 0x8CE7 +#define GL_COLOR_ATTACHMENT8_EXT 0x8CE8 +#define GL_COLOR_ATTACHMENT9_EXT 0x8CE9 +#define GL_COLOR_ATTACHMENT10_EXT 0x8CEA +#define GL_COLOR_ATTACHMENT11_EXT 0x8CEB +#define GL_COLOR_ATTACHMENT12_EXT 0x8CEC +#define GL_COLOR_ATTACHMENT13_EXT 0x8CED +#define GL_COLOR_ATTACHMENT14_EXT 0x8CEE +#define GL_COLOR_ATTACHMENT15_EXT 0x8CEF +#define GL_DEPTH_ATTACHMENT_EXT 0x8D00 +#define GL_STENCIL_ATTACHMENT_EXT 0x8D20 +#define GL_FRAMEBUFFER_EXT 0x8D40 +#define GL_RENDERBUFFER_EXT 0x8D41 +#define GL_RENDERBUFFER_WIDTH_EXT 0x8D42 +#define GL_RENDERBUFFER_HEIGHT_EXT 0x8D43 +#define GL_RENDERBUFFER_INTERNAL_FORMAT_EXT 0x8D44 +#define GL_STENCIL_INDEX1_EXT 0x8D46 +#define GL_STENCIL_INDEX4_EXT 0x8D47 +#define GL_STENCIL_INDEX8_EXT 0x8D48 +#define GL_STENCIL_INDEX16_EXT 0x8D49 +#define GL_RENDERBUFFER_RED_SIZE_EXT 0x8D50 +#define GL_RENDERBUFFER_GREEN_SIZE_EXT 0x8D51 +#define GL_RENDERBUFFER_BLUE_SIZE_EXT 0x8D52 +#define GL_RENDERBUFFER_ALPHA_SIZE_EXT 0x8D53 +#define GL_RENDERBUFFER_DEPTH_SIZE_EXT 0x8D54 +#define GL_RENDERBUFFER_STENCIL_SIZE_EXT 0x8D55 +#endif + +#ifndef GL_GREMEDY_string_marker +#endif + + +/*************************************************************/ + +#include +#ifndef GL_VERSION_2_0 +/* GL type for program/shader text */ +typedef char GLchar; /* native character */ +#endif + +#ifndef GL_VERSION_1_5 +/* GL types for handling large vertex buffer objects */ +#ifdef __APPLE__ +typedef long GLintptr; +typedef long GLsizeiptr; +#else +typedef ptrdiff_t GLintptr; +typedef ptrdiff_t GLsizeiptr; +#endif +#endif + +#ifndef GL_ARB_vertex_buffer_object +/* GL types for handling large vertex buffer objects */ +#ifdef __APPLE__ +typedef long GLintptrARB; +typedef long GLsizeiptrARB; +#else +typedef ptrdiff_t GLintptrARB; +typedef ptrdiff_t GLsizeiptrARB; +#endif +#endif + +#ifndef GL_ARB_shader_objects +/* GL types for handling shader object handles and program/shader text */ +typedef char GLcharARB; /* native character */ +#if defined(__APPLE__) +typedef void *GLhandleARB; /* shader object handle */ +#else +typedef unsigned int GLhandleARB; /* shader object handle */ +#endif +#endif + +/* GL types for "half" precision (s10e5) float data in host memory */ +#ifndef GL_ARB_half_float_pixel +typedef unsigned short GLhalfARB; +#endif + +#ifndef GL_NV_half_float +typedef unsigned short GLhalfNV; +#endif + +#ifndef GL_VERSION_1_2 +#define GL_VERSION_1_2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendColor (GLclampf, GLclampf, GLclampf, GLclampf); +GLAPI void APIENTRY glBlendEquation (GLenum); +GLAPI void APIENTRY glDrawRangeElements (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); +GLAPI void APIENTRY glColorTable (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glColorTableParameterfv (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glColorTableParameteriv (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glCopyColorTable (GLenum, GLenum, GLint, GLint, GLsizei); +GLAPI void APIENTRY glGetColorTable (GLenum, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetColorTableParameterfv (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetColorTableParameteriv (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glColorSubTable (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glCopyColorSubTable (GLenum, GLsizei, GLint, GLint, GLsizei); +GLAPI void APIENTRY glConvolutionFilter1D (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glConvolutionFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glConvolutionParameterf (GLenum, GLenum, GLfloat); +GLAPI void APIENTRY glConvolutionParameterfv (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glConvolutionParameteri (GLenum, GLenum, GLint); +GLAPI void APIENTRY glConvolutionParameteriv (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glCopyConvolutionFilter1D (GLenum, GLenum, GLint, GLint, GLsizei); +GLAPI void APIENTRY glCopyConvolutionFilter2D (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); +GLAPI void APIENTRY glGetConvolutionFilter (GLenum, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetConvolutionParameterfv (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetConvolutionParameteriv (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetSeparableFilter (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); +GLAPI void APIENTRY glSeparableFilter2D (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); +GLAPI void APIENTRY glGetHistogram (GLenum, GLboolean, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetHistogramParameterfv (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetHistogramParameteriv (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetMinmax (GLenum, GLboolean, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetMinmaxParameterfv (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetMinmaxParameteriv (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glHistogram (GLenum, GLsizei, GLenum, GLboolean); +GLAPI void APIENTRY glMinmax (GLenum, GLenum, GLboolean); +GLAPI void APIENTRY glResetHistogram (GLenum); +GLAPI void APIENTRY glResetMinmax (GLenum); +GLAPI void APIENTRY glTexImage3D (GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glCopyTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDCOLORPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); +typedef void (APIENTRYP PFNGLBLENDEQUATIONPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +typedef void (APIENTRYP PFNGLCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCOLORTABLEPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFPROC) (GLenum target, GLenum pname, GLfloat params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIPROC) (GLenum target, GLenum pname, GLint params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTERPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMINMAXPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLHISTOGRAMPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLMINMAXPROC) (GLenum target, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLRESETHISTOGRAMPROC) (GLenum target); +typedef void (APIENTRYP PFNGLRESETMINMAXPROC) (GLenum target); +typedef void (APIENTRYP PFNGLTEXIMAGE3DPROC) (GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif + +#ifndef GL_VERSION_1_3 +#define GL_VERSION_1_3 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTexture (GLenum); +GLAPI void APIENTRY glClientActiveTexture (GLenum); +GLAPI void APIENTRY glMultiTexCoord1d (GLenum, GLdouble); +GLAPI void APIENTRY glMultiTexCoord1dv (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord1f (GLenum, GLfloat); +GLAPI void APIENTRY glMultiTexCoord1fv (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord1i (GLenum, GLint); +GLAPI void APIENTRY glMultiTexCoord1iv (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord1s (GLenum, GLshort); +GLAPI void APIENTRY glMultiTexCoord1sv (GLenum, const GLshort *); +GLAPI void APIENTRY glMultiTexCoord2d (GLenum, GLdouble, GLdouble); +GLAPI void APIENTRY glMultiTexCoord2dv (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord2f (GLenum, GLfloat, GLfloat); +GLAPI void APIENTRY glMultiTexCoord2fv (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord2i (GLenum, GLint, GLint); +GLAPI void APIENTRY glMultiTexCoord2iv (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord2s (GLenum, GLshort, GLshort); +GLAPI void APIENTRY glMultiTexCoord2sv (GLenum, const GLshort *); +GLAPI void APIENTRY glMultiTexCoord3d (GLenum, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glMultiTexCoord3dv (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord3f (GLenum, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glMultiTexCoord3fv (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord3i (GLenum, GLint, GLint, GLint); +GLAPI void APIENTRY glMultiTexCoord3iv (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord3s (GLenum, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glMultiTexCoord3sv (GLenum, const GLshort *); +GLAPI void APIENTRY glMultiTexCoord4d (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glMultiTexCoord4dv (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord4f (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glMultiTexCoord4fv (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord4i (GLenum, GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glMultiTexCoord4iv (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord4s (GLenum, GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glMultiTexCoord4sv (GLenum, const GLshort *); +GLAPI void APIENTRY glLoadTransposeMatrixf (const GLfloat *); +GLAPI void APIENTRY glLoadTransposeMatrixd (const GLdouble *); +GLAPI void APIENTRY glMultTransposeMatrixf (const GLfloat *); +GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *); +GLAPI void APIENTRY glSampleCoverage (GLclampf, GLboolean); +GLAPI void APIENTRY glCompressedTexImage3D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexImage2D (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexImage1D (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexSubImage3D (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexSubImage2D (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexSubImage1D (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glGetCompressedTexImage (GLenum, GLint, GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DPROC) (GLenum target, GLdouble s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FPROC) (GLenum target, GLfloat s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IPROC) (GLenum target, GLint s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SPROC) (GLenum target, GLshort s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DPROC) (GLenum target, GLdouble s, GLdouble t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FPROC) (GLenum target, GLfloat s, GLfloat t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IPROC) (GLenum target, GLint s, GLint t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SPROC) (GLenum target, GLshort s, GLshort t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IPROC) (GLenum target, GLint s, GLint t, GLint r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SPROC) (GLenum target, GLshort s, GLshort t, GLshort r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEPROC) (GLenum target, GLint level, GLvoid *img); +#endif + +#ifndef GL_VERSION_1_4 +#define GL_VERSION_1_4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparate (GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glFogCoordf (GLfloat); +GLAPI void APIENTRY glFogCoordfv (const GLfloat *); +GLAPI void APIENTRY glFogCoordd (GLdouble); +GLAPI void APIENTRY glFogCoorddv (const GLdouble *); +GLAPI void APIENTRY glFogCoordPointer (GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glMultiDrawArrays (GLenum, GLint *, GLsizei *, GLsizei); +GLAPI void APIENTRY glMultiDrawElements (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); +GLAPI void APIENTRY glPointParameterf (GLenum, GLfloat); +GLAPI void APIENTRY glPointParameterfv (GLenum, const GLfloat *); +GLAPI void APIENTRY glPointParameteri (GLenum, GLint); +GLAPI void APIENTRY glPointParameteriv (GLenum, const GLint *); +GLAPI void APIENTRY glSecondaryColor3b (GLbyte, GLbyte, GLbyte); +GLAPI void APIENTRY glSecondaryColor3bv (const GLbyte *); +GLAPI void APIENTRY glSecondaryColor3d (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glSecondaryColor3dv (const GLdouble *); +GLAPI void APIENTRY glSecondaryColor3f (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glSecondaryColor3fv (const GLfloat *); +GLAPI void APIENTRY glSecondaryColor3i (GLint, GLint, GLint); +GLAPI void APIENTRY glSecondaryColor3iv (const GLint *); +GLAPI void APIENTRY glSecondaryColor3s (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glSecondaryColor3sv (const GLshort *); +GLAPI void APIENTRY glSecondaryColor3ub (GLubyte, GLubyte, GLubyte); +GLAPI void APIENTRY glSecondaryColor3ubv (const GLubyte *); +GLAPI void APIENTRY glSecondaryColor3ui (GLuint, GLuint, GLuint); +GLAPI void APIENTRY glSecondaryColor3uiv (const GLuint *); +GLAPI void APIENTRY glSecondaryColor3us (GLushort, GLushort, GLushort); +GLAPI void APIENTRY glSecondaryColor3usv (const GLushort *); +GLAPI void APIENTRY glSecondaryColorPointer (GLint, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glWindowPos2d (GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos2dv (const GLdouble *); +GLAPI void APIENTRY glWindowPos2f (GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos2fv (const GLfloat *); +GLAPI void APIENTRY glWindowPos2i (GLint, GLint); +GLAPI void APIENTRY glWindowPos2iv (const GLint *); +GLAPI void APIENTRY glWindowPos2s (GLshort, GLshort); +GLAPI void APIENTRY glWindowPos2sv (const GLshort *); +GLAPI void APIENTRY glWindowPos3d (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos3dv (const GLdouble *); +GLAPI void APIENTRY glWindowPos3f (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos3fv (const GLfloat *); +GLAPI void APIENTRY glWindowPos3i (GLint, GLint, GLint); +GLAPI void APIENTRY glWindowPos3iv (const GLint *); +GLAPI void APIENTRY glWindowPos3s (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glWindowPos3sv (const GLshort *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +typedef void (APIENTRYP PFNGLFOGCOORDFPROC) (GLfloat coord); +typedef void (APIENTRYP PFNGLFOGCOORDFVPROC) (const GLfloat *coord); +typedef void (APIENTRYP PFNGLFOGCOORDDPROC) (GLdouble coord); +typedef void (APIENTRYP PFNGLFOGCOORDDVPROC) (const GLdouble *coord); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BPROC) (GLbyte red, GLbyte green, GLbyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DPROC) (GLdouble red, GLdouble green, GLdouble blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FPROC) (GLfloat red, GLfloat green, GLfloat blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IPROC) (GLint red, GLint green, GLint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SPROC) (GLshort red, GLshort green, GLshort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBPROC) (GLubyte red, GLubyte green, GLubyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVPROC) (const GLubyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIPROC) (GLuint red, GLuint green, GLuint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVPROC) (const GLuint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USPROC) (GLushort red, GLushort green, GLushort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVPROC) (const GLushort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLWINDOWPOS2DPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVPROC) (const GLshort *v); +#endif + +#ifndef GL_VERSION_1_5 +#define GL_VERSION_1_5 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueries (GLsizei, GLuint *); +GLAPI void APIENTRY glDeleteQueries (GLsizei, const GLuint *); +GLAPI GLboolean APIENTRY glIsQuery (GLuint); +GLAPI void APIENTRY glBeginQuery (GLenum, GLuint); +GLAPI void APIENTRY glEndQuery (GLenum); +GLAPI void APIENTRY glGetQueryiv (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetQueryObjectiv (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetQueryObjectuiv (GLuint, GLenum, GLuint *); +GLAPI void APIENTRY glBindBuffer (GLenum, GLuint); +GLAPI void APIENTRY glDeleteBuffers (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenBuffers (GLsizei, GLuint *); +GLAPI GLboolean APIENTRY glIsBuffer (GLuint); +GLAPI void APIENTRY glBufferData (GLenum, GLsizeiptr, const GLvoid *, GLenum); +GLAPI void APIENTRY glBufferSubData (GLenum, GLintptr, GLsizeiptr, const GLvoid *); +GLAPI void APIENTRY glGetBufferSubData (GLenum, GLintptr, GLsizeiptr, GLvoid *); +GLAPI GLvoid* APIENTRY glMapBuffer (GLenum, GLenum); +GLAPI GLboolean APIENTRY glUnmapBuffer (GLenum); +GLAPI void APIENTRY glGetBufferParameteriv (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetBufferPointerv (GLenum, GLenum, GLvoid* *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENQUERIESPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVPROC) (GLuint id, GLenum pname, GLuint *params); +typedef void (APIENTRYP PFNGLBINDBUFFERPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAPROC) (GLenum target, GLsizeiptr size, const GLvoid *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLvoid *data); +typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVPROC) (GLenum target, GLenum pname, GLvoid* *params); +#endif + +#ifndef GL_VERSION_2_0 +#define GL_VERSION_2_0 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparate (GLenum, GLenum); +GLAPI void APIENTRY glDrawBuffers (GLsizei, const GLenum *); +GLAPI void APIENTRY glStencilOpSeparate (GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glStencilFuncSeparate (GLenum, GLenum, GLint, GLuint); +GLAPI void APIENTRY glStencilMaskSeparate (GLenum, GLuint); +GLAPI void APIENTRY glAttachShader (GLuint, GLuint); +GLAPI void APIENTRY glBindAttribLocation (GLuint, GLuint, const GLchar *); +GLAPI void APIENTRY glCompileShader (GLuint); +GLAPI GLuint APIENTRY glCreateProgram (void); +GLAPI GLuint APIENTRY glCreateShader (GLenum); +GLAPI void APIENTRY glDeleteProgram (GLuint); +GLAPI void APIENTRY glDeleteShader (GLuint); +GLAPI void APIENTRY glDetachShader (GLuint, GLuint); +GLAPI void APIENTRY glDisableVertexAttribArray (GLuint); +GLAPI void APIENTRY glEnableVertexAttribArray (GLuint); +GLAPI void APIENTRY glGetActiveAttrib (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); +GLAPI void APIENTRY glGetActiveUniform (GLuint, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLchar *); +GLAPI void APIENTRY glGetAttachedShaders (GLuint, GLsizei, GLsizei *, GLuint *); +GLAPI GLint APIENTRY glGetAttribLocation (GLuint, const GLchar *); +GLAPI void APIENTRY glGetProgramiv (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetProgramInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); +GLAPI void APIENTRY glGetShaderiv (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetShaderInfoLog (GLuint, GLsizei, GLsizei *, GLchar *); +GLAPI void APIENTRY glGetShaderSource (GLuint, GLsizei, GLsizei *, GLchar *); +GLAPI GLint APIENTRY glGetUniformLocation (GLuint, const GLchar *); +GLAPI void APIENTRY glGetUniformfv (GLuint, GLint, GLfloat *); +GLAPI void APIENTRY glGetUniformiv (GLuint, GLint, GLint *); +GLAPI void APIENTRY glGetVertexAttribdv (GLuint, GLenum, GLdouble *); +GLAPI void APIENTRY glGetVertexAttribfv (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetVertexAttribiv (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetVertexAttribPointerv (GLuint, GLenum, GLvoid* *); +GLAPI GLboolean APIENTRY glIsProgram (GLuint); +GLAPI GLboolean APIENTRY glIsShader (GLuint); +GLAPI void APIENTRY glLinkProgram (GLuint); +GLAPI void APIENTRY glShaderSource (GLuint, GLsizei, const GLchar* *, const GLint *); +GLAPI void APIENTRY glUseProgram (GLuint); +GLAPI void APIENTRY glUniform1f (GLint, GLfloat); +GLAPI void APIENTRY glUniform2f (GLint, GLfloat, GLfloat); +GLAPI void APIENTRY glUniform3f (GLint, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glUniform4f (GLint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glUniform1i (GLint, GLint); +GLAPI void APIENTRY glUniform2i (GLint, GLint, GLint); +GLAPI void APIENTRY glUniform3i (GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glUniform4i (GLint, GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glUniform1fv (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform2fv (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform3fv (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform4fv (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform1iv (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniform2iv (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniform3iv (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniform4iv (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniformMatrix2fv (GLint, GLsizei, GLboolean, const GLfloat *); +GLAPI void APIENTRY glUniformMatrix3fv (GLint, GLsizei, GLboolean, const GLfloat *); +GLAPI void APIENTRY glUniformMatrix4fv (GLint, GLsizei, GLboolean, const GLfloat *); +GLAPI void APIENTRY glValidateProgram (GLuint); +GLAPI void APIENTRY glVertexAttrib1d (GLuint, GLdouble); +GLAPI void APIENTRY glVertexAttrib1dv (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib1f (GLuint, GLfloat); +GLAPI void APIENTRY glVertexAttrib1fv (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib1s (GLuint, GLshort); +GLAPI void APIENTRY glVertexAttrib1sv (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib2d (GLuint, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib2dv (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib2f (GLuint, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib2fv (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib2s (GLuint, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib2sv (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib3d (GLuint, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib3dv (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib3f (GLuint, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib3fv (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib3s (GLuint, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib3sv (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4Nbv (GLuint, const GLbyte *); +GLAPI void APIENTRY glVertexAttrib4Niv (GLuint, const GLint *); +GLAPI void APIENTRY glVertexAttrib4Nsv (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4Nub (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); +GLAPI void APIENTRY glVertexAttrib4Nubv (GLuint, const GLubyte *); +GLAPI void APIENTRY glVertexAttrib4Nuiv (GLuint, const GLuint *); +GLAPI void APIENTRY glVertexAttrib4Nusv (GLuint, const GLushort *); +GLAPI void APIENTRY glVertexAttrib4bv (GLuint, const GLbyte *); +GLAPI void APIENTRY glVertexAttrib4d (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib4dv (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib4f (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib4fv (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib4iv (GLuint, const GLint *); +GLAPI void APIENTRY glVertexAttrib4s (GLuint, GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib4sv (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4ubv (GLuint, const GLubyte *); +GLAPI void APIENTRY glVertexAttrib4uiv (GLuint, const GLuint *); +GLAPI void APIENTRY glVertexAttrib4usv (GLuint, const GLushort *); +GLAPI void APIENTRY glVertexAttribPointer (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEPROC) (GLenum modeRGB, GLenum modeAlpha); +typedef void (APIENTRYP PFNGLDRAWBUFFERSPROC) (GLsizei n, const GLenum *bufs); +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); +typedef void (APIENTRYP PFNGLSTENCILMASKSEPARATEPROC) (GLenum face, GLuint mask); +typedef void (APIENTRYP PFNGLATTACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONPROC) (GLuint program, GLuint index, const GLchar *name); +typedef void (APIENTRYP PFNGLCOMPILESHADERPROC) (GLuint shader); +typedef GLuint (APIENTRYP PFNGLCREATEPROGRAMPROC) (void); +typedef GLuint (APIENTRYP PFNGLCREATESHADERPROC) (GLenum type); +typedef void (APIENTRYP PFNGLDELETEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLDELETESHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLDETACHSHADERPROC) (GLuint program, GLuint shader); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYPROC) (GLuint index); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMPROC) (GLuint program, GLuint index, GLsizei bufSize, GLsizei *length, GLint *size, GLenum *type, GLchar *name); +typedef void (APIENTRYP PFNGLGETATTACHEDSHADERSPROC) (GLuint program, GLsizei maxCount, GLsizei *count, GLuint *obj); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETPROGRAMIVPROC) (GLuint program, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMINFOLOGPROC) (GLuint program, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERIVPROC) (GLuint shader, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERINFOLOGPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *infoLog); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEPROC) (GLuint shader, GLsizei bufSize, GLsizei *length, GLchar *source); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONPROC) (GLuint program, const GLchar *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVPROC) (GLuint program, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVPROC) (GLuint program, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMPROC) (GLuint program); +typedef GLboolean (APIENTRYP PFNGLISSHADERPROC) (GLuint shader); +typedef void (APIENTRYP PFNGLLINKPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLSHADERSOURCEPROC) (GLuint shader, GLsizei count, const GLchar* *string, const GLint *length); +typedef void (APIENTRYP PFNGLUSEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLUNIFORM1FPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMPROC) (GLuint program); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_ARB_multitexture +#define GL_ARB_multitexture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveTextureARB (GLenum); +GLAPI void APIENTRY glClientActiveTextureARB (GLenum); +GLAPI void APIENTRY glMultiTexCoord1dARB (GLenum, GLdouble); +GLAPI void APIENTRY glMultiTexCoord1dvARB (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord1fARB (GLenum, GLfloat); +GLAPI void APIENTRY glMultiTexCoord1fvARB (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord1iARB (GLenum, GLint); +GLAPI void APIENTRY glMultiTexCoord1ivARB (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord1sARB (GLenum, GLshort); +GLAPI void APIENTRY glMultiTexCoord1svARB (GLenum, const GLshort *); +GLAPI void APIENTRY glMultiTexCoord2dARB (GLenum, GLdouble, GLdouble); +GLAPI void APIENTRY glMultiTexCoord2dvARB (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord2fARB (GLenum, GLfloat, GLfloat); +GLAPI void APIENTRY glMultiTexCoord2fvARB (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord2iARB (GLenum, GLint, GLint); +GLAPI void APIENTRY glMultiTexCoord2ivARB (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord2sARB (GLenum, GLshort, GLshort); +GLAPI void APIENTRY glMultiTexCoord2svARB (GLenum, const GLshort *); +GLAPI void APIENTRY glMultiTexCoord3dARB (GLenum, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glMultiTexCoord3dvARB (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord3fARB (GLenum, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glMultiTexCoord3fvARB (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord3iARB (GLenum, GLint, GLint, GLint); +GLAPI void APIENTRY glMultiTexCoord3ivARB (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord3sARB (GLenum, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glMultiTexCoord3svARB (GLenum, const GLshort *); +GLAPI void APIENTRY glMultiTexCoord4dARB (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glMultiTexCoord4dvARB (GLenum, const GLdouble *); +GLAPI void APIENTRY glMultiTexCoord4fARB (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glMultiTexCoord4fvARB (GLenum, const GLfloat *); +GLAPI void APIENTRY glMultiTexCoord4iARB (GLenum, GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glMultiTexCoord4ivARB (GLenum, const GLint *); +GLAPI void APIENTRY glMultiTexCoord4sARB (GLenum, GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glMultiTexCoord4svARB (GLenum, const GLshort *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLACTIVETEXTUREARBPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLCLIENTACTIVETEXTUREARBPROC) (GLenum texture); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DARBPROC) (GLenum target, GLdouble s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FARBPROC) (GLenum target, GLfloat s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IARBPROC) (GLenum target, GLint s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SARBPROC) (GLenum target, GLshort s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DARBPROC) (GLenum target, GLdouble s, GLdouble t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FARBPROC) (GLenum target, GLfloat s, GLfloat t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IARBPROC) (GLenum target, GLint s, GLint t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SARBPROC) (GLenum target, GLshort s, GLshort t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IARBPROC) (GLenum target, GLint s, GLint t, GLint r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3SVARBPROC) (GLenum target, const GLshort *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DARBPROC) (GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4DVARBPROC) (GLenum target, const GLdouble *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FARBPROC) (GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4FVARBPROC) (GLenum target, const GLfloat *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IARBPROC) (GLenum target, GLint s, GLint t, GLint r, GLint q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4IVARBPROC) (GLenum target, const GLint *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SARBPROC) (GLenum target, GLshort s, GLshort t, GLshort r, GLshort q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4SVARBPROC) (GLenum target, const GLshort *v); +#endif + +#ifndef GL_ARB_transpose_matrix +#define GL_ARB_transpose_matrix 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLoadTransposeMatrixfARB (const GLfloat *); +GLAPI void APIENTRY glLoadTransposeMatrixdARB (const GLdouble *); +GLAPI void APIENTRY glMultTransposeMatrixfARB (const GLfloat *); +GLAPI void APIENTRY glMultTransposeMatrixdARB (const GLdouble *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLLOADTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXFARBPROC) (const GLfloat *m); +typedef void (APIENTRYP PFNGLMULTTRANSPOSEMATRIXDARBPROC) (const GLdouble *m); +#endif + +#ifndef GL_ARB_multisample +#define GL_ARB_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleCoverageARB (GLclampf, GLboolean); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSAMPLECOVERAGEARBPROC) (GLclampf value, GLboolean invert); +#endif + +#ifndef GL_ARB_texture_env_add +#define GL_ARB_texture_env_add 1 +#endif + +#ifndef GL_ARB_texture_cube_map +#define GL_ARB_texture_cube_map 1 +#endif + +#ifndef GL_ARB_texture_compression +#define GL_ARB_texture_compression 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCompressedTexImage3DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexImage2DARB (GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexImage1DARB (GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexSubImage3DARB (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexSubImage2DARB (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glCompressedTexSubImage1DARB (GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum, GLint, GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE3DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE2DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXIMAGE1DARBPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETCOMPRESSEDTEXIMAGEARBPROC) (GLenum target, GLint level, GLvoid *img); +#endif + +#ifndef GL_ARB_texture_border_clamp +#define GL_ARB_texture_border_clamp 1 +#endif + +#ifndef GL_ARB_point_parameters +#define GL_ARB_point_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfARB (GLenum, GLfloat); +GLAPI void APIENTRY glPointParameterfvARB (GLenum, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERFARBPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVARBPROC) (GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_ARB_vertex_blend +#define GL_ARB_vertex_blend 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWeightbvARB (GLint, const GLbyte *); +GLAPI void APIENTRY glWeightsvARB (GLint, const GLshort *); +GLAPI void APIENTRY glWeightivARB (GLint, const GLint *); +GLAPI void APIENTRY glWeightfvARB (GLint, const GLfloat *); +GLAPI void APIENTRY glWeightdvARB (GLint, const GLdouble *); +GLAPI void APIENTRY glWeightubvARB (GLint, const GLubyte *); +GLAPI void APIENTRY glWeightusvARB (GLint, const GLushort *); +GLAPI void APIENTRY glWeightuivARB (GLint, const GLuint *); +GLAPI void APIENTRY glWeightPointerARB (GLint, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glVertexBlendARB (GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLWEIGHTBVARBPROC) (GLint size, const GLbyte *weights); +typedef void (APIENTRYP PFNGLWEIGHTSVARBPROC) (GLint size, const GLshort *weights); +typedef void (APIENTRYP PFNGLWEIGHTIVARBPROC) (GLint size, const GLint *weights); +typedef void (APIENTRYP PFNGLWEIGHTFVARBPROC) (GLint size, const GLfloat *weights); +typedef void (APIENTRYP PFNGLWEIGHTDVARBPROC) (GLint size, const GLdouble *weights); +typedef void (APIENTRYP PFNGLWEIGHTUBVARBPROC) (GLint size, const GLubyte *weights); +typedef void (APIENTRYP PFNGLWEIGHTUSVARBPROC) (GLint size, const GLushort *weights); +typedef void (APIENTRYP PFNGLWEIGHTUIVARBPROC) (GLint size, const GLuint *weights); +typedef void (APIENTRYP PFNGLWEIGHTPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXBLENDARBPROC) (GLint count); +#endif + +#ifndef GL_ARB_matrix_palette +#define GL_ARB_matrix_palette 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCurrentPaletteMatrixARB (GLint); +GLAPI void APIENTRY glMatrixIndexubvARB (GLint, const GLubyte *); +GLAPI void APIENTRY glMatrixIndexusvARB (GLint, const GLushort *); +GLAPI void APIENTRY glMatrixIndexuivARB (GLint, const GLuint *); +GLAPI void APIENTRY glMatrixIndexPointerARB (GLint, GLenum, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCURRENTPALETTEMATRIXARBPROC) (GLint index); +typedef void (APIENTRYP PFNGLMATRIXINDEXUBVARBPROC) (GLint size, const GLubyte *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXUSVARBPROC) (GLint size, const GLushort *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXUIVARBPROC) (GLint size, const GLuint *indices); +typedef void (APIENTRYP PFNGLMATRIXINDEXPOINTERARBPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_ARB_texture_env_combine +#define GL_ARB_texture_env_combine 1 +#endif + +#ifndef GL_ARB_texture_env_crossbar +#define GL_ARB_texture_env_crossbar 1 +#endif + +#ifndef GL_ARB_texture_env_dot3 +#define GL_ARB_texture_env_dot3 1 +#endif + +#ifndef GL_ARB_texture_mirrored_repeat +#define GL_ARB_texture_mirrored_repeat 1 +#endif + +#ifndef GL_ARB_depth_texture +#define GL_ARB_depth_texture 1 +#endif + +#ifndef GL_ARB_shadow +#define GL_ARB_shadow 1 +#endif + +#ifndef GL_ARB_shadow_ambient +#define GL_ARB_shadow_ambient 1 +#endif + +#ifndef GL_ARB_window_pos +#define GL_ARB_window_pos 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowPos2dARB (GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos2dvARB (const GLdouble *); +GLAPI void APIENTRY glWindowPos2fARB (GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos2fvARB (const GLfloat *); +GLAPI void APIENTRY glWindowPos2iARB (GLint, GLint); +GLAPI void APIENTRY glWindowPos2ivARB (const GLint *); +GLAPI void APIENTRY glWindowPos2sARB (GLshort, GLshort); +GLAPI void APIENTRY glWindowPos2svARB (const GLshort *); +GLAPI void APIENTRY glWindowPos3dARB (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos3dvARB (const GLdouble *); +GLAPI void APIENTRY glWindowPos3fARB (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos3fvARB (const GLfloat *); +GLAPI void APIENTRY glWindowPos3iARB (GLint, GLint, GLint); +GLAPI void APIENTRY glWindowPos3ivARB (const GLint *); +GLAPI void APIENTRY glWindowPos3sARB (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glWindowPos3svARB (const GLshort *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLWINDOWPOS2DARBPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVARBPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FARBPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVARBPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IARBPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVARBPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SARBPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVARBPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DARBPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVARBPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FARBPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVARBPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IARBPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVARBPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SARBPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVARBPROC) (const GLshort *v); +#endif + +#ifndef GL_ARB_vertex_program +#define GL_ARB_vertex_program 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttrib1dARB (GLuint, GLdouble); +GLAPI void APIENTRY glVertexAttrib1dvARB (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib1fARB (GLuint, GLfloat); +GLAPI void APIENTRY glVertexAttrib1fvARB (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib1sARB (GLuint, GLshort); +GLAPI void APIENTRY glVertexAttrib1svARB (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib2dARB (GLuint, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib2dvARB (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib2fARB (GLuint, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib2fvARB (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib2sARB (GLuint, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib2svARB (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib3dARB (GLuint, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib3dvARB (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib3fARB (GLuint, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib3fvARB (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib3sARB (GLuint, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib3svARB (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4NbvARB (GLuint, const GLbyte *); +GLAPI void APIENTRY glVertexAttrib4NivARB (GLuint, const GLint *); +GLAPI void APIENTRY glVertexAttrib4NsvARB (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4NubARB (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); +GLAPI void APIENTRY glVertexAttrib4NubvARB (GLuint, const GLubyte *); +GLAPI void APIENTRY glVertexAttrib4NuivARB (GLuint, const GLuint *); +GLAPI void APIENTRY glVertexAttrib4NusvARB (GLuint, const GLushort *); +GLAPI void APIENTRY glVertexAttrib4bvARB (GLuint, const GLbyte *); +GLAPI void APIENTRY glVertexAttrib4dARB (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib4dvARB (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib4fARB (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib4fvARB (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib4ivARB (GLuint, const GLint *); +GLAPI void APIENTRY glVertexAttrib4sARB (GLuint, GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib4svARB (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4ubvARB (GLuint, const GLubyte *); +GLAPI void APIENTRY glVertexAttrib4uivARB (GLuint, const GLuint *); +GLAPI void APIENTRY glVertexAttrib4usvARB (GLuint, const GLushort *); +GLAPI void APIENTRY glVertexAttribPointerARB (GLuint, GLint, GLenum, GLboolean, GLsizei, const GLvoid *); +GLAPI void APIENTRY glEnableVertexAttribArrayARB (GLuint); +GLAPI void APIENTRY glDisableVertexAttribArrayARB (GLuint); +GLAPI void APIENTRY glProgramStringARB (GLenum, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glBindProgramARB (GLenum, GLuint); +GLAPI void APIENTRY glDeleteProgramsARB (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenProgramsARB (GLsizei, GLuint *); +GLAPI void APIENTRY glProgramEnvParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glProgramEnvParameter4dvARB (GLenum, GLuint, const GLdouble *); +GLAPI void APIENTRY glProgramEnvParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glProgramEnvParameter4fvARB (GLenum, GLuint, const GLfloat *); +GLAPI void APIENTRY glProgramLocalParameter4dARB (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glProgramLocalParameter4dvARB (GLenum, GLuint, const GLdouble *); +GLAPI void APIENTRY glProgramLocalParameter4fARB (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glProgramLocalParameter4fvARB (GLenum, GLuint, const GLfloat *); +GLAPI void APIENTRY glGetProgramEnvParameterdvARB (GLenum, GLuint, GLdouble *); +GLAPI void APIENTRY glGetProgramEnvParameterfvARB (GLenum, GLuint, GLfloat *); +GLAPI void APIENTRY glGetProgramLocalParameterdvARB (GLenum, GLuint, GLdouble *); +GLAPI void APIENTRY glGetProgramLocalParameterfvARB (GLenum, GLuint, GLfloat *); +GLAPI void APIENTRY glGetProgramivARB (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetProgramStringARB (GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetVertexAttribdvARB (GLuint, GLenum, GLdouble *); +GLAPI void APIENTRY glGetVertexAttribfvARB (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetVertexAttribivARB (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetVertexAttribPointervARB (GLuint, GLenum, GLvoid* *); +GLAPI GLboolean APIENTRY glIsProgramARB (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DARBPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FARBPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SARBPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DARBPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FARBPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SARBPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NBVARBPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NIVARBPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NSVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBARBPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUBVARBPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUIVARBPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4NUSVARBPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4BVARBPROC) (GLuint index, const GLbyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DARBPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVARBPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FARBPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVARBPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4IVARBPROC) (GLuint index, const GLint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SARBPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVARBPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVARBPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UIVARBPROC) (GLuint index, const GLuint *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4USVARBPROC) (GLuint index, const GLushort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERARBPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLENABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); +typedef void (APIENTRYP PFNGLDISABLEVERTEXATTRIBARRAYARBPROC) (GLuint index); +typedef void (APIENTRYP PFNGLPROGRAMSTRINGARBPROC) (GLenum target, GLenum format, GLsizei len, const GLvoid *string); +typedef void (APIENTRYP PFNGLBINDPROGRAMARBPROC) (GLenum target, GLuint program); +typedef void (APIENTRYP PFNGLDELETEPROGRAMSARBPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLGENPROGRAMSARBPROC) (GLsizei n, GLuint *programs); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMENVPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DARBPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4DVARBPROC) (GLenum target, GLuint index, const GLdouble *params); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FARBPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMLOCALPARAMETER4FVARBPROC) (GLenum target, GLuint index, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMENVPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC) (GLenum target, GLuint index, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC) (GLenum target, GLuint index, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGARBPROC) (GLenum target, GLenum pname, GLvoid *string); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVARBPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVARBPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVARBPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVARBPROC) (GLuint index, GLenum pname, GLvoid* *pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMARBPROC) (GLuint program); +#endif + +#ifndef GL_ARB_fragment_program +#define GL_ARB_fragment_program 1 +/* All ARB_fragment_program entry points are shared with ARB_vertex_program. */ +#endif + +#ifndef GL_ARB_vertex_buffer_object +#define GL_ARB_vertex_buffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindBufferARB (GLenum, GLuint); +GLAPI void APIENTRY glDeleteBuffersARB (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenBuffersARB (GLsizei, GLuint *); +GLAPI GLboolean APIENTRY glIsBufferARB (GLuint); +GLAPI void APIENTRY glBufferDataARB (GLenum, GLsizeiptrARB, const GLvoid *, GLenum); +GLAPI void APIENTRY glBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, const GLvoid *); +GLAPI void APIENTRY glGetBufferSubDataARB (GLenum, GLintptrARB, GLsizeiptrARB, GLvoid *); +GLAPI GLvoid* APIENTRY glMapBufferARB (GLenum, GLenum); +GLAPI GLboolean APIENTRY glUnmapBufferARB (GLenum); +GLAPI void APIENTRY glGetBufferParameterivARB (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetBufferPointervARB (GLenum, GLenum, GLvoid* *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDBUFFERARBPROC) (GLenum target, GLuint buffer); +typedef void (APIENTRYP PFNGLDELETEBUFFERSARBPROC) (GLsizei n, const GLuint *buffers); +typedef void (APIENTRYP PFNGLGENBUFFERSARBPROC) (GLsizei n, GLuint *buffers); +typedef GLboolean (APIENTRYP PFNGLISBUFFERARBPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLBUFFERDATAARBPROC) (GLenum target, GLsizeiptrARB size, const GLvoid *data, GLenum usage); +typedef void (APIENTRYP PFNGLBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid *data); +typedef void (APIENTRYP PFNGLGETBUFFERSUBDATAARBPROC) (GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid *data); +typedef GLvoid* (APIENTRYP PFNGLMAPBUFFERARBPROC) (GLenum target, GLenum access); +typedef GLboolean (APIENTRYP PFNGLUNMAPBUFFERARBPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETBUFFERPARAMETERIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETBUFFERPOINTERVARBPROC) (GLenum target, GLenum pname, GLvoid* *params); +#endif + +#ifndef GL_ARB_occlusion_query +#define GL_ARB_occlusion_query 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueriesARB (GLsizei, GLuint *); +GLAPI void APIENTRY glDeleteQueriesARB (GLsizei, const GLuint *); +GLAPI GLboolean APIENTRY glIsQueryARB (GLuint); +GLAPI void APIENTRY glBeginQueryARB (GLenum, GLuint); +GLAPI void APIENTRY glEndQueryARB (GLenum); +GLAPI void APIENTRY glGetQueryivARB (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetQueryObjectivARB (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetQueryObjectuivARB (GLuint, GLenum, GLuint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENQUERIESARBPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEQUERIESARBPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISQUERYARBPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINQUERYARBPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLENDQUERYARBPROC) (GLenum target); +typedef void (APIENTRYP PFNGLGETQUERYIVARBPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTIVARBPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETQUERYOBJECTUIVARBPROC) (GLuint id, GLenum pname, GLuint *params); +#endif + +#ifndef GL_ARB_shader_objects +#define GL_ARB_shader_objects 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeleteObjectARB (GLhandleARB); +GLAPI GLhandleARB APIENTRY glGetHandleARB (GLenum); +GLAPI void APIENTRY glDetachObjectARB (GLhandleARB, GLhandleARB); +GLAPI GLhandleARB APIENTRY glCreateShaderObjectARB (GLenum); +GLAPI void APIENTRY glShaderSourceARB (GLhandleARB, GLsizei, const GLcharARB* *, const GLint *); +GLAPI void APIENTRY glCompileShaderARB (GLhandleARB); +GLAPI GLhandleARB APIENTRY glCreateProgramObjectARB (void); +GLAPI void APIENTRY glAttachObjectARB (GLhandleARB, GLhandleARB); +GLAPI void APIENTRY glLinkProgramARB (GLhandleARB); +GLAPI void APIENTRY glUseProgramObjectARB (GLhandleARB); +GLAPI void APIENTRY glValidateProgramARB (GLhandleARB); +GLAPI void APIENTRY glUniform1fARB (GLint, GLfloat); +GLAPI void APIENTRY glUniform2fARB (GLint, GLfloat, GLfloat); +GLAPI void APIENTRY glUniform3fARB (GLint, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glUniform4fARB (GLint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glUniform1iARB (GLint, GLint); +GLAPI void APIENTRY glUniform2iARB (GLint, GLint, GLint); +GLAPI void APIENTRY glUniform3iARB (GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glUniform4iARB (GLint, GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glUniform1fvARB (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform2fvARB (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform3fvARB (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform4fvARB (GLint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glUniform1ivARB (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniform2ivARB (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniform3ivARB (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniform4ivARB (GLint, GLsizei, const GLint *); +GLAPI void APIENTRY glUniformMatrix2fvARB (GLint, GLsizei, GLboolean, const GLfloat *); +GLAPI void APIENTRY glUniformMatrix3fvARB (GLint, GLsizei, GLboolean, const GLfloat *); +GLAPI void APIENTRY glUniformMatrix4fvARB (GLint, GLsizei, GLboolean, const GLfloat *); +GLAPI void APIENTRY glGetObjectParameterfvARB (GLhandleARB, GLenum, GLfloat *); +GLAPI void APIENTRY glGetObjectParameterivARB (GLhandleARB, GLenum, GLint *); +GLAPI void APIENTRY glGetInfoLogARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); +GLAPI void APIENTRY glGetAttachedObjectsARB (GLhandleARB, GLsizei, GLsizei *, GLhandleARB *); +GLAPI GLint APIENTRY glGetUniformLocationARB (GLhandleARB, const GLcharARB *); +GLAPI void APIENTRY glGetActiveUniformARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); +GLAPI void APIENTRY glGetUniformfvARB (GLhandleARB, GLint, GLfloat *); +GLAPI void APIENTRY glGetUniformivARB (GLhandleARB, GLint, GLint *); +GLAPI void APIENTRY glGetShaderSourceARB (GLhandleARB, GLsizei, GLsizei *, GLcharARB *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDELETEOBJECTARBPROC) (GLhandleARB obj); +typedef GLhandleARB (APIENTRYP PFNGLGETHANDLEARBPROC) (GLenum pname); +typedef void (APIENTRYP PFNGLDETACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB attachedObj); +typedef GLhandleARB (APIENTRYP PFNGLCREATESHADEROBJECTARBPROC) (GLenum shaderType); +typedef void (APIENTRYP PFNGLSHADERSOURCEARBPROC) (GLhandleARB shaderObj, GLsizei count, const GLcharARB* *string, const GLint *length); +typedef void (APIENTRYP PFNGLCOMPILESHADERARBPROC) (GLhandleARB shaderObj); +typedef GLhandleARB (APIENTRYP PFNGLCREATEPROGRAMOBJECTARBPROC) (void); +typedef void (APIENTRYP PFNGLATTACHOBJECTARBPROC) (GLhandleARB containerObj, GLhandleARB obj); +typedef void (APIENTRYP PFNGLLINKPROGRAMARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLUSEPROGRAMOBJECTARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLVALIDATEPROGRAMARBPROC) (GLhandleARB programObj); +typedef void (APIENTRYP PFNGLUNIFORM1FARBPROC) (GLint location, GLfloat v0); +typedef void (APIENTRYP PFNGLUNIFORM2FARBPROC) (GLint location, GLfloat v0, GLfloat v1); +typedef void (APIENTRYP PFNGLUNIFORM3FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2); +typedef void (APIENTRYP PFNGLUNIFORM4FARBPROC) (GLint location, GLfloat v0, GLfloat v1, GLfloat v2, GLfloat v3); +typedef void (APIENTRYP PFNGLUNIFORM1IARBPROC) (GLint location, GLint v0); +typedef void (APIENTRYP PFNGLUNIFORM2IARBPROC) (GLint location, GLint v0, GLint v1); +typedef void (APIENTRYP PFNGLUNIFORM3IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2); +typedef void (APIENTRYP PFNGLUNIFORM4IARBPROC) (GLint location, GLint v0, GLint v1, GLint v2, GLint v3); +typedef void (APIENTRYP PFNGLUNIFORM1FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM2FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM3FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM4FVARBPROC) (GLint location, GLsizei count, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORM1IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM2IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM3IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORM4IVARBPROC) (GLint location, GLsizei count, const GLint *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX2FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX3FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLUNIFORMMATRIX4FVARBPROC) (GLint location, GLsizei count, GLboolean transpose, const GLfloat *value); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERFVARBPROC) (GLhandleARB obj, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETOBJECTPARAMETERIVARBPROC) (GLhandleARB obj, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETINFOLOGARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *infoLog); +typedef void (APIENTRYP PFNGLGETATTACHEDOBJECTSARBPROC) (GLhandleARB containerObj, GLsizei maxCount, GLsizei *count, GLhandleARB *obj); +typedef GLint (APIENTRYP PFNGLGETUNIFORMLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); +typedef void (APIENTRYP PFNGLGETACTIVEUNIFORMARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +typedef void (APIENTRYP PFNGLGETUNIFORMFVARBPROC) (GLhandleARB programObj, GLint location, GLfloat *params); +typedef void (APIENTRYP PFNGLGETUNIFORMIVARBPROC) (GLhandleARB programObj, GLint location, GLint *params); +typedef void (APIENTRYP PFNGLGETSHADERSOURCEARBPROC) (GLhandleARB obj, GLsizei maxLength, GLsizei *length, GLcharARB *source); +#endif + +#ifndef GL_ARB_vertex_shader +#define GL_ARB_vertex_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindAttribLocationARB (GLhandleARB, GLuint, const GLcharARB *); +GLAPI void APIENTRY glGetActiveAttribARB (GLhandleARB, GLuint, GLsizei, GLsizei *, GLint *, GLenum *, GLcharARB *); +GLAPI GLint APIENTRY glGetAttribLocationARB (GLhandleARB, const GLcharARB *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDATTRIBLOCATIONARBPROC) (GLhandleARB programObj, GLuint index, const GLcharARB *name); +typedef void (APIENTRYP PFNGLGETACTIVEATTRIBARBPROC) (GLhandleARB programObj, GLuint index, GLsizei maxLength, GLsizei *length, GLint *size, GLenum *type, GLcharARB *name); +typedef GLint (APIENTRYP PFNGLGETATTRIBLOCATIONARBPROC) (GLhandleARB programObj, const GLcharARB *name); +#endif + +#ifndef GL_ARB_fragment_shader +#define GL_ARB_fragment_shader 1 +#endif + +#ifndef GL_ARB_shading_language_100 +#define GL_ARB_shading_language_100 1 +#endif + +#ifndef GL_ARB_texture_non_power_of_two +#define GL_ARB_texture_non_power_of_two 1 +#endif + +#ifndef GL_ARB_point_sprite +#define GL_ARB_point_sprite 1 +#endif + +#ifndef GL_ARB_fragment_program_shadow +#define GL_ARB_fragment_program_shadow 1 +#endif + +#ifndef GL_ARB_draw_buffers +#define GL_ARB_draw_buffers 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawBuffersARB (GLsizei, const GLenum *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWBUFFERSARBPROC) (GLsizei n, const GLenum *bufs); +#endif + +#ifndef GL_ARB_texture_rectangle +#define GL_ARB_texture_rectangle 1 +#endif + +#ifndef GL_ARB_color_buffer_float +#define GL_ARB_color_buffer_float 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glClampColorARB (GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCLAMPCOLORARBPROC) (GLenum target, GLenum clamp); +#endif + +#ifndef GL_ARB_half_float_pixel +#define GL_ARB_half_float_pixel 1 +#endif + +#ifndef GL_ARB_texture_float +#define GL_ARB_texture_float 1 +#endif + +#ifndef GL_ARB_pixel_buffer_object +#define GL_ARB_pixel_buffer_object 1 +#endif + +#ifndef GL_EXT_abgr +#define GL_EXT_abgr 1 +#endif + +#ifndef GL_EXT_blend_color +#define GL_EXT_blend_color 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendColorEXT (GLclampf, GLclampf, GLclampf, GLclampf); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDCOLOREXTPROC) (GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha); +#endif + +#ifndef GL_EXT_polygon_offset +#define GL_EXT_polygon_offset 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPolygonOffsetEXT (GLfloat, GLfloat); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOLYGONOFFSETEXTPROC) (GLfloat factor, GLfloat bias); +#endif + +#ifndef GL_EXT_texture +#define GL_EXT_texture 1 +#endif + +#ifndef GL_EXT_texture3D +#define GL_EXT_texture3D 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage3DEXT (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXIMAGE3DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid *pixels); +#endif + +#ifndef GL_SGIS_texture_filter4 +#define GL_SGIS_texture_filter4 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetTexFilterFuncSGIS (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glTexFilterFuncSGIS (GLenum, GLenum, GLsizei, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLfloat *weights); +typedef void (APIENTRYP PFNGLTEXFILTERFUNCSGISPROC) (GLenum target, GLenum filter, GLsizei n, const GLfloat *weights); +#endif + +#ifndef GL_EXT_subtexture +#define GL_EXT_subtexture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexSubImage1DEXT (GLenum, GLint, GLint, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *pixels); +#endif + +#ifndef GL_EXT_copy_texture +#define GL_EXT_copy_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCopyTexImage1DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLint); +GLAPI void APIENTRY glCopyTexImage2DEXT (GLenum, GLint, GLenum, GLint, GLint, GLsizei, GLsizei, GLint); +GLAPI void APIENTRY glCopyTexSubImage1DEXT (GLenum, GLint, GLint, GLint, GLint, GLsizei); +GLAPI void APIENTRY glCopyTexSubImage2DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); +GLAPI void APIENTRY glCopyTexSubImage3DEXT (GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE1DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXIMAGE2DEXTPROC) (GLenum target, GLint level, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height, GLint border); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE1DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE2DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLCOPYTEXSUBIMAGE3DEXTPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height); +#endif + +#ifndef GL_EXT_histogram +#define GL_EXT_histogram 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetHistogramEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetHistogramParameterfvEXT (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetHistogramParameterivEXT (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetMinmaxEXT (GLenum, GLboolean, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetMinmaxParameterfvEXT (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetMinmaxParameterivEXT (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glHistogramEXT (GLenum, GLsizei, GLenum, GLboolean); +GLAPI void APIENTRY glMinmaxEXT (GLenum, GLenum, GLboolean); +GLAPI void APIENTRY glResetHistogramEXT (GLenum); +GLAPI void APIENTRY glResetMinmaxEXT (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETHISTOGRAMEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETHISTOGRAMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMINMAXEXTPROC) (GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid *values); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMINMAXPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLHISTOGRAMEXTPROC) (GLenum target, GLsizei width, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLMINMAXEXTPROC) (GLenum target, GLenum internalformat, GLboolean sink); +typedef void (APIENTRYP PFNGLRESETHISTOGRAMEXTPROC) (GLenum target); +typedef void (APIENTRYP PFNGLRESETMINMAXEXTPROC) (GLenum target); +#endif + +#ifndef GL_EXT_convolution +#define GL_EXT_convolution 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glConvolutionFilter1DEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glConvolutionFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glConvolutionParameterfEXT (GLenum, GLenum, GLfloat); +GLAPI void APIENTRY glConvolutionParameterfvEXT (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glConvolutionParameteriEXT (GLenum, GLenum, GLint); +GLAPI void APIENTRY glConvolutionParameterivEXT (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glCopyConvolutionFilter1DEXT (GLenum, GLenum, GLint, GLint, GLsizei); +GLAPI void APIENTRY glCopyConvolutionFilter2DEXT (GLenum, GLenum, GLint, GLint, GLsizei, GLsizei); +GLAPI void APIENTRY glGetConvolutionFilterEXT (GLenum, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetConvolutionParameterfvEXT (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetConvolutionParameterivEXT (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetSeparableFilterEXT (GLenum, GLenum, GLenum, GLvoid *, GLvoid *, GLvoid *); +GLAPI void APIENTRY glSeparableFilter2DEXT (GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *image); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint params); +typedef void (APIENTRYP PFNGLCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER1DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLCOPYCONVOLUTIONFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *image); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCONVOLUTIONPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETSEPARABLEFILTEREXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *row, GLvoid *column, GLvoid *span); +typedef void (APIENTRYP PFNGLSEPARABLEFILTER2DEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid *row, const GLvoid *column); +#endif + +#ifndef GL_EXT_color_matrix +#define GL_EXT_color_matrix 1 +#endif + +#ifndef GL_SGI_color_table +#define GL_SGI_color_table 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTableSGI (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glColorTableParameterfvSGI (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glColorTableParameterivSGI (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glCopyColorTableSGI (GLenum, GLenum, GLint, GLint, GLsizei); +GLAPI void APIENTRY glGetColorTableSGI (GLenum, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetColorTableParameterfvSGI (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetColorTableParameterivSGI (GLenum, GLenum, GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOPYCOLORTABLESGIPROC) (GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width); +typedef void (APIENTRYP PFNGLGETCOLORTABLESGIPROC) (GLenum target, GLenum format, GLenum type, GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVSGIPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVSGIPROC) (GLenum target, GLenum pname, GLint *params); +#endif + +#ifndef GL_SGIX_pixel_texture +#define GL_SGIX_pixel_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTexGenSGIX (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELTEXGENSGIXPROC) (GLenum mode); +#endif + +#ifndef GL_SGIS_pixel_texture +#define GL_SGIS_pixel_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTexGenParameteriSGIS (GLenum, GLint); +GLAPI void APIENTRY glPixelTexGenParameterivSGIS (GLenum, const GLint *); +GLAPI void APIENTRY glPixelTexGenParameterfSGIS (GLenum, GLfloat); +GLAPI void APIENTRY glPixelTexGenParameterfvSGIS (GLenum, const GLfloat *); +GLAPI void APIENTRY glGetPixelTexGenParameterivSGIS (GLenum, GLint *); +GLAPI void APIENTRY glGetPixelTexGenParameterfvSGIS (GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERISGISPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFSGISPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERIVSGISPROC) (GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPIXELTEXGENPARAMETERFVSGISPROC) (GLenum pname, GLfloat *params); +#endif + +#ifndef GL_SGIS_texture4D +#define GL_SGIS_texture4D 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexImage4DSGIS (GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glTexSubImage4DSGIS (GLenum, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXIMAGE4DSGISPROC) (GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLint border, GLenum format, GLenum type, const GLvoid *pixels); +typedef void (APIENTRYP PFNGLTEXSUBIMAGE4DSGISPROC) (GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint woffset, GLsizei width, GLsizei height, GLsizei depth, GLsizei size4d, GLenum format, GLenum type, const GLvoid *pixels); +#endif + +#ifndef GL_SGI_texture_color_table +#define GL_SGI_texture_color_table 1 +#endif + +#ifndef GL_EXT_cmyka +#define GL_EXT_cmyka 1 +#endif + +#ifndef GL_EXT_texture_object +#define GL_EXT_texture_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAreTexturesResidentEXT (GLsizei, const GLuint *, GLboolean *); +GLAPI void APIENTRY glBindTextureEXT (GLenum, GLuint); +GLAPI void APIENTRY glDeleteTexturesEXT (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenTexturesEXT (GLsizei, GLuint *); +GLAPI GLboolean APIENTRY glIsTextureEXT (GLuint); +GLAPI void APIENTRY glPrioritizeTexturesEXT (GLsizei, const GLuint *, const GLclampf *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLARETEXTURESRESIDENTEXTPROC) (GLsizei n, const GLuint *textures, GLboolean *residences); +typedef void (APIENTRYP PFNGLBINDTEXTUREEXTPROC) (GLenum target, GLuint texture); +typedef void (APIENTRYP PFNGLDELETETEXTURESEXTPROC) (GLsizei n, const GLuint *textures); +typedef void (APIENTRYP PFNGLGENTEXTURESEXTPROC) (GLsizei n, GLuint *textures); +typedef GLboolean (APIENTRYP PFNGLISTEXTUREEXTPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLPRIORITIZETEXTURESEXTPROC) (GLsizei n, const GLuint *textures, const GLclampf *priorities); +#endif + +#ifndef GL_SGIS_detail_texture +#define GL_SGIS_detail_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDetailTexFuncSGIS (GLenum, GLsizei, const GLfloat *); +GLAPI void APIENTRY glGetDetailTexFuncSGIS (GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDETAILTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETDETAILTEXFUNCSGISPROC) (GLenum target, GLfloat *points); +#endif + +#ifndef GL_SGIS_sharpen_texture +#define GL_SGIS_sharpen_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSharpenTexFuncSGIS (GLenum, GLsizei, const GLfloat *); +GLAPI void APIENTRY glGetSharpenTexFuncSGIS (GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSHARPENTEXFUNCSGISPROC) (GLenum target, GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETSHARPENTEXFUNCSGISPROC) (GLenum target, GLfloat *points); +#endif + +#ifndef GL_EXT_packed_pixels +#define GL_EXT_packed_pixels 1 +#endif + +#ifndef GL_SGIS_texture_lod +#define GL_SGIS_texture_lod 1 +#endif + +#ifndef GL_SGIS_multisample +#define GL_SGIS_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleMaskSGIS (GLclampf, GLboolean); +GLAPI void APIENTRY glSamplePatternSGIS (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSAMPLEMASKSGISPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLSAMPLEPATTERNSGISPROC) (GLenum pattern); +#endif + +#ifndef GL_EXT_rescale_normal +#define GL_EXT_rescale_normal 1 +#endif + +#ifndef GL_EXT_vertex_array +#define GL_EXT_vertex_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glArrayElementEXT (GLint); +GLAPI void APIENTRY glColorPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); +GLAPI void APIENTRY glDrawArraysEXT (GLenum, GLint, GLsizei); +GLAPI void APIENTRY glEdgeFlagPointerEXT (GLsizei, GLsizei, const GLboolean *); +GLAPI void APIENTRY glGetPointervEXT (GLenum, GLvoid* *); +GLAPI void APIENTRY glIndexPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); +GLAPI void APIENTRY glNormalPointerEXT (GLenum, GLsizei, GLsizei, const GLvoid *); +GLAPI void APIENTRY glTexCoordPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); +GLAPI void APIENTRY glVertexPointerEXT (GLint, GLenum, GLsizei, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLARRAYELEMENTEXTPROC) (GLint i); +typedef void (APIENTRYP PFNGLCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLDRAWARRAYSEXTPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLEDGEFLAGPOINTEREXTPROC) (GLsizei stride, GLsizei count, const GLboolean *pointer); +typedef void (APIENTRYP PFNGLGETPOINTERVEXTPROC) (GLenum pname, GLvoid* *params); +typedef void (APIENTRYP PFNGLINDEXPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid *pointer); +#endif + +#ifndef GL_EXT_misc_attribute +#define GL_EXT_misc_attribute 1 +#endif + +#ifndef GL_SGIS_generate_mipmap +#define GL_SGIS_generate_mipmap 1 +#endif + +#ifndef GL_SGIX_clipmap +#define GL_SGIX_clipmap 1 +#endif + +#ifndef GL_SGIX_shadow +#define GL_SGIX_shadow 1 +#endif + +#ifndef GL_SGIS_texture_edge_clamp +#define GL_SGIS_texture_edge_clamp 1 +#endif + +#ifndef GL_SGIS_texture_border_clamp +#define GL_SGIS_texture_border_clamp 1 +#endif + +#ifndef GL_EXT_blend_minmax +#define GL_EXT_blend_minmax 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationEXT (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONEXTPROC) (GLenum mode); +#endif + +#ifndef GL_EXT_blend_subtract +#define GL_EXT_blend_subtract 1 +#endif + +#ifndef GL_EXT_blend_logic_op +#define GL_EXT_blend_logic_op 1 +#endif + +#ifndef GL_SGIX_interlace +#define GL_SGIX_interlace 1 +#endif + +#ifndef GL_SGIX_pixel_tiles +#define GL_SGIX_pixel_tiles 1 +#endif + +#ifndef GL_SGIX_texture_select +#define GL_SGIX_texture_select 1 +#endif + +#ifndef GL_SGIX_sprite +#define GL_SGIX_sprite 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpriteParameterfSGIX (GLenum, GLfloat); +GLAPI void APIENTRY glSpriteParameterfvSGIX (GLenum, const GLfloat *); +GLAPI void APIENTRY glSpriteParameteriSGIX (GLenum, GLint); +GLAPI void APIENTRY glSpriteParameterivSGIX (GLenum, const GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSPRITEPARAMETERFSGIXPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERFVSGIXPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERISGIXPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLSPRITEPARAMETERIVSGIXPROC) (GLenum pname, const GLint *params); +#endif + +#ifndef GL_SGIX_texture_multi_buffer +#define GL_SGIX_texture_multi_buffer 1 +#endif + +#ifndef GL_EXT_point_parameters +#define GL_EXT_point_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfEXT (GLenum, GLfloat); +GLAPI void APIENTRY glPointParameterfvEXT (GLenum, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERFEXTPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVEXTPROC) (GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_SGIS_point_parameters +#define GL_SGIS_point_parameters 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameterfSGIS (GLenum, GLfloat); +GLAPI void APIENTRY glPointParameterfvSGIS (GLenum, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERFSGISPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERFVSGISPROC) (GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_SGIX_instruments +#define GL_SGIX_instruments 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glGetInstrumentsSGIX (void); +GLAPI void APIENTRY glInstrumentsBufferSGIX (GLsizei, GLint *); +GLAPI GLint APIENTRY glPollInstrumentsSGIX (GLint *); +GLAPI void APIENTRY glReadInstrumentsSGIX (GLint); +GLAPI void APIENTRY glStartInstrumentsSGIX (void); +GLAPI void APIENTRY glStopInstrumentsSGIX (GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLint (APIENTRYP PFNGLGETINSTRUMENTSSGIXPROC) (void); +typedef void (APIENTRYP PFNGLINSTRUMENTSBUFFERSGIXPROC) (GLsizei size, GLint *buffer); +typedef GLint (APIENTRYP PFNGLPOLLINSTRUMENTSSGIXPROC) (GLint *marker_p); +typedef void (APIENTRYP PFNGLREADINSTRUMENTSSGIXPROC) (GLint marker); +typedef void (APIENTRYP PFNGLSTARTINSTRUMENTSSGIXPROC) (void); +typedef void (APIENTRYP PFNGLSTOPINSTRUMENTSSGIXPROC) (GLint marker); +#endif + +#ifndef GL_SGIX_texture_scale_bias +#define GL_SGIX_texture_scale_bias 1 +#endif + +#ifndef GL_SGIX_framezoom +#define GL_SGIX_framezoom 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFrameZoomSGIX (GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFRAMEZOOMSGIXPROC) (GLint factor); +#endif + +#ifndef GL_SGIX_tag_sample_buffer +#define GL_SGIX_tag_sample_buffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTagSampleBufferSGIX (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTAGSAMPLEBUFFERSGIXPROC) (void); +#endif + +#ifndef GL_SGIX_polynomial_ffd +#define GL_SGIX_polynomial_ffd 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeformationMap3dSGIX (GLenum, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, GLdouble, GLdouble, GLint, GLint, const GLdouble *); +GLAPI void APIENTRY glDeformationMap3fSGIX (GLenum, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, GLfloat, GLfloat, GLint, GLint, const GLfloat *); +GLAPI void APIENTRY glDeformSGIX (GLbitfield); +GLAPI void APIENTRY glLoadIdentityDeformationMapSGIX (GLbitfield); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEFORMATIONMAP3DSGIXPROC) (GLenum target, GLdouble u1, GLdouble u2, GLint ustride, GLint uorder, GLdouble v1, GLdouble v2, GLint vstride, GLint vorder, GLdouble w1, GLdouble w2, GLint wstride, GLint worder, const GLdouble *points); +typedef void (APIENTRYP PFNGLDEFORMATIONMAP3FSGIXPROC) (GLenum target, GLfloat u1, GLfloat u2, GLint ustride, GLint uorder, GLfloat v1, GLfloat v2, GLint vstride, GLint vorder, GLfloat w1, GLfloat w2, GLint wstride, GLint worder, const GLfloat *points); +typedef void (APIENTRYP PFNGLDEFORMSGIXPROC) (GLbitfield mask); +typedef void (APIENTRYP PFNGLLOADIDENTITYDEFORMATIONMAPSGIXPROC) (GLbitfield mask); +#endif + +#ifndef GL_SGIX_reference_plane +#define GL_SGIX_reference_plane 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReferencePlaneSGIX (const GLdouble *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLREFERENCEPLANESGIXPROC) (const GLdouble *equation); +#endif + +#ifndef GL_SGIX_flush_raster +#define GL_SGIX_flush_raster 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushRasterSGIX (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFLUSHRASTERSGIXPROC) (void); +#endif + +#ifndef GL_SGIX_depth_texture +#define GL_SGIX_depth_texture 1 +#endif + +#ifndef GL_SGIS_fog_function +#define GL_SGIS_fog_function 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogFuncSGIS (GLsizei, const GLfloat *); +GLAPI void APIENTRY glGetFogFuncSGIS (GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFOGFUNCSGISPROC) (GLsizei n, const GLfloat *points); +typedef void (APIENTRYP PFNGLGETFOGFUNCSGISPROC) (GLfloat *points); +#endif + +#ifndef GL_SGIX_fog_offset +#define GL_SGIX_fog_offset 1 +#endif + +#ifndef GL_HP_image_transform +#define GL_HP_image_transform 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImageTransformParameteriHP (GLenum, GLenum, GLint); +GLAPI void APIENTRY glImageTransformParameterfHP (GLenum, GLenum, GLfloat); +GLAPI void APIENTRY glImageTransformParameterivHP (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glImageTransformParameterfvHP (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glGetImageTransformParameterivHP (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetImageTransformParameterfvHP (GLenum, GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIHPPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFHPPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERIVHPPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETIMAGETRANSFORMPARAMETERFVHPPROC) (GLenum target, GLenum pname, GLfloat *params); +#endif + +#ifndef GL_HP_convolution_border_modes +#define GL_HP_convolution_border_modes 1 +#endif + +#ifndef GL_SGIX_texture_add_env +#define GL_SGIX_texture_add_env 1 +#endif + +#ifndef GL_EXT_color_subtable +#define GL_EXT_color_subtable 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorSubTableEXT (GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glCopyColorSubTableEXT (GLenum, GLsizei, GLint, GLint, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid *data); +typedef void (APIENTRYP PFNGLCOPYCOLORSUBTABLEEXTPROC) (GLenum target, GLsizei start, GLint x, GLint y, GLsizei width); +#endif + +#ifndef GL_PGI_vertex_hints +#define GL_PGI_vertex_hints 1 +#endif + +#ifndef GL_PGI_misc_hints +#define GL_PGI_misc_hints 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glHintPGI (GLenum, GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLHINTPGIPROC) (GLenum target, GLint mode); +#endif + +#ifndef GL_EXT_paletted_texture +#define GL_EXT_paletted_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorTableEXT (GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid *); +GLAPI void APIENTRY glGetColorTableEXT (GLenum, GLenum, GLenum, GLvoid *); +GLAPI void APIENTRY glGetColorTableParameterivEXT (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetColorTableParameterfvEXT (GLenum, GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORTABLEEXTPROC) (GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid *table); +typedef void (APIENTRYP PFNGLGETCOLORTABLEEXTPROC) (GLenum target, GLenum format, GLenum type, GLvoid *data); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETCOLORTABLEPARAMETERFVEXTPROC) (GLenum target, GLenum pname, GLfloat *params); +#endif + +#ifndef GL_EXT_clip_volume_hint +#define GL_EXT_clip_volume_hint 1 +#endif + +#ifndef GL_SGIX_list_priority +#define GL_SGIX_list_priority 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetListParameterfvSGIX (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetListParameterivSGIX (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glListParameterfSGIX (GLuint, GLenum, GLfloat); +GLAPI void APIENTRY glListParameterfvSGIX (GLuint, GLenum, const GLfloat *); +GLAPI void APIENTRY glListParameteriSGIX (GLuint, GLenum, GLint); +GLAPI void APIENTRY glListParameterivSGIX (GLuint, GLenum, const GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGETLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLLISTPARAMETERFSGIXPROC) (GLuint list, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLLISTPARAMETERFVSGIXPROC) (GLuint list, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLLISTPARAMETERISGIXPROC) (GLuint list, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLLISTPARAMETERIVSGIXPROC) (GLuint list, GLenum pname, const GLint *params); +#endif + +#ifndef GL_SGIX_ir_instrument1 +#define GL_SGIX_ir_instrument1 1 +#endif + +#ifndef GL_SGIX_calligraphic_fragment +#define GL_SGIX_calligraphic_fragment 1 +#endif + +#ifndef GL_SGIX_texture_lod_bias +#define GL_SGIX_texture_lod_bias 1 +#endif + +#ifndef GL_SGIX_shadow_ambient +#define GL_SGIX_shadow_ambient 1 +#endif + +#ifndef GL_EXT_index_texture +#define GL_EXT_index_texture 1 +#endif + +#ifndef GL_EXT_index_material +#define GL_EXT_index_material 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIndexMaterialEXT (GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLINDEXMATERIALEXTPROC) (GLenum face, GLenum mode); +#endif + +#ifndef GL_EXT_index_func +#define GL_EXT_index_func 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIndexFuncEXT (GLenum, GLclampf); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLINDEXFUNCEXTPROC) (GLenum func, GLclampf ref); +#endif + +#ifndef GL_EXT_index_array_formats +#define GL_EXT_index_array_formats 1 +#endif + +#ifndef GL_EXT_compiled_vertex_array +#define GL_EXT_compiled_vertex_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glLockArraysEXT (GLint, GLsizei); +GLAPI void APIENTRY glUnlockArraysEXT (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLLOCKARRAYSEXTPROC) (GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLUNLOCKARRAYSEXTPROC) (void); +#endif + +#ifndef GL_EXT_cull_vertex +#define GL_EXT_cull_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCullParameterdvEXT (GLenum, GLdouble *); +GLAPI void APIENTRY glCullParameterfvEXT (GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCULLPARAMETERDVEXTPROC) (GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLCULLPARAMETERFVEXTPROC) (GLenum pname, GLfloat *params); +#endif + +#ifndef GL_SGIX_ycrcb +#define GL_SGIX_ycrcb 1 +#endif + +#ifndef GL_SGIX_fragment_lighting +#define GL_SGIX_fragment_lighting 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFragmentColorMaterialSGIX (GLenum, GLenum); +GLAPI void APIENTRY glFragmentLightfSGIX (GLenum, GLenum, GLfloat); +GLAPI void APIENTRY glFragmentLightfvSGIX (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glFragmentLightiSGIX (GLenum, GLenum, GLint); +GLAPI void APIENTRY glFragmentLightivSGIX (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glFragmentLightModelfSGIX (GLenum, GLfloat); +GLAPI void APIENTRY glFragmentLightModelfvSGIX (GLenum, const GLfloat *); +GLAPI void APIENTRY glFragmentLightModeliSGIX (GLenum, GLint); +GLAPI void APIENTRY glFragmentLightModelivSGIX (GLenum, const GLint *); +GLAPI void APIENTRY glFragmentMaterialfSGIX (GLenum, GLenum, GLfloat); +GLAPI void APIENTRY glFragmentMaterialfvSGIX (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glFragmentMaterialiSGIX (GLenum, GLenum, GLint); +GLAPI void APIENTRY glFragmentMaterialivSGIX (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glGetFragmentLightfvSGIX (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetFragmentLightivSGIX (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetFragmentMaterialfvSGIX (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetFragmentMaterialivSGIX (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glLightEnviSGIX (GLenum, GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFRAGMENTCOLORMATERIALSGIXPROC) (GLenum face, GLenum mode); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFSGIXPROC) (GLenum light, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTISGIXPROC) (GLenum light, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFSGIXPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELFVSGIXPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELISGIXPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTLIGHTMODELIVSGIXPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFSGIXPROC) (GLenum face, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALISGIXPROC) (GLenum face, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTFVSGIXPROC) (GLenum light, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTLIGHTIVSGIXPROC) (GLenum light, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALFVSGIXPROC) (GLenum face, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFRAGMENTMATERIALIVSGIXPROC) (GLenum face, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLLIGHTENVISGIXPROC) (GLenum pname, GLint param); +#endif + +#ifndef GL_IBM_rasterpos_clip +#define GL_IBM_rasterpos_clip 1 +#endif + +#ifndef GL_HP_texture_lighting +#define GL_HP_texture_lighting 1 +#endif + +#ifndef GL_EXT_draw_range_elements +#define GL_EXT_draw_range_elements 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTSEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid *indices); +#endif + +#ifndef GL_WIN_phong_shading +#define GL_WIN_phong_shading 1 +#endif + +#ifndef GL_WIN_specular_fog +#define GL_WIN_specular_fog 1 +#endif + +#ifndef GL_EXT_light_texture +#define GL_EXT_light_texture 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glApplyTextureEXT (GLenum); +GLAPI void APIENTRY glTextureLightEXT (GLenum); +GLAPI void APIENTRY glTextureMaterialEXT (GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLAPPLYTEXTUREEXTPROC) (GLenum mode); +typedef void (APIENTRYP PFNGLTEXTURELIGHTEXTPROC) (GLenum pname); +typedef void (APIENTRYP PFNGLTEXTUREMATERIALEXTPROC) (GLenum face, GLenum mode); +#endif + +#ifndef GL_SGIX_blend_alpha_minmax +#define GL_SGIX_blend_alpha_minmax 1 +#endif + +#ifndef GL_EXT_bgra +#define GL_EXT_bgra 1 +#endif + +#ifndef GL_SGIX_async +#define GL_SGIX_async 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glAsyncMarkerSGIX (GLuint); +GLAPI GLint APIENTRY glFinishAsyncSGIX (GLuint *); +GLAPI GLint APIENTRY glPollAsyncSGIX (GLuint *); +GLAPI GLuint APIENTRY glGenAsyncMarkersSGIX (GLsizei); +GLAPI void APIENTRY glDeleteAsyncMarkersSGIX (GLuint, GLsizei); +GLAPI GLboolean APIENTRY glIsAsyncMarkerSGIX (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLASYNCMARKERSGIXPROC) (GLuint marker); +typedef GLint (APIENTRYP PFNGLFINISHASYNCSGIXPROC) (GLuint *markerp); +typedef GLint (APIENTRYP PFNGLPOLLASYNCSGIXPROC) (GLuint *markerp); +typedef GLuint (APIENTRYP PFNGLGENASYNCMARKERSSGIXPROC) (GLsizei range); +typedef void (APIENTRYP PFNGLDELETEASYNCMARKERSSGIXPROC) (GLuint marker, GLsizei range); +typedef GLboolean (APIENTRYP PFNGLISASYNCMARKERSGIXPROC) (GLuint marker); +#endif + +#ifndef GL_SGIX_async_pixel +#define GL_SGIX_async_pixel 1 +#endif + +#ifndef GL_SGIX_async_histogram +#define GL_SGIX_async_histogram 1 +#endif + +#ifndef GL_INTEL_parallel_arrays +#define GL_INTEL_parallel_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexPointervINTEL (GLint, GLenum, const GLvoid* *); +GLAPI void APIENTRY glNormalPointervINTEL (GLenum, const GLvoid* *); +GLAPI void APIENTRY glColorPointervINTEL (GLint, GLenum, const GLvoid* *); +GLAPI void APIENTRY glTexCoordPointervINTEL (GLint, GLenum, const GLvoid* *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); +typedef void (APIENTRYP PFNGLNORMALPOINTERVINTELPROC) (GLenum type, const GLvoid* *pointer); +typedef void (APIENTRYP PFNGLCOLORPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERVINTELPROC) (GLint size, GLenum type, const GLvoid* *pointer); +#endif + +#ifndef GL_HP_occlusion_test +#define GL_HP_occlusion_test 1 +#endif + +#ifndef GL_EXT_pixel_transform +#define GL_EXT_pixel_transform 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelTransformParameteriEXT (GLenum, GLenum, GLint); +GLAPI void APIENTRY glPixelTransformParameterfEXT (GLenum, GLenum, GLfloat); +GLAPI void APIENTRY glPixelTransformParameterivEXT (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glPixelTransformParameterfvEXT (GLenum, GLenum, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIEXTPROC) (GLenum target, GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFEXTPROC) (GLenum target, GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERIVEXTPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLPIXELTRANSFORMPARAMETERFVEXTPROC) (GLenum target, GLenum pname, const GLfloat *params); +#endif + +#ifndef GL_EXT_pixel_transform_color_table +#define GL_EXT_pixel_transform_color_table 1 +#endif + +#ifndef GL_EXT_shared_texture_palette +#define GL_EXT_shared_texture_palette 1 +#endif + +#ifndef GL_EXT_separate_specular_color +#define GL_EXT_separate_specular_color 1 +#endif + +#ifndef GL_EXT_secondary_color +#define GL_EXT_secondary_color 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSecondaryColor3bEXT (GLbyte, GLbyte, GLbyte); +GLAPI void APIENTRY glSecondaryColor3bvEXT (const GLbyte *); +GLAPI void APIENTRY glSecondaryColor3dEXT (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glSecondaryColor3dvEXT (const GLdouble *); +GLAPI void APIENTRY glSecondaryColor3fEXT (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glSecondaryColor3fvEXT (const GLfloat *); +GLAPI void APIENTRY glSecondaryColor3iEXT (GLint, GLint, GLint); +GLAPI void APIENTRY glSecondaryColor3ivEXT (const GLint *); +GLAPI void APIENTRY glSecondaryColor3sEXT (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glSecondaryColor3svEXT (const GLshort *); +GLAPI void APIENTRY glSecondaryColor3ubEXT (GLubyte, GLubyte, GLubyte); +GLAPI void APIENTRY glSecondaryColor3ubvEXT (const GLubyte *); +GLAPI void APIENTRY glSecondaryColor3uiEXT (GLuint, GLuint, GLuint); +GLAPI void APIENTRY glSecondaryColor3uivEXT (const GLuint *); +GLAPI void APIENTRY glSecondaryColor3usEXT (GLushort, GLushort, GLushort); +GLAPI void APIENTRY glSecondaryColor3usvEXT (const GLushort *); +GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint, GLenum, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BEXTPROC) (GLbyte red, GLbyte green, GLbyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DEXTPROC) (GLdouble red, GLdouble green, GLdouble blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FEXTPROC) (GLfloat red, GLfloat green, GLfloat blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IEXTPROC) (GLint red, GLint green, GLint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SEXTPROC) (GLshort red, GLshort green, GLshort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBEXTPROC) (GLubyte red, GLubyte green, GLubyte blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UBVEXTPROC) (const GLubyte *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIEXTPROC) (GLuint red, GLuint green, GLuint blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3UIVEXTPROC) (const GLuint *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USEXTPROC) (GLushort red, GLushort green, GLushort blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3USVEXTPROC) (const GLushort *v); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTEREXTPROC) (GLint size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_EXT_texture_perturb_normal +#define GL_EXT_texture_perturb_normal 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureNormalEXT (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXTURENORMALEXTPROC) (GLenum mode); +#endif + +#ifndef GL_EXT_multi_draw_arrays +#define GL_EXT_multi_draw_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiDrawArraysEXT (GLenum, GLint *, GLsizei *, GLsizei); +GLAPI void APIENTRY glMultiDrawElementsEXT (GLenum, const GLsizei *, GLenum, const GLvoid* *, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, GLint *first, GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const GLvoid* *indices, GLsizei primcount); +#endif + +#ifndef GL_EXT_fog_coord +#define GL_EXT_fog_coord 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFogCoordfEXT (GLfloat); +GLAPI void APIENTRY glFogCoordfvEXT (const GLfloat *); +GLAPI void APIENTRY glFogCoorddEXT (GLdouble); +GLAPI void APIENTRY glFogCoorddvEXT (const GLdouble *); +GLAPI void APIENTRY glFogCoordPointerEXT (GLenum, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFOGCOORDFEXTPROC) (GLfloat coord); +typedef void (APIENTRYP PFNGLFOGCOORDFVEXTPROC) (const GLfloat *coord); +typedef void (APIENTRYP PFNGLFOGCOORDDEXTPROC) (GLdouble coord); +typedef void (APIENTRYP PFNGLFOGCOORDDVEXTPROC) (const GLdouble *coord); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_REND_screen_coordinates +#define GL_REND_screen_coordinates 1 +#endif + +#ifndef GL_EXT_coordinate_frame +#define GL_EXT_coordinate_frame 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTangent3bEXT (GLbyte, GLbyte, GLbyte); +GLAPI void APIENTRY glTangent3bvEXT (const GLbyte *); +GLAPI void APIENTRY glTangent3dEXT (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glTangent3dvEXT (const GLdouble *); +GLAPI void APIENTRY glTangent3fEXT (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTangent3fvEXT (const GLfloat *); +GLAPI void APIENTRY glTangent3iEXT (GLint, GLint, GLint); +GLAPI void APIENTRY glTangent3ivEXT (const GLint *); +GLAPI void APIENTRY glTangent3sEXT (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glTangent3svEXT (const GLshort *); +GLAPI void APIENTRY glBinormal3bEXT (GLbyte, GLbyte, GLbyte); +GLAPI void APIENTRY glBinormal3bvEXT (const GLbyte *); +GLAPI void APIENTRY glBinormal3dEXT (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glBinormal3dvEXT (const GLdouble *); +GLAPI void APIENTRY glBinormal3fEXT (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glBinormal3fvEXT (const GLfloat *); +GLAPI void APIENTRY glBinormal3iEXT (GLint, GLint, GLint); +GLAPI void APIENTRY glBinormal3ivEXT (const GLint *); +GLAPI void APIENTRY glBinormal3sEXT (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glBinormal3svEXT (const GLshort *); +GLAPI void APIENTRY glTangentPointerEXT (GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glBinormalPointerEXT (GLenum, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTANGENT3BEXTPROC) (GLbyte tx, GLbyte ty, GLbyte tz); +typedef void (APIENTRYP PFNGLTANGENT3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLTANGENT3DEXTPROC) (GLdouble tx, GLdouble ty, GLdouble tz); +typedef void (APIENTRYP PFNGLTANGENT3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLTANGENT3FEXTPROC) (GLfloat tx, GLfloat ty, GLfloat tz); +typedef void (APIENTRYP PFNGLTANGENT3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLTANGENT3IEXTPROC) (GLint tx, GLint ty, GLint tz); +typedef void (APIENTRYP PFNGLTANGENT3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLTANGENT3SEXTPROC) (GLshort tx, GLshort ty, GLshort tz); +typedef void (APIENTRYP PFNGLTANGENT3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLBINORMAL3BEXTPROC) (GLbyte bx, GLbyte by, GLbyte bz); +typedef void (APIENTRYP PFNGLBINORMAL3BVEXTPROC) (const GLbyte *v); +typedef void (APIENTRYP PFNGLBINORMAL3DEXTPROC) (GLdouble bx, GLdouble by, GLdouble bz); +typedef void (APIENTRYP PFNGLBINORMAL3DVEXTPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLBINORMAL3FEXTPROC) (GLfloat bx, GLfloat by, GLfloat bz); +typedef void (APIENTRYP PFNGLBINORMAL3FVEXTPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLBINORMAL3IEXTPROC) (GLint bx, GLint by, GLint bz); +typedef void (APIENTRYP PFNGLBINORMAL3IVEXTPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLBINORMAL3SEXTPROC) (GLshort bx, GLshort by, GLshort bz); +typedef void (APIENTRYP PFNGLBINORMAL3SVEXTPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLTANGENTPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLBINORMALPOINTEREXTPROC) (GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_EXT_texture_env_combine +#define GL_EXT_texture_env_combine 1 +#endif + +#ifndef GL_APPLE_specular_vector +#define GL_APPLE_specular_vector 1 +#endif + +#ifndef GL_APPLE_transform_hint +#define GL_APPLE_transform_hint 1 +#endif + +#ifndef GL_SGIX_fog_scale +#define GL_SGIX_fog_scale 1 +#endif + +#ifndef GL_SUNX_constant_data +#define GL_SUNX_constant_data 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFinishTextureSUNX (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFINISHTEXTURESUNXPROC) (void); +#endif + +#ifndef GL_SUN_global_alpha +#define GL_SUN_global_alpha 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGlobalAlphaFactorbSUN (GLbyte); +GLAPI void APIENTRY glGlobalAlphaFactorsSUN (GLshort); +GLAPI void APIENTRY glGlobalAlphaFactoriSUN (GLint); +GLAPI void APIENTRY glGlobalAlphaFactorfSUN (GLfloat); +GLAPI void APIENTRY glGlobalAlphaFactordSUN (GLdouble); +GLAPI void APIENTRY glGlobalAlphaFactorubSUN (GLubyte); +GLAPI void APIENTRY glGlobalAlphaFactorusSUN (GLushort); +GLAPI void APIENTRY glGlobalAlphaFactoruiSUN (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORBSUNPROC) (GLbyte factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORSSUNPROC) (GLshort factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORISUNPROC) (GLint factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORFSUNPROC) (GLfloat factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORDSUNPROC) (GLdouble factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUBSUNPROC) (GLubyte factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUSSUNPROC) (GLushort factor); +typedef void (APIENTRYP PFNGLGLOBALALPHAFACTORUISUNPROC) (GLuint factor); +#endif + +#ifndef GL_SUN_triangle_list +#define GL_SUN_triangle_list 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glReplacementCodeuiSUN (GLuint); +GLAPI void APIENTRY glReplacementCodeusSUN (GLushort); +GLAPI void APIENTRY glReplacementCodeubSUN (GLubyte); +GLAPI void APIENTRY glReplacementCodeuivSUN (const GLuint *); +GLAPI void APIENTRY glReplacementCodeusvSUN (const GLushort *); +GLAPI void APIENTRY glReplacementCodeubvSUN (const GLubyte *); +GLAPI void APIENTRY glReplacementCodePointerSUN (GLenum, GLsizei, const GLvoid* *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUISUNPROC) (GLuint code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSSUNPROC) (GLushort code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBSUNPROC) (GLubyte code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVSUNPROC) (const GLuint *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUSVSUNPROC) (const GLushort *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUBVSUNPROC) (const GLubyte *code); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEPOINTERSUNPROC) (GLenum type, GLsizei stride, const GLvoid* *pointer); +#endif + +#ifndef GL_SUN_vertex +#define GL_SUN_vertex 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColor4ubVertex2fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat); +GLAPI void APIENTRY glColor4ubVertex2fvSUN (const GLubyte *, const GLfloat *); +GLAPI void APIENTRY glColor4ubVertex3fSUN (GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glColor4ubVertex3fvSUN (const GLubyte *, const GLfloat *); +GLAPI void APIENTRY glColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glColor3fVertex3fvSUN (const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glTexCoord2fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord2fVertex3fvSUN (const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glTexCoord4fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord4fVertex4fvSUN (const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fSUN (GLfloat, GLfloat, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord2fColor4ubVertex3fvSUN (const GLfloat *, const GLubyte *, const GLfloat *); +GLAPI void APIENTRY glTexCoord2fColor3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord2fColor3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord2fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord2fColor4fNormal3fVertex3fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fSUN (GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glTexCoord4fColor4fNormal3fVertex4fvSUN (const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiVertex3fvSUN (const GLuint *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fSUN (GLuint, GLubyte, GLubyte, GLubyte, GLubyte, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiColor4ubVertex3fvSUN (const GLuint *, const GLubyte *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiColor3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fSUN (GLuint, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glReplacementCodeuiTexCoord2fColor4fNormal3fVertex3fvSUN (const GLuint *, const GLfloat *, const GLfloat *, const GLfloat *, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX2FVSUNPROC) (const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FSUNPROC) (GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR4UBVERTEX3FVSUNPROC) (const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FSUNPROC) (GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLTEXCOORD4FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4UBVERTEX3FVSUNPROC) (const GLfloat *tc, const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLTEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FSUNPROC) (GLfloat s, GLfloat t, GLfloat p, GLfloat q, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLTEXCOORD4FCOLOR4FNORMAL3FVERTEX4FVSUNPROC) (const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FSUNPROC) (GLuint rc, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUIVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FSUNPROC) (GLuint rc, GLubyte r, GLubyte g, GLubyte b, GLubyte a, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4UBVERTEX3FVSUNPROC) (const GLuint *rc, const GLubyte *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUINORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUICOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *n, const GLfloat *v); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FSUNPROC) (GLuint rc, GLfloat s, GLfloat t, GLfloat r, GLfloat g, GLfloat b, GLfloat a, GLfloat nx, GLfloat ny, GLfloat nz, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLREPLACEMENTCODEUITEXCOORD2FCOLOR4FNORMAL3FVERTEX3FVSUNPROC) (const GLuint *rc, const GLfloat *tc, const GLfloat *c, const GLfloat *n, const GLfloat *v); +#endif + +#ifndef GL_EXT_blend_func_separate +#define GL_EXT_blend_func_separate 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparateEXT (GLenum, GLenum, GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEEXTPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif + +#ifndef GL_INGR_blend_func_separate +#define GL_INGR_blend_func_separate 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum, GLenum, GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEINGRPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); +#endif + +#ifndef GL_INGR_color_clamp +#define GL_INGR_color_clamp 1 +#endif + +#ifndef GL_INGR_interlace_read +#define GL_INGR_interlace_read 1 +#endif + +#ifndef GL_EXT_stencil_wrap +#define GL_EXT_stencil_wrap 1 +#endif + +#ifndef GL_EXT_422_pixels +#define GL_EXT_422_pixels 1 +#endif + +#ifndef GL_NV_texgen_reflection +#define GL_NV_texgen_reflection 1 +#endif + +#ifndef GL_SUN_convolution_border_modes +#define GL_SUN_convolution_border_modes 1 +#endif + +#ifndef GL_EXT_texture_env_add +#define GL_EXT_texture_env_add 1 +#endif + +#ifndef GL_EXT_texture_lod_bias +#define GL_EXT_texture_lod_bias 1 +#endif + +#ifndef GL_EXT_texture_filter_anisotropic +#define GL_EXT_texture_filter_anisotropic 1 +#endif + +#ifndef GL_EXT_vertex_weighting +#define GL_EXT_vertex_weighting 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexWeightfEXT (GLfloat); +GLAPI void APIENTRY glVertexWeightfvEXT (const GLfloat *); +GLAPI void APIENTRY glVertexWeightPointerEXT (GLsizei, GLenum, GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXWEIGHTFEXTPROC) (GLfloat weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTFVEXTPROC) (const GLfloat *weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTPOINTEREXTPROC) (GLsizei size, GLenum type, GLsizei stride, const GLvoid *pointer); +#endif + +#ifndef GL_NV_light_max_exponent +#define GL_NV_light_max_exponent 1 +#endif + +#ifndef GL_NV_vertex_array_range +#define GL_NV_vertex_array_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFlushVertexArrayRangeNV (void); +GLAPI void APIENTRY glVertexArrayRangeNV (GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGENVPROC) (void); +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGENVPROC) (GLsizei length, const GLvoid *pointer); +#endif + +#ifndef GL_NV_register_combiners +#define GL_NV_register_combiners 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCombinerParameterfvNV (GLenum, const GLfloat *); +GLAPI void APIENTRY glCombinerParameterfNV (GLenum, GLfloat); +GLAPI void APIENTRY glCombinerParameterivNV (GLenum, const GLint *); +GLAPI void APIENTRY glCombinerParameteriNV (GLenum, GLint); +GLAPI void APIENTRY glCombinerInputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glCombinerOutputNV (GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean); +GLAPI void APIENTRY glFinalCombinerInputNV (GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glGetCombinerInputParameterfvNV (GLenum, GLenum, GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetCombinerInputParameterivNV (GLenum, GLenum, GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetCombinerOutputParameterfvNV (GLenum, GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetCombinerOutputParameterivNV (GLenum, GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetFinalCombinerInputParameterfvNV (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetFinalCombinerInputParameterivNV (GLenum, GLenum, GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFVNVPROC) (GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERFNVPROC) (GLenum pname, GLfloat param); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERIVNVPROC) (GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLCOMBINERPARAMETERINVPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLCOMBINERINPUTNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +typedef void (APIENTRYP PFNGLCOMBINEROUTPUTNVPROC) (GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum); +typedef void (APIENTRYP PFNGLFINALCOMBINERINPUTNVPROC) (GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage); +typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC) (GLenum stage, GLenum portion, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC) (GLenum variable, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC) (GLenum variable, GLenum pname, GLint *params); +#endif + +#ifndef GL_NV_fog_distance +#define GL_NV_fog_distance 1 +#endif + +#ifndef GL_NV_texgen_emboss +#define GL_NV_texgen_emboss 1 +#endif + +#ifndef GL_NV_blend_square +#define GL_NV_blend_square 1 +#endif + +#ifndef GL_NV_texture_env_combine4 +#define GL_NV_texture_env_combine4 1 +#endif + +#ifndef GL_MESA_resize_buffers +#define GL_MESA_resize_buffers 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glResizeBuffersMESA (void); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); +#endif + +#ifndef GL_MESA_window_pos +#define GL_MESA_window_pos 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glWindowPos2dMESA (GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos2dvMESA (const GLdouble *); +GLAPI void APIENTRY glWindowPos2fMESA (GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos2fvMESA (const GLfloat *); +GLAPI void APIENTRY glWindowPos2iMESA (GLint, GLint); +GLAPI void APIENTRY glWindowPos2ivMESA (const GLint *); +GLAPI void APIENTRY glWindowPos2sMESA (GLshort, GLshort); +GLAPI void APIENTRY glWindowPos2svMESA (const GLshort *); +GLAPI void APIENTRY glWindowPos3dMESA (GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos3dvMESA (const GLdouble *); +GLAPI void APIENTRY glWindowPos3fMESA (GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos3fvMESA (const GLfloat *); +GLAPI void APIENTRY glWindowPos3iMESA (GLint, GLint, GLint); +GLAPI void APIENTRY glWindowPos3ivMESA (const GLint *); +GLAPI void APIENTRY glWindowPos3sMESA (GLshort, GLshort, GLshort); +GLAPI void APIENTRY glWindowPos3svMESA (const GLshort *); +GLAPI void APIENTRY glWindowPos4dMESA (GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glWindowPos4dvMESA (const GLdouble *); +GLAPI void APIENTRY glWindowPos4fMESA (GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glWindowPos4fvMESA (const GLfloat *); +GLAPI void APIENTRY glWindowPos4iMESA (GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glWindowPos4ivMESA (const GLint *); +GLAPI void APIENTRY glWindowPos4sMESA (GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glWindowPos4svMESA (const GLshort *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLWINDOWPOS2DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2FMESAPROC) (GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLWINDOWPOS2FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2IMESAPROC) (GLint x, GLint y); +typedef void (APIENTRYP PFNGLWINDOWPOS2IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS2SMESAPROC) (GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLWINDOWPOS2SVMESAPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3DMESAPROC) (GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLWINDOWPOS3DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3FMESAPROC) (GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLWINDOWPOS3FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3IMESAPROC) (GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLWINDOWPOS3IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS3SMESAPROC) (GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLWINDOWPOS3SVMESAPROC) (const GLshort *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4DMESAPROC) (GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLWINDOWPOS4DVMESAPROC) (const GLdouble *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4FMESAPROC) (GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLWINDOWPOS4FVMESAPROC) (const GLfloat *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4IMESAPROC) (GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLWINDOWPOS4IVMESAPROC) (const GLint *v); +typedef void (APIENTRYP PFNGLWINDOWPOS4SMESAPROC) (GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLWINDOWPOS4SVMESAPROC) (const GLshort *v); +#endif + +#ifndef GL_IBM_cull_vertex +#define GL_IBM_cull_vertex 1 +#endif + +#ifndef GL_IBM_multimode_draw_arrays +#define GL_IBM_multimode_draw_arrays 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMultiModeDrawArraysIBM (const GLenum *, const GLint *, const GLsizei *, GLsizei, GLint); +GLAPI void APIENTRY glMultiModeDrawElementsIBM (const GLenum *, const GLsizei *, GLenum, const GLvoid* const *, GLsizei, GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMULTIMODEDRAWARRAYSIBMPROC) (const GLenum *mode, const GLint *first, const GLsizei *count, GLsizei primcount, GLint modestride); +typedef void (APIENTRYP PFNGLMULTIMODEDRAWELEMENTSIBMPROC) (const GLenum *mode, const GLsizei *count, GLenum type, const GLvoid* const *indices, GLsizei primcount, GLint modestride); +#endif + +#ifndef GL_IBM_vertex_array_lists +#define GL_IBM_vertex_array_lists 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); +GLAPI void APIENTRY glSecondaryColorPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); +GLAPI void APIENTRY glEdgeFlagPointerListIBM (GLint, const GLboolean* *, GLint); +GLAPI void APIENTRY glFogCoordPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); +GLAPI void APIENTRY glIndexPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); +GLAPI void APIENTRY glNormalPointerListIBM (GLenum, GLint, const GLvoid* *, GLint); +GLAPI void APIENTRY glTexCoordPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); +GLAPI void APIENTRY glVertexPointerListIBM (GLint, GLenum, GLint, const GLvoid* *, GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLSECONDARYCOLORPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLEDGEFLAGPOINTERLISTIBMPROC) (GLint stride, const GLboolean* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLFOGCOORDPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLINDEXPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLNORMALPOINTERLISTIBMPROC) (GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLTEXCOORDPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +typedef void (APIENTRYP PFNGLVERTEXPOINTERLISTIBMPROC) (GLint size, GLenum type, GLint stride, const GLvoid* *pointer, GLint ptrstride); +#endif + +#ifndef GL_SGIX_subsample +#define GL_SGIX_subsample 1 +#endif + +#ifndef GL_SGIX_ycrcba +#define GL_SGIX_ycrcba 1 +#endif + +#ifndef GL_SGIX_ycrcb_subsample +#define GL_SGIX_ycrcb_subsample 1 +#endif + +#ifndef GL_SGIX_depth_pass_instrument +#define GL_SGIX_depth_pass_instrument 1 +#endif + +#ifndef GL_3DFX_texture_compression_FXT1 +#define GL_3DFX_texture_compression_FXT1 1 +#endif + +#ifndef GL_3DFX_multisample +#define GL_3DFX_multisample 1 +#endif + +#ifndef GL_3DFX_tbuffer +#define GL_3DFX_tbuffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTbufferMask3DFX (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTBUFFERMASK3DFXPROC) (GLuint mask); +#endif + +#ifndef GL_EXT_multisample +#define GL_EXT_multisample 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSampleMaskEXT (GLclampf, GLboolean); +GLAPI void APIENTRY glSamplePatternEXT (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSAMPLEMASKEXTPROC) (GLclampf value, GLboolean invert); +typedef void (APIENTRYP PFNGLSAMPLEPATTERNEXTPROC) (GLenum pattern); +#endif + +#ifndef GL_SGIX_vertex_preclip +#define GL_SGIX_vertex_preclip 1 +#endif + +#ifndef GL_SGIX_convolution_accuracy +#define GL_SGIX_convolution_accuracy 1 +#endif + +#ifndef GL_SGIX_resample +#define GL_SGIX_resample 1 +#endif + +#ifndef GL_SGIS_point_line_texgen +#define GL_SGIS_point_line_texgen 1 +#endif + +#ifndef GL_SGIS_texture_color_mask +#define GL_SGIS_texture_color_mask 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTextureColorMaskSGIS (GLboolean, GLboolean, GLboolean, GLboolean); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXTURECOLORMASKSGISPROC) (GLboolean red, GLboolean green, GLboolean blue, GLboolean alpha); +#endif + +#ifndef GL_SGIX_igloo_interface +#define GL_SGIX_igloo_interface 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glIglooInterfaceSGIX (GLenum, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLIGLOOINTERFACESGIXPROC) (GLenum pname, const GLvoid *params); +#endif + +#ifndef GL_EXT_texture_env_dot3 +#define GL_EXT_texture_env_dot3 1 +#endif + +#ifndef GL_ATI_texture_mirror_once +#define GL_ATI_texture_mirror_once 1 +#endif + +#ifndef GL_NV_fence +#define GL_NV_fence 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDeleteFencesNV (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenFencesNV (GLsizei, GLuint *); +GLAPI GLboolean APIENTRY glIsFenceNV (GLuint); +GLAPI GLboolean APIENTRY glTestFenceNV (GLuint); +GLAPI void APIENTRY glGetFenceivNV (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glFinishFenceNV (GLuint); +GLAPI void APIENTRY glSetFenceNV (GLuint, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDELETEFENCESNVPROC) (GLsizei n, const GLuint *fences); +typedef void (APIENTRYP PFNGLGENFENCESNVPROC) (GLsizei n, GLuint *fences); +typedef GLboolean (APIENTRYP PFNGLISFENCENVPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTFENCENVPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLGETFENCEIVNVPROC) (GLuint fence, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLFINISHFENCENVPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLSETFENCENVPROC) (GLuint fence, GLenum condition); +#endif + +#ifndef GL_NV_evaluators +#define GL_NV_evaluators 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLint, GLint, GLboolean, const GLvoid *); +GLAPI void APIENTRY glMapParameterivNV (GLenum, GLenum, const GLint *); +GLAPI void APIENTRY glMapParameterfvNV (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glGetMapControlPointsNV (GLenum, GLuint, GLenum, GLsizei, GLsizei, GLboolean, GLvoid *); +GLAPI void APIENTRY glGetMapParameterivNV (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGetMapParameterfvNV (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetMapAttribParameterivNV (GLenum, GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetMapAttribParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glEvalMapsNV (GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLint uorder, GLint vorder, GLboolean packed, const GLvoid *points); +typedef void (APIENTRYP PFNGLMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETMAPCONTROLPOINTSNVPROC) (GLenum target, GLuint index, GLenum type, GLsizei ustride, GLsizei vstride, GLboolean packed, GLvoid *points); +typedef void (APIENTRYP PFNGLGETMAPPARAMETERIVNVPROC) (GLenum target, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMAPPARAMETERFVNVPROC) (GLenum target, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERIVNVPROC) (GLenum target, GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETMAPATTRIBPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLEVALMAPSNVPROC) (GLenum target, GLenum mode); +#endif + +#ifndef GL_NV_packed_depth_stencil +#define GL_NV_packed_depth_stencil 1 +#endif + +#ifndef GL_NV_register_combiners2 +#define GL_NV_register_combiners2 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glCombinerStageParameterfvNV (GLenum, GLenum, const GLfloat *); +GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum, GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, const GLfloat *params); +typedef void (APIENTRYP PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC) (GLenum stage, GLenum pname, GLfloat *params); +#endif + +#ifndef GL_NV_texture_compression_vtc +#define GL_NV_texture_compression_vtc 1 +#endif + +#ifndef GL_NV_texture_rectangle +#define GL_NV_texture_rectangle 1 +#endif + +#ifndef GL_NV_texture_shader +#define GL_NV_texture_shader 1 +#endif + +#ifndef GL_NV_texture_shader2 +#define GL_NV_texture_shader2 1 +#endif + +#ifndef GL_NV_vertex_array_range2 +#define GL_NV_vertex_array_range2 1 +#endif + +#ifndef GL_NV_vertex_program +#define GL_NV_vertex_program 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAreProgramsResidentNV (GLsizei, const GLuint *, GLboolean *); +GLAPI void APIENTRY glBindProgramNV (GLenum, GLuint); +GLAPI void APIENTRY glDeleteProgramsNV (GLsizei, const GLuint *); +GLAPI void APIENTRY glExecuteProgramNV (GLenum, GLuint, const GLfloat *); +GLAPI void APIENTRY glGenProgramsNV (GLsizei, GLuint *); +GLAPI void APIENTRY glGetProgramParameterdvNV (GLenum, GLuint, GLenum, GLdouble *); +GLAPI void APIENTRY glGetProgramParameterfvNV (GLenum, GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetProgramivNV (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetProgramStringNV (GLuint, GLenum, GLubyte *); +GLAPI void APIENTRY glGetTrackMatrixivNV (GLenum, GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetVertexAttribdvNV (GLuint, GLenum, GLdouble *); +GLAPI void APIENTRY glGetVertexAttribfvNV (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetVertexAttribivNV (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetVertexAttribPointervNV (GLuint, GLenum, GLvoid* *); +GLAPI GLboolean APIENTRY glIsProgramNV (GLuint); +GLAPI void APIENTRY glLoadProgramNV (GLenum, GLuint, GLsizei, const GLubyte *); +GLAPI void APIENTRY glProgramParameter4dNV (GLenum, GLuint, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glProgramParameter4dvNV (GLenum, GLuint, const GLdouble *); +GLAPI void APIENTRY glProgramParameter4fNV (GLenum, GLuint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glProgramParameter4fvNV (GLenum, GLuint, const GLfloat *); +GLAPI void APIENTRY glProgramParameters4dvNV (GLenum, GLuint, GLuint, const GLdouble *); +GLAPI void APIENTRY glProgramParameters4fvNV (GLenum, GLuint, GLuint, const GLfloat *); +GLAPI void APIENTRY glRequestResidentProgramsNV (GLsizei, const GLuint *); +GLAPI void APIENTRY glTrackMatrixNV (GLenum, GLuint, GLenum, GLenum); +GLAPI void APIENTRY glVertexAttribPointerNV (GLuint, GLint, GLenum, GLsizei, const GLvoid *); +GLAPI void APIENTRY glVertexAttrib1dNV (GLuint, GLdouble); +GLAPI void APIENTRY glVertexAttrib1dvNV (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib1fNV (GLuint, GLfloat); +GLAPI void APIENTRY glVertexAttrib1fvNV (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib1sNV (GLuint, GLshort); +GLAPI void APIENTRY glVertexAttrib1svNV (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib2dNV (GLuint, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib2dvNV (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib2fNV (GLuint, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib2fvNV (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib2sNV (GLuint, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib2svNV (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib3dNV (GLuint, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib3dvNV (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib3fNV (GLuint, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib3fvNV (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib3sNV (GLuint, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib3svNV (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4dNV (GLuint, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexAttrib4dvNV (GLuint, const GLdouble *); +GLAPI void APIENTRY glVertexAttrib4fNV (GLuint, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexAttrib4fvNV (GLuint, const GLfloat *); +GLAPI void APIENTRY glVertexAttrib4sNV (GLuint, GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexAttrib4svNV (GLuint, const GLshort *); +GLAPI void APIENTRY glVertexAttrib4ubNV (GLuint, GLubyte, GLubyte, GLubyte, GLubyte); +GLAPI void APIENTRY glVertexAttrib4ubvNV (GLuint, const GLubyte *); +GLAPI void APIENTRY glVertexAttribs1dvNV (GLuint, GLsizei, const GLdouble *); +GLAPI void APIENTRY glVertexAttribs1fvNV (GLuint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glVertexAttribs1svNV (GLuint, GLsizei, const GLshort *); +GLAPI void APIENTRY glVertexAttribs2dvNV (GLuint, GLsizei, const GLdouble *); +GLAPI void APIENTRY glVertexAttribs2fvNV (GLuint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glVertexAttribs2svNV (GLuint, GLsizei, const GLshort *); +GLAPI void APIENTRY glVertexAttribs3dvNV (GLuint, GLsizei, const GLdouble *); +GLAPI void APIENTRY glVertexAttribs3fvNV (GLuint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glVertexAttribs3svNV (GLuint, GLsizei, const GLshort *); +GLAPI void APIENTRY glVertexAttribs4dvNV (GLuint, GLsizei, const GLdouble *); +GLAPI void APIENTRY glVertexAttribs4fvNV (GLuint, GLsizei, const GLfloat *); +GLAPI void APIENTRY glVertexAttribs4svNV (GLuint, GLsizei, const GLshort *); +GLAPI void APIENTRY glVertexAttribs4ubvNV (GLuint, GLsizei, const GLubyte *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLAREPROGRAMSRESIDENTNVPROC) (GLsizei n, const GLuint *programs, GLboolean *residences); +typedef void (APIENTRYP PFNGLBINDPROGRAMNVPROC) (GLenum target, GLuint id); +typedef void (APIENTRYP PFNGLDELETEPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLEXECUTEPROGRAMNVPROC) (GLenum target, GLuint id, const GLfloat *params); +typedef void (APIENTRYP PFNGLGENPROGRAMSNVPROC) (GLsizei n, GLuint *programs); +typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERDVNVPROC) (GLenum target, GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETPROGRAMPARAMETERFVNVPROC) (GLenum target, GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMIVNVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETPROGRAMSTRINGNVPROC) (GLuint id, GLenum pname, GLubyte *program); +typedef void (APIENTRYP PFNGLGETTRACKMATRIXIVNVPROC) (GLenum target, GLuint address, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBDVNVPROC) (GLuint index, GLenum pname, GLdouble *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBFVNVPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBIVNVPROC) (GLuint index, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBPOINTERVNVPROC) (GLuint index, GLenum pname, GLvoid* *pointer); +typedef GLboolean (APIENTRYP PFNGLISPROGRAMNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLLOADPROGRAMNVPROC) (GLenum target, GLuint id, GLsizei len, const GLubyte *program); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DNVPROC) (GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4DVNVPROC) (GLenum target, GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FNVPROC) (GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETER4FVNVPROC) (GLenum target, GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4DVNVPROC) (GLenum target, GLuint index, GLuint count, const GLdouble *v); +typedef void (APIENTRYP PFNGLPROGRAMPARAMETERS4FVNVPROC) (GLenum target, GLuint index, GLuint count, const GLfloat *v); +typedef void (APIENTRYP PFNGLREQUESTRESIDENTPROGRAMSNVPROC) (GLsizei n, const GLuint *programs); +typedef void (APIENTRYP PFNGLTRACKMATRIXNVPROC) (GLenum target, GLuint address, GLenum matrix, GLenum transform); +typedef void (APIENTRYP PFNGLVERTEXATTRIBPOINTERNVPROC) (GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DNVPROC) (GLuint index, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FNVPROC) (GLuint index, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SNVPROC) (GLuint index, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DNVPROC) (GLuint index, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FNVPROC) (GLuint index, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SNVPROC) (GLuint index, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DNVPROC) (GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4DVNVPROC) (GLuint index, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FNVPROC) (GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4FVNVPROC) (GLuint index, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SNVPROC) (GLuint index, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4SVNVPROC) (GLuint index, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBNVPROC) (GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4UBVNVPROC) (GLuint index, const GLubyte *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4DVNVPROC) (GLuint index, GLsizei count, const GLdouble *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4FVNVPROC) (GLuint index, GLsizei count, const GLfloat *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4SVNVPROC) (GLuint index, GLsizei count, const GLshort *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4UBVNVPROC) (GLuint index, GLsizei count, const GLubyte *v); +#endif + +#ifndef GL_SGIX_texture_coordinate_clamp +#define GL_SGIX_texture_coordinate_clamp 1 +#endif + +#ifndef GL_SGIX_scalebias_hint +#define GL_SGIX_scalebias_hint 1 +#endif + +#ifndef GL_OML_interlace +#define GL_OML_interlace 1 +#endif + +#ifndef GL_OML_subsample +#define GL_OML_subsample 1 +#endif + +#ifndef GL_OML_resample +#define GL_OML_resample 1 +#endif + +#ifndef GL_NV_copy_depth_to_color +#define GL_NV_copy_depth_to_color 1 +#endif + +#ifndef GL_ATI_envmap_bumpmap +#define GL_ATI_envmap_bumpmap 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glTexBumpParameterivATI (GLenum, const GLint *); +GLAPI void APIENTRY glTexBumpParameterfvATI (GLenum, const GLfloat *); +GLAPI void APIENTRY glGetTexBumpParameterivATI (GLenum, GLint *); +GLAPI void APIENTRY glGetTexBumpParameterfvATI (GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERIVATIPROC) (GLenum pname, const GLint *param); +typedef void (APIENTRYP PFNGLTEXBUMPPARAMETERFVATIPROC) (GLenum pname, const GLfloat *param); +typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERIVATIPROC) (GLenum pname, GLint *param); +typedef void (APIENTRYP PFNGLGETTEXBUMPPARAMETERFVATIPROC) (GLenum pname, GLfloat *param); +#endif + +#ifndef GL_ATI_fragment_shader +#define GL_ATI_fragment_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glGenFragmentShadersATI (GLuint); +GLAPI void APIENTRY glBindFragmentShaderATI (GLuint); +GLAPI void APIENTRY glDeleteFragmentShaderATI (GLuint); +GLAPI void APIENTRY glBeginFragmentShaderATI (void); +GLAPI void APIENTRY glEndFragmentShaderATI (void); +GLAPI void APIENTRY glPassTexCoordATI (GLuint, GLuint, GLenum); +GLAPI void APIENTRY glSampleMapATI (GLuint, GLuint, GLenum); +GLAPI void APIENTRY glColorFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glColorFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glColorFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glAlphaFragmentOp1ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glAlphaFragmentOp2ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glAlphaFragmentOp3ATI (GLenum, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glSetFragmentShaderConstantATI (GLuint, const GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLuint (APIENTRYP PFNGLGENFRAGMENTSHADERSATIPROC) (GLuint range); +typedef void (APIENTRYP PFNGLBINDFRAGMENTSHADERATIPROC) (GLuint id); +typedef void (APIENTRYP PFNGLDELETEFRAGMENTSHADERATIPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINFRAGMENTSHADERATIPROC) (void); +typedef void (APIENTRYP PFNGLENDFRAGMENTSHADERATIPROC) (void); +typedef void (APIENTRYP PFNGLPASSTEXCOORDATIPROC) (GLuint dst, GLuint coord, GLenum swizzle); +typedef void (APIENTRYP PFNGLSAMPLEMAPATIPROC) (GLuint dst, GLuint interp, GLenum swizzle); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +typedef void (APIENTRYP PFNGLCOLORFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMask, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP1ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP2ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod); +typedef void (APIENTRYP PFNGLALPHAFRAGMENTOP3ATIPROC) (GLenum op, GLuint dst, GLuint dstMod, GLuint arg1, GLuint arg1Rep, GLuint arg1Mod, GLuint arg2, GLuint arg2Rep, GLuint arg2Mod, GLuint arg3, GLuint arg3Rep, GLuint arg3Mod); +typedef void (APIENTRYP PFNGLSETFRAGMENTSHADERCONSTANTATIPROC) (GLuint dst, const GLfloat *value); +#endif + +#ifndef GL_ATI_pn_triangles +#define GL_ATI_pn_triangles 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPNTrianglesiATI (GLenum, GLint); +GLAPI void APIENTRY glPNTrianglesfATI (GLenum, GLfloat); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPNTRIANGLESIATIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPNTRIANGLESFATIPROC) (GLenum pname, GLfloat param); +#endif + +#ifndef GL_ATI_vertex_array_object +#define GL_ATI_vertex_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLuint APIENTRY glNewObjectBufferATI (GLsizei, const GLvoid *, GLenum); +GLAPI GLboolean APIENTRY glIsObjectBufferATI (GLuint); +GLAPI void APIENTRY glUpdateObjectBufferATI (GLuint, GLuint, GLsizei, const GLvoid *, GLenum); +GLAPI void APIENTRY glGetObjectBufferfvATI (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetObjectBufferivATI (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glFreeObjectBufferATI (GLuint); +GLAPI void APIENTRY glArrayObjectATI (GLenum, GLint, GLenum, GLsizei, GLuint, GLuint); +GLAPI void APIENTRY glGetArrayObjectfvATI (GLenum, GLenum, GLfloat *); +GLAPI void APIENTRY glGetArrayObjectivATI (GLenum, GLenum, GLint *); +GLAPI void APIENTRY glVariantArrayObjectATI (GLuint, GLenum, GLsizei, GLuint, GLuint); +GLAPI void APIENTRY glGetVariantArrayObjectfvATI (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetVariantArrayObjectivATI (GLuint, GLenum, GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLuint (APIENTRYP PFNGLNEWOBJECTBUFFERATIPROC) (GLsizei size, const GLvoid *pointer, GLenum usage); +typedef GLboolean (APIENTRYP PFNGLISOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLUPDATEOBJECTBUFFERATIPROC) (GLuint buffer, GLuint offset, GLsizei size, const GLvoid *pointer, GLenum preserve); +typedef void (APIENTRYP PFNGLGETOBJECTBUFFERFVATIPROC) (GLuint buffer, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETOBJECTBUFFERIVATIPROC) (GLuint buffer, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLFREEOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLARRAYOBJECTATIPROC) (GLenum array, GLint size, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETARRAYOBJECTFVATIPROC) (GLenum array, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETARRAYOBJECTIVATIPROC) (GLenum array, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLVARIANTARRAYOBJECTATIPROC) (GLuint id, GLenum type, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTFVATIPROC) (GLuint id, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVARIANTARRAYOBJECTIVATIPROC) (GLuint id, GLenum pname, GLint *params); +#endif + +#ifndef GL_EXT_vertex_shader +#define GL_EXT_vertex_shader 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBeginVertexShaderEXT (void); +GLAPI void APIENTRY glEndVertexShaderEXT (void); +GLAPI void APIENTRY glBindVertexShaderEXT (GLuint); +GLAPI GLuint APIENTRY glGenVertexShadersEXT (GLuint); +GLAPI void APIENTRY glDeleteVertexShaderEXT (GLuint); +GLAPI void APIENTRY glShaderOp1EXT (GLenum, GLuint, GLuint); +GLAPI void APIENTRY glShaderOp2EXT (GLenum, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glShaderOp3EXT (GLenum, GLuint, GLuint, GLuint, GLuint); +GLAPI void APIENTRY glSwizzleEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glWriteMaskEXT (GLuint, GLuint, GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glInsertComponentEXT (GLuint, GLuint, GLuint); +GLAPI void APIENTRY glExtractComponentEXT (GLuint, GLuint, GLuint); +GLAPI GLuint APIENTRY glGenSymbolsEXT (GLenum, GLenum, GLenum, GLuint); +GLAPI void APIENTRY glSetInvariantEXT (GLuint, GLenum, const GLvoid *); +GLAPI void APIENTRY glSetLocalConstantEXT (GLuint, GLenum, const GLvoid *); +GLAPI void APIENTRY glVariantbvEXT (GLuint, const GLbyte *); +GLAPI void APIENTRY glVariantsvEXT (GLuint, const GLshort *); +GLAPI void APIENTRY glVariantivEXT (GLuint, const GLint *); +GLAPI void APIENTRY glVariantfvEXT (GLuint, const GLfloat *); +GLAPI void APIENTRY glVariantdvEXT (GLuint, const GLdouble *); +GLAPI void APIENTRY glVariantubvEXT (GLuint, const GLubyte *); +GLAPI void APIENTRY glVariantusvEXT (GLuint, const GLushort *); +GLAPI void APIENTRY glVariantuivEXT (GLuint, const GLuint *); +GLAPI void APIENTRY glVariantPointerEXT (GLuint, GLenum, GLuint, const GLvoid *); +GLAPI void APIENTRY glEnableVariantClientStateEXT (GLuint); +GLAPI void APIENTRY glDisableVariantClientStateEXT (GLuint); +GLAPI GLuint APIENTRY glBindLightParameterEXT (GLenum, GLenum); +GLAPI GLuint APIENTRY glBindMaterialParameterEXT (GLenum, GLenum); +GLAPI GLuint APIENTRY glBindTexGenParameterEXT (GLenum, GLenum, GLenum); +GLAPI GLuint APIENTRY glBindTextureUnitParameterEXT (GLenum, GLenum); +GLAPI GLuint APIENTRY glBindParameterEXT (GLenum); +GLAPI GLboolean APIENTRY glIsVariantEnabledEXT (GLuint, GLenum); +GLAPI void APIENTRY glGetVariantBooleanvEXT (GLuint, GLenum, GLboolean *); +GLAPI void APIENTRY glGetVariantIntegervEXT (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetVariantFloatvEXT (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetVariantPointervEXT (GLuint, GLenum, GLvoid* *); +GLAPI void APIENTRY glGetInvariantBooleanvEXT (GLuint, GLenum, GLboolean *); +GLAPI void APIENTRY glGetInvariantIntegervEXT (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetInvariantFloatvEXT (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetLocalConstantBooleanvEXT (GLuint, GLenum, GLboolean *); +GLAPI void APIENTRY glGetLocalConstantIntegervEXT (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetLocalConstantFloatvEXT (GLuint, GLenum, GLfloat *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBEGINVERTEXSHADEREXTPROC) (void); +typedef void (APIENTRYP PFNGLENDVERTEXSHADEREXTPROC) (void); +typedef void (APIENTRYP PFNGLBINDVERTEXSHADEREXTPROC) (GLuint id); +typedef GLuint (APIENTRYP PFNGLGENVERTEXSHADERSEXTPROC) (GLuint range); +typedef void (APIENTRYP PFNGLDELETEVERTEXSHADEREXTPROC) (GLuint id); +typedef void (APIENTRYP PFNGLSHADEROP1EXTPROC) (GLenum op, GLuint res, GLuint arg1); +typedef void (APIENTRYP PFNGLSHADEROP2EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2); +typedef void (APIENTRYP PFNGLSHADEROP3EXTPROC) (GLenum op, GLuint res, GLuint arg1, GLuint arg2, GLuint arg3); +typedef void (APIENTRYP PFNGLSWIZZLEEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +typedef void (APIENTRYP PFNGLWRITEMASKEXTPROC) (GLuint res, GLuint in, GLenum outX, GLenum outY, GLenum outZ, GLenum outW); +typedef void (APIENTRYP PFNGLINSERTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); +typedef void (APIENTRYP PFNGLEXTRACTCOMPONENTEXTPROC) (GLuint res, GLuint src, GLuint num); +typedef GLuint (APIENTRYP PFNGLGENSYMBOLSEXTPROC) (GLenum datatype, GLenum storagetype, GLenum range, GLuint components); +typedef void (APIENTRYP PFNGLSETINVARIANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); +typedef void (APIENTRYP PFNGLSETLOCALCONSTANTEXTPROC) (GLuint id, GLenum type, const GLvoid *addr); +typedef void (APIENTRYP PFNGLVARIANTBVEXTPROC) (GLuint id, const GLbyte *addr); +typedef void (APIENTRYP PFNGLVARIANTSVEXTPROC) (GLuint id, const GLshort *addr); +typedef void (APIENTRYP PFNGLVARIANTIVEXTPROC) (GLuint id, const GLint *addr); +typedef void (APIENTRYP PFNGLVARIANTFVEXTPROC) (GLuint id, const GLfloat *addr); +typedef void (APIENTRYP PFNGLVARIANTDVEXTPROC) (GLuint id, const GLdouble *addr); +typedef void (APIENTRYP PFNGLVARIANTUBVEXTPROC) (GLuint id, const GLubyte *addr); +typedef void (APIENTRYP PFNGLVARIANTUSVEXTPROC) (GLuint id, const GLushort *addr); +typedef void (APIENTRYP PFNGLVARIANTUIVEXTPROC) (GLuint id, const GLuint *addr); +typedef void (APIENTRYP PFNGLVARIANTPOINTEREXTPROC) (GLuint id, GLenum type, GLuint stride, const GLvoid *addr); +typedef void (APIENTRYP PFNGLENABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); +typedef void (APIENTRYP PFNGLDISABLEVARIANTCLIENTSTATEEXTPROC) (GLuint id); +typedef GLuint (APIENTRYP PFNGLBINDLIGHTPARAMETEREXTPROC) (GLenum light, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDMATERIALPARAMETEREXTPROC) (GLenum face, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDTEXGENPARAMETEREXTPROC) (GLenum unit, GLenum coord, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDTEXTUREUNITPARAMETEREXTPROC) (GLenum unit, GLenum value); +typedef GLuint (APIENTRYP PFNGLBINDPARAMETEREXTPROC) (GLenum value); +typedef GLboolean (APIENTRYP PFNGLISVARIANTENABLEDEXTPROC) (GLuint id, GLenum cap); +typedef void (APIENTRYP PFNGLGETVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +typedef void (APIENTRYP PFNGLGETVARIANTPOINTERVEXTPROC) (GLuint id, GLenum value, GLvoid* *data); +typedef void (APIENTRYP PFNGLGETINVARIANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETINVARIANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETINVARIANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTBOOLEANVEXTPROC) (GLuint id, GLenum value, GLboolean *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTINTEGERVEXTPROC) (GLuint id, GLenum value, GLint *data); +typedef void (APIENTRYP PFNGLGETLOCALCONSTANTFLOATVEXTPROC) (GLuint id, GLenum value, GLfloat *data); +#endif + +#ifndef GL_ATI_vertex_streams +#define GL_ATI_vertex_streams 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexStream1sATI (GLenum, GLshort); +GLAPI void APIENTRY glVertexStream1svATI (GLenum, const GLshort *); +GLAPI void APIENTRY glVertexStream1iATI (GLenum, GLint); +GLAPI void APIENTRY glVertexStream1ivATI (GLenum, const GLint *); +GLAPI void APIENTRY glVertexStream1fATI (GLenum, GLfloat); +GLAPI void APIENTRY glVertexStream1fvATI (GLenum, const GLfloat *); +GLAPI void APIENTRY glVertexStream1dATI (GLenum, GLdouble); +GLAPI void APIENTRY glVertexStream1dvATI (GLenum, const GLdouble *); +GLAPI void APIENTRY glVertexStream2sATI (GLenum, GLshort, GLshort); +GLAPI void APIENTRY glVertexStream2svATI (GLenum, const GLshort *); +GLAPI void APIENTRY glVertexStream2iATI (GLenum, GLint, GLint); +GLAPI void APIENTRY glVertexStream2ivATI (GLenum, const GLint *); +GLAPI void APIENTRY glVertexStream2fATI (GLenum, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexStream2fvATI (GLenum, const GLfloat *); +GLAPI void APIENTRY glVertexStream2dATI (GLenum, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexStream2dvATI (GLenum, const GLdouble *); +GLAPI void APIENTRY glVertexStream3sATI (GLenum, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexStream3svATI (GLenum, const GLshort *); +GLAPI void APIENTRY glVertexStream3iATI (GLenum, GLint, GLint, GLint); +GLAPI void APIENTRY glVertexStream3ivATI (GLenum, const GLint *); +GLAPI void APIENTRY glVertexStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexStream3fvATI (GLenum, const GLfloat *); +GLAPI void APIENTRY glVertexStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexStream3dvATI (GLenum, const GLdouble *); +GLAPI void APIENTRY glVertexStream4sATI (GLenum, GLshort, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glVertexStream4svATI (GLenum, const GLshort *); +GLAPI void APIENTRY glVertexStream4iATI (GLenum, GLint, GLint, GLint, GLint); +GLAPI void APIENTRY glVertexStream4ivATI (GLenum, const GLint *); +GLAPI void APIENTRY glVertexStream4fATI (GLenum, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glVertexStream4fvATI (GLenum, const GLfloat *); +GLAPI void APIENTRY glVertexStream4dATI (GLenum, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glVertexStream4dvATI (GLenum, const GLdouble *); +GLAPI void APIENTRY glNormalStream3bATI (GLenum, GLbyte, GLbyte, GLbyte); +GLAPI void APIENTRY glNormalStream3bvATI (GLenum, const GLbyte *); +GLAPI void APIENTRY glNormalStream3sATI (GLenum, GLshort, GLshort, GLshort); +GLAPI void APIENTRY glNormalStream3svATI (GLenum, const GLshort *); +GLAPI void APIENTRY glNormalStream3iATI (GLenum, GLint, GLint, GLint); +GLAPI void APIENTRY glNormalStream3ivATI (GLenum, const GLint *); +GLAPI void APIENTRY glNormalStream3fATI (GLenum, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glNormalStream3fvATI (GLenum, const GLfloat *); +GLAPI void APIENTRY glNormalStream3dATI (GLenum, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glNormalStream3dvATI (GLenum, const GLdouble *); +GLAPI void APIENTRY glClientActiveVertexStreamATI (GLenum); +GLAPI void APIENTRY glVertexBlendEnviATI (GLenum, GLint); +GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum, GLfloat); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXSTREAM1SATIPROC) (GLenum stream, GLshort x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1IATIPROC) (GLenum stream, GLint x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1FATIPROC) (GLenum stream, GLfloat x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1DATIPROC) (GLenum stream, GLdouble x); +typedef void (APIENTRYP PFNGLVERTEXSTREAM1DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2SATIPROC) (GLenum stream, GLshort x, GLshort y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2IATIPROC) (GLenum stream, GLint x, GLint y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2FATIPROC) (GLenum stream, GLfloat x, GLfloat y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2DATIPROC) (GLenum stream, GLdouble x, GLdouble y); +typedef void (APIENTRYP PFNGLVERTEXSTREAM2DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3IATIPROC) (GLenum stream, GLint x, GLint y, GLint z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z); +typedef void (APIENTRYP PFNGLVERTEXSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4SATIPROC) (GLenum stream, GLshort x, GLshort y, GLshort z, GLshort w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4IATIPROC) (GLenum stream, GLint x, GLint y, GLint z, GLint w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4FATIPROC) (GLenum stream, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4DATIPROC) (GLenum stream, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLVERTEXSTREAM4DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3BATIPROC) (GLenum stream, GLbyte nx, GLbyte ny, GLbyte nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3BVATIPROC) (GLenum stream, const GLbyte *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3SATIPROC) (GLenum stream, GLshort nx, GLshort ny, GLshort nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3SVATIPROC) (GLenum stream, const GLshort *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3IATIPROC) (GLenum stream, GLint nx, GLint ny, GLint nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3IVATIPROC) (GLenum stream, const GLint *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3FATIPROC) (GLenum stream, GLfloat nx, GLfloat ny, GLfloat nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3FVATIPROC) (GLenum stream, const GLfloat *coords); +typedef void (APIENTRYP PFNGLNORMALSTREAM3DATIPROC) (GLenum stream, GLdouble nx, GLdouble ny, GLdouble nz); +typedef void (APIENTRYP PFNGLNORMALSTREAM3DVATIPROC) (GLenum stream, const GLdouble *coords); +typedef void (APIENTRYP PFNGLCLIENTACTIVEVERTEXSTREAMATIPROC) (GLenum stream); +typedef void (APIENTRYP PFNGLVERTEXBLENDENVIATIPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLVERTEXBLENDENVFATIPROC) (GLenum pname, GLfloat param); +#endif + +#ifndef GL_ATI_element_array +#define GL_ATI_element_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glElementPointerATI (GLenum, const GLvoid *); +GLAPI void APIENTRY glDrawElementArrayATI (GLenum, GLsizei); +GLAPI void APIENTRY glDrawRangeElementArrayATI (GLenum, GLuint, GLuint, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLELEMENTPOINTERATIPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYATIPROC) (GLenum mode, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYATIPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count); +#endif + +#ifndef GL_SUN_mesh_array +#define GL_SUN_mesh_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshArraysSUN (GLenum, GLint, GLsizei, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWMESHARRAYSSUNPROC) (GLenum mode, GLint first, GLsizei count, GLsizei width); +#endif + +#ifndef GL_SUN_slice_accum +#define GL_SUN_slice_accum 1 +#endif + +#ifndef GL_NV_multisample_filter_hint +#define GL_NV_multisample_filter_hint 1 +#endif + +#ifndef GL_NV_depth_clamp +#define GL_NV_depth_clamp 1 +#endif + +#ifndef GL_NV_occlusion_query +#define GL_NV_occlusion_query 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenOcclusionQueriesNV (GLsizei, GLuint *); +GLAPI void APIENTRY glDeleteOcclusionQueriesNV (GLsizei, const GLuint *); +GLAPI GLboolean APIENTRY glIsOcclusionQueryNV (GLuint); +GLAPI void APIENTRY glBeginOcclusionQueryNV (GLuint); +GLAPI void APIENTRY glEndOcclusionQueryNV (void); +GLAPI void APIENTRY glGetOcclusionQueryivNV (GLuint, GLenum, GLint *); +GLAPI void APIENTRY glGetOcclusionQueryuivNV (GLuint, GLenum, GLuint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENOCCLUSIONQUERIESNVPROC) (GLsizei n, GLuint *ids); +typedef void (APIENTRYP PFNGLDELETEOCCLUSIONQUERIESNVPROC) (GLsizei n, const GLuint *ids); +typedef GLboolean (APIENTRYP PFNGLISOCCLUSIONQUERYNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLBEGINOCCLUSIONQUERYNVPROC) (GLuint id); +typedef void (APIENTRYP PFNGLENDOCCLUSIONQUERYNVPROC) (void); +typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYIVNVPROC) (GLuint id, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGETOCCLUSIONQUERYUIVNVPROC) (GLuint id, GLenum pname, GLuint *params); +#endif + +#ifndef GL_NV_point_sprite +#define GL_NV_point_sprite 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPointParameteriNV (GLenum, GLint); +GLAPI void APIENTRY glPointParameterivNV (GLenum, const GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPOINTPARAMETERINVPROC) (GLenum pname, GLint param); +typedef void (APIENTRYP PFNGLPOINTPARAMETERIVNVPROC) (GLenum pname, const GLint *params); +#endif + +#ifndef GL_NV_texture_shader3 +#define GL_NV_texture_shader3 1 +#endif + +#ifndef GL_NV_vertex_program1_1 +#define GL_NV_vertex_program1_1 1 +#endif + +#ifndef GL_EXT_shadow_funcs +#define GL_EXT_shadow_funcs 1 +#endif + +#ifndef GL_EXT_stencil_two_side +#define GL_EXT_stencil_two_side 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glActiveStencilFaceEXT (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLACTIVESTENCILFACEEXTPROC) (GLenum face); +#endif + +#ifndef GL_ATI_text_fragment_shader +#define GL_ATI_text_fragment_shader 1 +#endif + +#ifndef GL_APPLE_client_storage +#define GL_APPLE_client_storage 1 +#endif + +#ifndef GL_APPLE_element_array +#define GL_APPLE_element_array 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glElementPointerAPPLE (GLenum, const GLvoid *); +GLAPI void APIENTRY glDrawElementArrayAPPLE (GLenum, GLint, GLsizei); +GLAPI void APIENTRY glDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, GLint, GLsizei); +GLAPI void APIENTRY glMultiDrawElementArrayAPPLE (GLenum, const GLint *, const GLsizei *, GLsizei); +GLAPI void APIENTRY glMultiDrawRangeElementArrayAPPLE (GLenum, GLuint, GLuint, const GLint *, const GLsizei *, GLsizei); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLELEMENTPOINTERAPPLEPROC) (GLenum type, const GLvoid *pointer); +typedef void (APIENTRYP PFNGLDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTARRAYAPPLEPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); +typedef void (APIENTRYP PFNGLMULTIDRAWRANGEELEMENTARRAYAPPLEPROC) (GLenum mode, GLuint start, GLuint end, const GLint *first, const GLsizei *count, GLsizei primcount); +#endif + +#ifndef GL_APPLE_fence +#define GL_APPLE_fence 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenFencesAPPLE (GLsizei, GLuint *); +GLAPI void APIENTRY glDeleteFencesAPPLE (GLsizei, const GLuint *); +GLAPI void APIENTRY glSetFenceAPPLE (GLuint); +GLAPI GLboolean APIENTRY glIsFenceAPPLE (GLuint); +GLAPI GLboolean APIENTRY glTestFenceAPPLE (GLuint); +GLAPI void APIENTRY glFinishFenceAPPLE (GLuint); +GLAPI GLboolean APIENTRY glTestObjectAPPLE (GLenum, GLuint); +GLAPI void APIENTRY glFinishObjectAPPLE (GLenum, GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLGENFENCESAPPLEPROC) (GLsizei n, GLuint *fences); +typedef void (APIENTRYP PFNGLDELETEFENCESAPPLEPROC) (GLsizei n, const GLuint *fences); +typedef void (APIENTRYP PFNGLSETFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLISFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTFENCEAPPLEPROC) (GLuint fence); +typedef void (APIENTRYP PFNGLFINISHFENCEAPPLEPROC) (GLuint fence); +typedef GLboolean (APIENTRYP PFNGLTESTOBJECTAPPLEPROC) (GLenum object, GLuint name); +typedef void (APIENTRYP PFNGLFINISHOBJECTAPPLEPROC) (GLenum object, GLint name); +#endif + +#ifndef GL_APPLE_vertex_array_object +#define GL_APPLE_vertex_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindVertexArrayAPPLE (GLuint); +GLAPI void APIENTRY glDeleteVertexArraysAPPLE (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenVertexArraysAPPLE (GLsizei, const GLuint *); +GLAPI GLboolean APIENTRY glIsVertexArrayAPPLE (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBINDVERTEXARRAYAPPLEPROC) (GLuint array); +typedef void (APIENTRYP PFNGLDELETEVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); +typedef void (APIENTRYP PFNGLGENVERTEXARRAYSAPPLEPROC) (GLsizei n, const GLuint *arrays); +typedef GLboolean (APIENTRYP PFNGLISVERTEXARRAYAPPLEPROC) (GLuint array); +#endif + +#ifndef GL_APPLE_vertex_array_range +#define GL_APPLE_vertex_array_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexArrayRangeAPPLE (GLsizei, GLvoid *); +GLAPI void APIENTRY glFlushVertexArrayRangeAPPLE (GLsizei, GLvoid *); +GLAPI void APIENTRY glVertexArrayParameteriAPPLE (GLenum, GLint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLFLUSHVERTEXARRAYRANGEAPPLEPROC) (GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLVERTEXARRAYPARAMETERIAPPLEPROC) (GLenum pname, GLint param); +#endif + +#ifndef GL_APPLE_ycbcr_422 +#define GL_APPLE_ycbcr_422 1 +#endif + +#ifndef GL_S3_s3tc +#define GL_S3_s3tc 1 +#endif + +#ifndef GL_ATI_draw_buffers +#define GL_ATI_draw_buffers 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawBuffersATI (GLsizei, const GLenum *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDRAWBUFFERSATIPROC) (GLsizei n, const GLenum *bufs); +#endif + +#ifndef GL_ATI_pixel_format_float +#define GL_ATI_pixel_format_float 1 +/* This is really a WGL extension, but defines some associated GL enums. + * ATI does not export "GL_ATI_pixel_format_float" in the GL_EXTENSIONS string. + */ +#endif + +#ifndef GL_ATI_texture_env_combine3 +#define GL_ATI_texture_env_combine3 1 +#endif + +#ifndef GL_ATI_texture_float +#define GL_ATI_texture_float 1 +#endif + +#ifndef GL_NV_float_buffer +#define GL_NV_float_buffer 1 +#endif + +#ifndef GL_NV_fragment_program +#define GL_NV_fragment_program 1 +/* Some NV_fragment_program entry points are shared with ARB_vertex_program. */ +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glProgramNamedParameter4fNV (GLuint, GLsizei, const GLubyte *, GLfloat, GLfloat, GLfloat, GLfloat); +GLAPI void APIENTRY glProgramNamedParameter4dNV (GLuint, GLsizei, const GLubyte *, GLdouble, GLdouble, GLdouble, GLdouble); +GLAPI void APIENTRY glProgramNamedParameter4fvNV (GLuint, GLsizei, const GLubyte *, const GLfloat *); +GLAPI void APIENTRY glProgramNamedParameter4dvNV (GLuint, GLsizei, const GLubyte *, const GLdouble *); +GLAPI void APIENTRY glGetProgramNamedParameterfvNV (GLuint, GLsizei, const GLubyte *, GLfloat *); +GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint, GLsizei, const GLubyte *, GLdouble *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat x, GLfloat y, GLfloat z, GLfloat w); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble x, GLdouble y, GLdouble z, GLdouble w); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLfloat *v); +typedef void (APIENTRYP PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, const GLdouble *v); +typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLfloat *params); +typedef void (APIENTRYP PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC) (GLuint id, GLsizei len, const GLubyte *name, GLdouble *params); +#endif + +#ifndef GL_NV_half_float +#define GL_NV_half_float 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertex2hNV (GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glVertex2hvNV (const GLhalfNV *); +GLAPI void APIENTRY glVertex3hNV (GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glVertex3hvNV (const GLhalfNV *); +GLAPI void APIENTRY glVertex4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glVertex4hvNV (const GLhalfNV *); +GLAPI void APIENTRY glNormal3hNV (GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glNormal3hvNV (const GLhalfNV *); +GLAPI void APIENTRY glColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glColor3hvNV (const GLhalfNV *); +GLAPI void APIENTRY glColor4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glColor4hvNV (const GLhalfNV *); +GLAPI void APIENTRY glTexCoord1hNV (GLhalfNV); +GLAPI void APIENTRY glTexCoord1hvNV (const GLhalfNV *); +GLAPI void APIENTRY glTexCoord2hNV (GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glTexCoord2hvNV (const GLhalfNV *); +GLAPI void APIENTRY glTexCoord3hNV (GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glTexCoord3hvNV (const GLhalfNV *); +GLAPI void APIENTRY glTexCoord4hNV (GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glTexCoord4hvNV (const GLhalfNV *); +GLAPI void APIENTRY glMultiTexCoord1hNV (GLenum, GLhalfNV); +GLAPI void APIENTRY glMultiTexCoord1hvNV (GLenum, const GLhalfNV *); +GLAPI void APIENTRY glMultiTexCoord2hNV (GLenum, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glMultiTexCoord2hvNV (GLenum, const GLhalfNV *); +GLAPI void APIENTRY glMultiTexCoord3hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glMultiTexCoord3hvNV (GLenum, const GLhalfNV *); +GLAPI void APIENTRY glMultiTexCoord4hNV (GLenum, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glMultiTexCoord4hvNV (GLenum, const GLhalfNV *); +GLAPI void APIENTRY glFogCoordhNV (GLhalfNV); +GLAPI void APIENTRY glFogCoordhvNV (const GLhalfNV *); +GLAPI void APIENTRY glSecondaryColor3hNV (GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glSecondaryColor3hvNV (const GLhalfNV *); +GLAPI void APIENTRY glVertexWeighthNV (GLhalfNV); +GLAPI void APIENTRY glVertexWeighthvNV (const GLhalfNV *); +GLAPI void APIENTRY glVertexAttrib1hNV (GLuint, GLhalfNV); +GLAPI void APIENTRY glVertexAttrib1hvNV (GLuint, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttrib2hNV (GLuint, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glVertexAttrib2hvNV (GLuint, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttrib3hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glVertexAttrib3hvNV (GLuint, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttrib4hNV (GLuint, GLhalfNV, GLhalfNV, GLhalfNV, GLhalfNV); +GLAPI void APIENTRY glVertexAttrib4hvNV (GLuint, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttribs1hvNV (GLuint, GLsizei, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttribs2hvNV (GLuint, GLsizei, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttribs3hvNV (GLuint, GLsizei, const GLhalfNV *); +GLAPI void APIENTRY glVertexAttribs4hvNV (GLuint, GLsizei, const GLhalfNV *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEX2HNVPROC) (GLhalfNV x, GLhalfNV y); +typedef void (APIENTRYP PFNGLVERTEX2HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEX3HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z); +typedef void (APIENTRYP PFNGLVERTEX3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEX4HNVPROC) (GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +typedef void (APIENTRYP PFNGLVERTEX4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLNORMAL3HNVPROC) (GLhalfNV nx, GLhalfNV ny, GLhalfNV nz); +typedef void (APIENTRYP PFNGLNORMAL3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +typedef void (APIENTRYP PFNGLCOLOR3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLCOLOR4HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue, GLhalfNV alpha); +typedef void (APIENTRYP PFNGLCOLOR4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD1HNVPROC) (GLhalfNV s); +typedef void (APIENTRYP PFNGLTEXCOORD1HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD2HNVPROC) (GLhalfNV s, GLhalfNV t); +typedef void (APIENTRYP PFNGLTEXCOORD2HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD3HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r); +typedef void (APIENTRYP PFNGLTEXCOORD3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLTEXCOORD4HNVPROC) (GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +typedef void (APIENTRYP PFNGLTEXCOORD4HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1HNVPROC) (GLenum target, GLhalfNV s); +typedef void (APIENTRYP PFNGLMULTITEXCOORD1HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t); +typedef void (APIENTRYP PFNGLMULTITEXCOORD2HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r); +typedef void (APIENTRYP PFNGLMULTITEXCOORD3HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4HNVPROC) (GLenum target, GLhalfNV s, GLhalfNV t, GLhalfNV r, GLhalfNV q); +typedef void (APIENTRYP PFNGLMULTITEXCOORD4HVNVPROC) (GLenum target, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLFOGCOORDHNVPROC) (GLhalfNV fog); +typedef void (APIENTRYP PFNGLFOGCOORDHVNVPROC) (const GLhalfNV *fog); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HNVPROC) (GLhalfNV red, GLhalfNV green, GLhalfNV blue); +typedef void (APIENTRYP PFNGLSECONDARYCOLOR3HVNVPROC) (const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTHNVPROC) (GLhalfNV weight); +typedef void (APIENTRYP PFNGLVERTEXWEIGHTHVNVPROC) (const GLhalfNV *weight); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1HNVPROC) (GLuint index, GLhalfNV x); +typedef void (APIENTRYP PFNGLVERTEXATTRIB1HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y); +typedef void (APIENTRYP PFNGLVERTEXATTRIB2HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z); +typedef void (APIENTRYP PFNGLVERTEXATTRIB3HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4HNVPROC) (GLuint index, GLhalfNV x, GLhalfNV y, GLhalfNV z, GLhalfNV w); +typedef void (APIENTRYP PFNGLVERTEXATTRIB4HVNVPROC) (GLuint index, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS1HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS2HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS3HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +typedef void (APIENTRYP PFNGLVERTEXATTRIBS4HVNVPROC) (GLuint index, GLsizei n, const GLhalfNV *v); +#endif + +#ifndef GL_NV_pixel_data_range +#define GL_NV_pixel_data_range 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPixelDataRangeNV (GLenum, GLsizei, GLvoid *); +GLAPI void APIENTRY glFlushPixelDataRangeNV (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPIXELDATARANGENVPROC) (GLenum target, GLsizei length, GLvoid *pointer); +typedef void (APIENTRYP PFNGLFLUSHPIXELDATARANGENVPROC) (GLenum target); +#endif + +#ifndef GL_NV_primitive_restart +#define GL_NV_primitive_restart 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glPrimitiveRestartNV (void); +GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTNVPROC) (void); +typedef void (APIENTRYP PFNGLPRIMITIVERESTARTINDEXNVPROC) (GLuint index); +#endif + +#ifndef GL_NV_texture_expand_normal +#define GL_NV_texture_expand_normal 1 +#endif + +#ifndef GL_NV_vertex_program2 +#define GL_NV_vertex_program2 1 +#endif + +#ifndef GL_ATI_map_object_buffer +#define GL_ATI_map_object_buffer 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLvoid* APIENTRY glMapObjectBufferATI (GLuint); +GLAPI void APIENTRY glUnmapObjectBufferATI (GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLvoid* (APIENTRYP PFNGLMAPOBJECTBUFFERATIPROC) (GLuint buffer); +typedef void (APIENTRYP PFNGLUNMAPOBJECTBUFFERATIPROC) (GLuint buffer); +#endif + +#ifndef GL_ATI_separate_stencil +#define GL_ATI_separate_stencil 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStencilOpSeparateATI (GLenum, GLenum, GLenum, GLenum); +GLAPI void APIENTRY glStencilFuncSeparateATI (GLenum, GLenum, GLint, GLuint); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSTENCILOPSEPARATEATIPROC) (GLenum face, GLenum sfail, GLenum dpfail, GLenum dppass); +typedef void (APIENTRYP PFNGLSTENCILFUNCSEPARATEATIPROC) (GLenum frontfunc, GLenum backfunc, GLint ref, GLuint mask); +#endif + +#ifndef GL_ATI_vertex_attrib_array_object +#define GL_ATI_vertex_attrib_array_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glVertexAttribArrayObjectATI (GLuint, GLint, GLenum, GLboolean, GLsizei, GLuint, GLuint); +GLAPI void APIENTRY glGetVertexAttribArrayObjectfvATI (GLuint, GLenum, GLfloat *); +GLAPI void APIENTRY glGetVertexAttribArrayObjectivATI (GLuint, GLenum, GLint *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLVERTEXATTRIBARRAYOBJECTATIPROC) (GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, GLuint buffer, GLuint offset); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTFVATIPROC) (GLuint index, GLenum pname, GLfloat *params); +typedef void (APIENTRYP PFNGLGETVERTEXATTRIBARRAYOBJECTIVATIPROC) (GLuint index, GLenum pname, GLint *params); +#endif + +#ifndef GL_OES_read_format +#define GL_OES_read_format 1 +#endif + +#ifndef GL_EXT_depth_bounds_test +#define GL_EXT_depth_bounds_test 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDepthBoundsEXT (GLclampd, GLclampd); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLDEPTHBOUNDSEXTPROC) (GLclampd zmin, GLclampd zmax); +#endif + +#ifndef GL_EXT_texture_mirror_clamp +#define GL_EXT_texture_mirror_clamp 1 +#endif + +#ifndef GL_EXT_blend_equation_separate +#define GL_EXT_blend_equation_separate 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBlendEquationSeparateEXT (GLenum, GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLBLENDEQUATIONSEPARATEEXTPROC) (GLenum modeRGB, GLenum modeAlpha); +#endif + +#ifndef GL_MESA_pack_invert +#define GL_MESA_pack_invert 1 +#endif + +#ifndef GL_MESA_ycbcr_texture +#define GL_MESA_ycbcr_texture 1 +#endif + +#ifndef GL_EXT_pixel_buffer_object +#define GL_EXT_pixel_buffer_object 1 +#endif + +#ifndef GL_NV_fragment_program_option +#define GL_NV_fragment_program_option 1 +#endif + +#ifndef GL_NV_fragment_program2 +#define GL_NV_fragment_program2 1 +#endif + +#ifndef GL_NV_vertex_program2_option +#define GL_NV_vertex_program2_option 1 +#endif + +#ifndef GL_NV_vertex_program3 +#define GL_NV_vertex_program3 1 +#endif + +#ifndef GL_EXT_framebuffer_object +#define GL_EXT_framebuffer_object 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glIsRenderbufferEXT (GLuint); +GLAPI void APIENTRY glBindRenderbufferEXT (GLenum, GLuint); +GLAPI void APIENTRY glDeleteRenderbuffersEXT (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenRenderbuffersEXT (GLsizei, GLuint *); +GLAPI void APIENTRY glRenderbufferStorageEXT (GLenum, GLenum, GLsizei, GLsizei); +GLAPI void APIENTRY glGetRenderbufferParameterivEXT (GLenum, GLenum, GLint *); +GLAPI GLboolean APIENTRY glIsFramebufferEXT (GLuint); +GLAPI void APIENTRY glBindFramebufferEXT (GLenum, GLuint); +GLAPI void APIENTRY glDeleteFramebuffersEXT (GLsizei, const GLuint *); +GLAPI void APIENTRY glGenFramebuffersEXT (GLsizei, GLuint *); +GLAPI GLenum APIENTRY glCheckFramebufferStatusEXT (GLenum); +GLAPI void APIENTRY glFramebufferTexture1DEXT (GLenum, GLenum, GLenum, GLuint, GLint); +GLAPI void APIENTRY glFramebufferTexture2DEXT (GLenum, GLenum, GLenum, GLuint, GLint); +GLAPI void APIENTRY glFramebufferTexture3DEXT (GLenum, GLenum, GLenum, GLuint, GLint, GLint); +GLAPI void APIENTRY glFramebufferRenderbufferEXT (GLenum, GLenum, GLenum, GLuint); +GLAPI void APIENTRY glGetFramebufferAttachmentParameterivEXT (GLenum, GLenum, GLenum, GLint *); +GLAPI void APIENTRY glGenerateMipmapEXT (GLenum); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef GLboolean (APIENTRYP PFNGLISRENDERBUFFEREXTPROC) (GLuint renderbuffer); +typedef void (APIENTRYP PFNGLBINDRENDERBUFFEREXTPROC) (GLenum target, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLDELETERENDERBUFFERSEXTPROC) (GLsizei n, const GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLGENRENDERBUFFERSEXTPROC) (GLsizei n, GLuint *renderbuffers); +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEEXTPROC) (GLenum target, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLGETRENDERBUFFERPARAMETERIVEXTPROC) (GLenum target, GLenum pname, GLint *params); +typedef GLboolean (APIENTRYP PFNGLISFRAMEBUFFEREXTPROC) (GLuint framebuffer); +typedef void (APIENTRYP PFNGLBINDFRAMEBUFFEREXTPROC) (GLenum target, GLuint framebuffer); +typedef void (APIENTRYP PFNGLDELETEFRAMEBUFFERSEXTPROC) (GLsizei n, const GLuint *framebuffers); +typedef void (APIENTRYP PFNGLGENFRAMEBUFFERSEXTPROC) (GLsizei n, GLuint *framebuffers); +typedef GLenum (APIENTRYP PFNGLCHECKFRAMEBUFFERSTATUSEXTPROC) (GLenum target); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE1DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE2DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level); +typedef void (APIENTRYP PFNGLFRAMEBUFFERTEXTURE3DEXTPROC) (GLenum target, GLenum attachment, GLenum textarget, GLuint texture, GLint level, GLint zoffset); +typedef void (APIENTRYP PFNGLFRAMEBUFFERRENDERBUFFEREXTPROC) (GLenum target, GLenum attachment, GLenum renderbuffertarget, GLuint renderbuffer); +typedef void (APIENTRYP PFNGLGETFRAMEBUFFERATTACHMENTPARAMETERIVEXTPROC) (GLenum target, GLenum attachment, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLGENERATEMIPMAPEXTPROC) (GLenum target); +#endif + +#ifndef GL_GREMEDY_string_marker +#define GL_GREMEDY_string_marker 1 +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glStringMarkerGREMEDY (GLsizei, const GLvoid *); +#endif /* GL_GLEXT_PROTOTYPES */ +typedef void (APIENTRYP PFNGLSTRINGMARKERGREMEDYPROC) (GLsizei len, const GLvoid *string); +#endif + + +#ifdef __cplusplus +} +#endif + +#endif +#endif /* NO_SDL_GLEXT */ +/*@}*/ diff --git a/apps/plugins/sdl/include/SDL_platform.h b/apps/plugins/sdl/include/SDL_platform.h new file mode 100644 index 0000000..22c3201 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_platform.h @@ -0,0 +1,114 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_platform.h + * Try to get a standard set of platform defines + */ + +#ifndef _SDL_platform_h +#define _SDL_platform_h + +#if defined(_AIX) +#undef __AIX__ +#define __AIX__ 1 +#endif +#if defined(__BEOS__) +#undef __BEOS__ +#define __BEOS__ 1 +#endif +#if defined(__HAIKU__) +#undef __HAIKU__ +#define __HAIKU__ 1 +#endif +#if defined(bsdi) || defined(__bsdi) || defined(__bsdi__) +#undef __BSDI__ +#define __BSDI__ 1 +#endif +#if defined(_arch_dreamcast) +#undef __DREAMCAST__ +#define __DREAMCAST__ 1 +#endif +#if defined(__FreeBSD__) || defined(__FreeBSD_kernel__) || defined(__DragonFly__) +#undef __FREEBSD__ +#define __FREEBSD__ 1 +#endif +#if defined(__HAIKU__) +#undef __HAIKU__ +#define __HAIKU__ 1 +#endif +#if defined(hpux) || defined(__hpux) || defined(__hpux__) +#undef __HPUX__ +#define __HPUX__ 1 +#endif +#if defined(sgi) || defined(__sgi) || defined(__sgi__) || defined(_SGI_SOURCE) +#undef __IRIX__ +#define __IRIX__ 1 +#endif +#if (defined(linux) || defined(__linux) || defined(__linux__)) && !defined(ROCKBOX) +#undef __LINUX__ +#define __LINUX__ 1 +#endif +#if defined(__APPLE__) +#undef __MACOSX__ +#define __MACOSX__ 1 +#elif defined(macintosh) +#undef __MACOS__ +#define __MACOS__ 1 +#endif +#if defined(__NetBSD__) +#undef __NETBSD__ +#define __NETBSD__ 1 +#endif +#if defined(__OpenBSD__) +#undef __OPENBSD__ +#define __OPENBSD__ 1 +#endif +#if defined(__OS2__) +#undef __OS2__ +#define __OS2__ 1 +#endif +#if defined(osf) || defined(__osf) || defined(__osf__) || defined(_OSF_SOURCE) +#undef __OSF__ +#define __OSF__ 1 +#endif +#if defined(__QNXNTO__) +#undef __QNXNTO__ +#define __QNXNTO__ 1 +#endif +#if defined(riscos) || defined(__riscos) || defined(__riscos__) +#undef __RISCOS__ +#define __RISCOS__ 1 +#endif +#if defined(__SVR4) +#undef __SOLARIS__ +#define __SOLARIS__ 1 +#endif +#if defined(WIN32) || defined(_WIN32) +#undef __WIN32__ +#define __WIN32__ 1 +#endif +#if defined(ROCKBOX) +#undef __ROCKBOX__ +#define __ROCKBOX__ 1 +#endif + +#endif /* _SDL_platform_h */ diff --git a/apps/plugins/sdl/include/SDL_quit.h b/apps/plugins/sdl/include/SDL_quit.h new file mode 100644 index 0000000..abd2ec6 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_quit.h @@ -0,0 +1,55 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_quit.h + * Include file for SDL quit event handling + */ + +#ifndef _SDL_quit_h +#define _SDL_quit_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +/** @file SDL_quit.h + * An SDL_QUITEVENT is generated when the user tries to close the application + * window. If it is ignored or filtered out, the window will remain open. + * If it is not ignored or filtered, it is queued normally and the window + * is allowed to close. When the window is closed, screen updates will + * complete, but have no effect. + * + * SDL_Init() installs signal handlers for SIGINT (keyboard interrupt) + * and SIGTERM (system termination request), if handlers do not already + * exist, that generate SDL_QUITEVENT events as well. There is no way + * to determine the cause of an SDL_QUITEVENT, but setting a signal + * handler in your application will override the default generation of + * quit events for that signal. + */ + +/** @file SDL_quit.h + * There are no functions directly affecting the quit event + */ + +#define SDL_QuitRequested() \ + (SDL_PumpEvents(), SDL_PeepEvents(NULL,0,SDL_PEEKEVENT,SDL_QUITMASK)) + +#endif /* _SDL_quit_h */ diff --git a/apps/plugins/sdl/include/SDL_rwops.h b/apps/plugins/sdl/include/SDL_rwops.h new file mode 100644 index 0000000..98361d7 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_rwops.h @@ -0,0 +1,155 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_rwops.h + * This file provides a general interface for SDL to read and write + * data sources. It can easily be extended to files, memory, etc. + */ + +#ifndef _SDL_rwops_h +#define _SDL_rwops_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** This is the read/write operation structure -- very basic */ + +typedef struct SDL_RWops { + /** Seek to 'offset' relative to whence, one of stdio's whence values: + * SEEK_SET, SEEK_CUR, SEEK_END + * Returns the final offset in the data source. + */ + int (SDLCALL *seek)(struct SDL_RWops *context, int offset, int whence); + + /** Read up to 'maxnum' objects each of size 'size' from the data + * source to the area pointed at by 'ptr'. + * Returns the number of objects read, or -1 if the read failed. + */ + int (SDLCALL *read)(struct SDL_RWops *context, void *ptr, int size, int maxnum); + + /** Write exactly 'num' objects each of size 'objsize' from the area + * pointed at by 'ptr' to data source. + * Returns 'num', or -1 if the write failed. + */ + int (SDLCALL *write)(struct SDL_RWops *context, const void *ptr, int size, int num); + + /** Close and free an allocated SDL_FSops structure */ + int (SDLCALL *close)(struct SDL_RWops *context); + + Uint32 type; + union { +#if defined(__WIN32__) && !defined(__SYMBIAN32__) + struct { + int append; + void *h; + struct { + void *data; + int size; + int left; + } buffer; + } win32io; +#endif +#ifdef HAVE_STDIO_H + struct { + int autoclose; + FILE *fp; + } stdio; +#endif + struct { + Uint8 *base; + Uint8 *here; + Uint8 *stop; + } mem; + struct { + void *data1; + } unknown; + } hidden; + +} SDL_RWops; + + +/** @name Functions to create SDL_RWops structures from various data sources */ +/*@{*/ + +extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFile(const char *file, const char *mode); + +#ifdef HAVE_STDIO_H +extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromFP(FILE *fp, int autoclose); +#endif + +extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromMem(void *mem, int size); +extern DECLSPEC SDL_RWops * SDLCALL SDL_RWFromConstMem(const void *mem, int size); + +extern DECLSPEC SDL_RWops * SDLCALL SDL_AllocRW(void); +extern DECLSPEC void SDLCALL SDL_FreeRW(SDL_RWops *area); + +/*@}*/ + +/** @name Seek Reference Points */ +/*@{*/ +#define RW_SEEK_SET 0 /**< Seek from the beginning of data */ +#define RW_SEEK_CUR 1 /**< Seek relative to current read point */ +#define RW_SEEK_END 2 /**< Seek relative to the end of data */ +/*@}*/ + +/** @name Macros to easily read and write from an SDL_RWops structure */ +/*@{*/ +#define SDL_RWseek(ctx, offset, whence) (ctx)->seek(ctx, offset, whence) +#define SDL_RWtell(ctx) (ctx)->seek(ctx, 0, RW_SEEK_CUR) +#define SDL_RWread(ctx, ptr, size, n) (ctx)->read(ctx, ptr, size, n) +#define SDL_RWwrite(ctx, ptr, size, n) (ctx)->write(ctx, ptr, size, n) +#define SDL_RWclose(ctx) (ctx)->close(ctx) +/*@}*/ + +/** @name Read an item of the specified endianness and return in native format */ +/*@{*/ +extern DECLSPEC Uint16 SDLCALL SDL_ReadLE16(SDL_RWops *src); +extern DECLSPEC Uint16 SDLCALL SDL_ReadBE16(SDL_RWops *src); +extern DECLSPEC Uint32 SDLCALL SDL_ReadLE32(SDL_RWops *src); +extern DECLSPEC Uint32 SDLCALL SDL_ReadBE32(SDL_RWops *src); +extern DECLSPEC Uint64 SDLCALL SDL_ReadLE64(SDL_RWops *src); +extern DECLSPEC Uint64 SDLCALL SDL_ReadBE64(SDL_RWops *src); +/*@}*/ + +/** @name Write an item of native format to the specified endianness */ +/*@{*/ +extern DECLSPEC int SDLCALL SDL_WriteLE16(SDL_RWops *dst, Uint16 value); +extern DECLSPEC int SDLCALL SDL_WriteBE16(SDL_RWops *dst, Uint16 value); +extern DECLSPEC int SDLCALL SDL_WriteLE32(SDL_RWops *dst, Uint32 value); +extern DECLSPEC int SDLCALL SDL_WriteBE32(SDL_RWops *dst, Uint32 value); +extern DECLSPEC int SDLCALL SDL_WriteLE64(SDL_RWops *dst, Uint64 value); +extern DECLSPEC int SDLCALL SDL_WriteBE64(SDL_RWops *dst, Uint64 value); +/*@}*/ + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_rwops_h */ diff --git a/apps/plugins/sdl/include/SDL_stdinc.h b/apps/plugins/sdl/include/SDL_stdinc.h new file mode 100644 index 0000000..65e7bb8 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_stdinc.h @@ -0,0 +1,620 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_stdinc.h + * This is a general header that includes C language support + */ + +#ifndef _SDL_stdinc_h +#define _SDL_stdinc_h + +#include "SDL_config.h" + + +#ifdef HAVE_SYS_TYPES_H +#include +#endif +#ifdef HAVE_STDIO_H +#include +#endif +#if defined(STDC_HEADERS) +# include +# include +# include +#else +# if defined(HAVE_STDLIB_H) +# include +# elif defined(HAVE_MALLOC_H) +# include +# endif +# if defined(HAVE_STDDEF_H) +# include +# endif +# if defined(HAVE_STDARG_H) +# include +# endif +#endif +#ifdef HAVE_STRING_H +# if !defined(STDC_HEADERS) && defined(HAVE_MEMORY_H) +# include +# endif +# include +#endif +#ifdef HAVE_STRINGS_H +//# include +#endif +#if defined(HAVE_INTTYPES_H) +# include +#elif defined(HAVE_STDINT_H) +# include +#endif +#ifdef HAVE_CTYPE_H +# include +#endif +#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H) +# include +#endif + +/** The number of elements in an array */ +#define SDL_arraysize(array) (sizeof(array)/sizeof(array[0])) +#define SDL_TABLESIZE(table) SDL_arraysize(table) + +/* Use proper C++ casts when compiled as C++ to be compatible with the option + -Wold-style-cast of GCC (and -Werror=old-style-cast in GCC 4.2 and above. */ +#ifdef __cplusplus +#define SDL_reinterpret_cast(type, expression) reinterpret_cast(expression) +#define SDL_static_cast(type, expression) static_cast(expression) +#else +#define SDL_reinterpret_cast(type, expression) ((type)(expression)) +#define SDL_static_cast(type, expression) ((type)(expression)) +#endif + +/** @name Basic data types */ +/*@{*/ +typedef enum { + SDL_FALSE = 0, + SDL_TRUE = 1 +} SDL_bool; + +typedef int8_t Sint8; +typedef uint8_t Uint8; +typedef int16_t Sint16; +typedef uint16_t Uint16; +typedef int32_t Sint32; +typedef uint32_t Uint32; + +#ifdef SDL_HAS_64BIT_TYPE +typedef int64_t Sint64; +#ifndef SYMBIAN32_GCCE +typedef uint64_t Uint64; +#endif +#else +/* This is really just a hack to prevent the compiler from complaining */ +typedef struct { + Uint32 hi; + Uint32 lo; +} Uint64, Sint64; +#endif + +/*@}*/ + +/** @name Make sure the types really have the right sizes */ +/*@{*/ +#define SDL_COMPILE_TIME_ASSERT(name, x) \ + typedef int SDL_dummy_ ## name[(x) * 2 - 1] + +SDL_COMPILE_TIME_ASSERT(uint8, sizeof(Uint8) == 1); +SDL_COMPILE_TIME_ASSERT(sint8, sizeof(Sint8) == 1); +SDL_COMPILE_TIME_ASSERT(uint16, sizeof(Uint16) == 2); +SDL_COMPILE_TIME_ASSERT(sint16, sizeof(Sint16) == 2); +SDL_COMPILE_TIME_ASSERT(uint32, sizeof(Uint32) == 4); +SDL_COMPILE_TIME_ASSERT(sint32, sizeof(Sint32) == 4); +SDL_COMPILE_TIME_ASSERT(uint64, sizeof(Uint64) == 8); +SDL_COMPILE_TIME_ASSERT(sint64, sizeof(Sint64) == 8); +/*@}*/ + +/** @name Enum Size Check + * Check to make sure enums are the size of ints, for structure packing. + * For both Watcom C/C++ and Borland C/C++ the compiler option that makes + * enums having the size of an int must be enabled. + * This is "-b" for Borland C/C++ and "-ei" for Watcom C/C++ (v11). + */ +/* Enable enums always int in CodeWarrior (for MPW use "-enum int") */ +#ifdef __MWERKS__ +#pragma enumsalwaysint on +#endif + +typedef enum { + DUMMY_ENUM_VALUE +} SDL_DUMMY_ENUM; + +#if !defined(__NDS__) && !defined(__ROCKBOX__) +SDL_COMPILE_TIME_ASSERT(enum, sizeof(SDL_DUMMY_ENUM) == sizeof(int)); +#endif +/*@}*/ + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +#ifdef HAVE_MALLOC +#define SDL_malloc malloc +#else +extern DECLSPEC void * SDLCALL SDL_malloc(size_t size); +#endif + +#ifdef HAVE_CALLOC +#define SDL_calloc calloc +#else +extern DECLSPEC void * SDLCALL SDL_calloc(size_t nmemb, size_t size); +#endif + +#ifdef HAVE_REALLOC +#define SDL_realloc realloc +#else +extern DECLSPEC void * SDLCALL SDL_realloc(void *mem, size_t size); +#endif + +#ifdef HAVE_FREE +#define SDL_free free +#else +extern DECLSPEC void SDLCALL SDL_free(void *mem); +#endif + +#if defined(HAVE_ALLOCA) && !defined(alloca) +# if defined(HAVE_ALLOCA_H) +# include +# elif defined(__GNUC__) +# define alloca __builtin_alloca +# elif defined(_MSC_VER) +# include +# define alloca _alloca +# elif defined(__WATCOMC__) +# include +# elif defined(__BORLANDC__) +# include +# elif defined(__DMC__) +# include +# elif defined(__AIX__) + #pragma alloca +# elif defined(__MRC__) + void *alloca (unsigned); +# else + char *alloca (); +# endif +#endif +#ifdef HAVE_ALLOCA +#define SDL_stack_alloc(type, count) (type*)alloca(sizeof(type)*(count)) +#define SDL_stack_free(data) +#else +#define SDL_stack_alloc(type, count) (type*)SDL_malloc(sizeof(type)*(count)) +#define SDL_stack_free(data) SDL_free(data) +#endif + +#ifdef HAVE_GETENV +#define SDL_getenv getenv +#else +extern DECLSPEC char * SDLCALL SDL_getenv(const char *name); +#endif + +#ifdef HAVE_PUTENV +#define SDL_putenv putenv +#else +extern DECLSPEC int SDLCALL SDL_putenv(const char *variable); +#endif + +#ifdef HAVE_QSORT +#define SDL_qsort qsort +#else +extern DECLSPEC void SDLCALL SDL_qsort(void *base, size_t nmemb, size_t size, + int (*compare)(const void *, const void *)); +#endif + +#ifdef HAVE_ABS +#define SDL_abs abs +#else +#define SDL_abs(X) ((X) < 0 ? -(X) : (X)) +#endif + +#define SDL_min(x, y) (((x) < (y)) ? (x) : (y)) +#define SDL_max(x, y) (((x) > (y)) ? (x) : (y)) + +#ifdef HAVE_CTYPE_H +#define SDL_isdigit(X) isdigit(X) +#define SDL_isspace(X) isspace(X) +#define SDL_toupper(X) toupper(X) +#define SDL_tolower(X) tolower(X) +#else +#define SDL_isdigit(X) (((X) >= '0') && ((X) <= '9')) +#define SDL_isspace(X) (((X) == ' ') || ((X) == '\t') || ((X) == '\r') || ((X) == '\n')) +#define SDL_toupper(X) (((X) >= 'a') && ((X) <= 'z') ? ('A'+((X)-'a')) : (X)) +#define SDL_tolower(X) (((X) >= 'A') && ((X) <= 'Z') ? ('a'+((X)-'A')) : (X)) +#endif + +#ifdef HAVE_MEMSET +#define SDL_memset memset +#else +extern DECLSPEC void * SDLCALL SDL_memset(void *dst, int c, size_t len); +#endif + +#if defined(__GNUC__) && defined(i386) +#define SDL_memset4(dst, val, len) \ +do { \ + int u0, u1, u2; \ + __asm__ __volatile__ ( \ + "cld\n\t" \ + "rep ; stosl\n\t" \ + : "=&D" (u0), "=&a" (u1), "=&c" (u2) \ + : "0" (dst), "1" (val), "2" (SDL_static_cast(Uint32, len)) \ + : "memory" ); \ +} while(0) +#endif +#ifndef SDL_memset4 +#define SDL_memset4(dst, val, len) \ +do { \ + unsigned _count = (len); \ + unsigned _n = (_count + 3) / 4; \ + Uint32 *_p = SDL_static_cast(Uint32 *, dst); \ + Uint32 _val = (val); \ + if (len == 0) break; \ + switch (_count % 4) { \ + case 0: do { *_p++ = _val; \ + case 3: *_p++ = _val; \ + case 2: *_p++ = _val; \ + case 1: *_p++ = _val; \ + } while ( --_n ); \ + } \ +} while(0) +#endif + +/* We can count on memcpy existing on Mac OS X and being well-tuned. */ +#if defined(__MACH__) && defined(__APPLE__) +#define SDL_memcpy(dst, src, len) memcpy(dst, src, len) +#elif defined(__GNUC__) && defined(i386) +#define SDL_memcpy(dst, src, len) \ +do { \ + int u0, u1, u2; \ + __asm__ __volatile__ ( \ + "cld\n\t" \ + "rep ; movsl\n\t" \ + "testb $2,%b4\n\t" \ + "je 1f\n\t" \ + "movsw\n" \ + "1:\ttestb $1,%b4\n\t" \ + "je 2f\n\t" \ + "movsb\n" \ + "2:" \ + : "=&c" (u0), "=&D" (u1), "=&S" (u2) \ + : "0" (SDL_static_cast(unsigned, len)/4), "q" (len), "1" (dst),"2" (src) \ + : "memory" ); \ +} while(0) +#endif +#ifndef SDL_memcpy +#ifdef HAVE_MEMCPY +#define SDL_memcpy memcpy +#elif defined(HAVE_BCOPY) +#define SDL_memcpy(d, s, n) bcopy((s), (d), (n)) +#else +extern DECLSPEC void * SDLCALL SDL_memcpy(void *dst, const void *src, size_t len); +#endif +#endif + +/* We can count on memcpy existing on Mac OS X and being well-tuned. */ +#if defined(__MACH__) && defined(__APPLE__) +#define SDL_memcpy4(dst, src, len) memcpy(dst, src, (len)*4) +#elif defined(__GNUC__) && defined(i386) +#define SDL_memcpy4(dst, src, len) \ +do { \ + int ecx, edi, esi; \ + __asm__ __volatile__ ( \ + "cld\n\t" \ + "rep ; movsl" \ + : "=&c" (ecx), "=&D" (edi), "=&S" (esi) \ + : "0" (SDL_static_cast(unsigned, len)), "1" (dst), "2" (src) \ + : "memory" ); \ +} while(0) +#endif +#ifndef SDL_memcpy4 +#define SDL_memcpy4(dst, src, len) SDL_memcpy(dst, src, (len) << 2) +#endif + +#if defined(__GNUC__) && defined(i386) +#define SDL_revcpy(dst, src, len) \ +do { \ + int u0, u1, u2; \ + char *dstp = SDL_static_cast(char *, dst); \ + char *srcp = SDL_static_cast(char *, src); \ + int n = (len); \ + if ( n >= 4 ) { \ + __asm__ __volatile__ ( \ + "std\n\t" \ + "rep ; movsl\n\t" \ + "cld\n\t" \ + : "=&c" (u0), "=&D" (u1), "=&S" (u2) \ + : "0" (n >> 2), \ + "1" (dstp+(n-4)), "2" (srcp+(n-4)) \ + : "memory" ); \ + } \ + switch (n & 3) { \ + case 3: dstp[2] = srcp[2]; \ + case 2: dstp[1] = srcp[1]; \ + case 1: dstp[0] = srcp[0]; \ + break; \ + default: \ + break; \ + } \ +} while(0) +#endif +#ifndef SDL_revcpy +extern DECLSPEC void * SDLCALL SDL_revcpy(void *dst, const void *src, size_t len); +#endif + +#ifdef HAVE_MEMMOVE +#define SDL_memmove memmove +#elif defined(HAVE_BCOPY) +#define SDL_memmove(d, s, n) bcopy((s), (d), (n)) +#else +#define SDL_memmove(dst, src, len) \ +do { \ + if ( dst < src ) { \ + SDL_memcpy(dst, src, len); \ + } else { \ + SDL_revcpy(dst, src, len); \ + } \ +} while(0) +#endif + +#ifdef HAVE_MEMCMP +#define SDL_memcmp memcmp +#else +extern DECLSPEC int SDLCALL SDL_memcmp(const void *s1, const void *s2, size_t len); +#endif + +#ifdef HAVE_STRLEN +#define SDL_strlen strlen +#else +extern DECLSPEC size_t SDLCALL SDL_strlen(const char *string); +#endif + +#ifdef HAVE_STRLCPY +#define SDL_strlcpy strlcpy +#else +extern DECLSPEC size_t SDLCALL SDL_strlcpy(char *dst, const char *src, size_t maxlen); +#endif + +#ifdef HAVE_STRLCAT +#define SDL_strlcat strlcat +#else +extern DECLSPEC size_t SDLCALL SDL_strlcat(char *dst, const char *src, size_t maxlen); +#endif + +#ifdef HAVE_STRDUP +#define SDL_strdup strdup +#else +extern DECLSPEC char * SDLCALL SDL_strdup(const char *string); +#endif + +#ifdef HAVE__STRREV +#define SDL_strrev _strrev +#else +extern DECLSPEC char * SDLCALL SDL_strrev(char *string); +#endif + +#ifdef HAVE__STRUPR +#define SDL_strupr _strupr +#else +extern DECLSPEC char * SDLCALL SDL_strupr(char *string); +#endif + +#ifdef HAVE__STRLWR +#define SDL_strlwr _strlwr +#else +extern DECLSPEC char * SDLCALL SDL_strlwr(char *string); +#endif + +#ifdef HAVE_STRCHR +#define SDL_strchr strchr +#elif defined(HAVE_INDEX) +#define SDL_strchr index +#else +extern DECLSPEC char * SDLCALL SDL_strchr(const char *string, int c); +#endif + +#ifdef HAVE_STRRCHR +#define SDL_strrchr strrchr +#elif defined(HAVE_RINDEX) +#define SDL_strrchr rindex +#else +extern DECLSPEC char * SDLCALL SDL_strrchr(const char *string, int c); +#endif + +#ifdef HAVE_STRSTR +#define SDL_strstr strstr +#else +extern DECLSPEC char * SDLCALL SDL_strstr(const char *haystack, const char *needle); +#endif + +#ifdef HAVE_ITOA +#define SDL_itoa itoa +#else +#define SDL_itoa(value, string, radix) SDL_ltoa((long)value, string, radix) +#endif + +#ifdef HAVE__LTOA +#define SDL_ltoa _ltoa +#else +extern DECLSPEC char * SDLCALL SDL_ltoa(long value, char *string, int radix); +#endif + +#ifdef HAVE__UITOA +#define SDL_uitoa _uitoa +#else +#define SDL_uitoa(value, string, radix) SDL_ultoa((long)value, string, radix) +#endif + +#ifdef HAVE__ULTOA +#define SDL_ultoa _ultoa +#else +extern DECLSPEC char * SDLCALL SDL_ultoa(unsigned long value, char *string, int radix); +#endif + +#ifdef HAVE_STRTOL +#define SDL_strtol strtol +#else +extern DECLSPEC long SDLCALL SDL_strtol(const char *string, char **endp, int base); +#endif + +#ifdef HAVE_STRTOUL +#define SDL_strtoul strtoul +#else +extern DECLSPEC unsigned long SDLCALL SDL_strtoul(const char *string, char **endp, int base); +#endif + +#ifdef SDL_HAS_64BIT_TYPE + +#ifdef HAVE__I64TOA +#define SDL_lltoa _i64toa +#else +extern DECLSPEC char* SDLCALL SDL_lltoa(Sint64 value, char *string, int radix); +#endif + +#ifdef HAVE__UI64TOA +#define SDL_ulltoa _ui64toa +#else +extern DECLSPEC char* SDLCALL SDL_ulltoa(Uint64 value, char *string, int radix); +#endif + +#ifdef HAVE_STRTOLL +#define SDL_strtoll strtoll +#else +extern DECLSPEC Sint64 SDLCALL SDL_strtoll(const char *string, char **endp, int base); +#endif + +#ifdef HAVE_STRTOULL +#define SDL_strtoull strtoull +#else +extern DECLSPEC Uint64 SDLCALL SDL_strtoull(const char *string, char **endp, int base); +#endif + +#endif /* SDL_HAS_64BIT_TYPE */ + +#ifdef HAVE_STRTOD +#define SDL_strtod strtod +#else +extern DECLSPEC double SDLCALL SDL_strtod(const char *string, char **endp); +#endif + +#ifdef HAVE_ATOI +#define SDL_atoi atoi +#else +#define SDL_atoi(X) SDL_strtol(X, NULL, 0) +#endif + +#ifdef HAVE_ATOF +#define SDL_atof atof +#else +#define SDL_atof(X) SDL_strtod(X, NULL) +#endif + +#ifdef HAVE_STRCMP +#define SDL_strcmp strcmp +#else +extern DECLSPEC int SDLCALL SDL_strcmp(const char *str1, const char *str2); +#endif + +#ifdef HAVE_STRNCMP +#define SDL_strncmp strncmp +#else +extern DECLSPEC int SDLCALL SDL_strncmp(const char *str1, const char *str2, size_t maxlen); +#endif + +#ifdef HAVE_STRCASECMP +#define SDL_strcasecmp strcasecmp +#elif defined(HAVE__STRICMP) +#define SDL_strcasecmp _stricmp +#else +extern DECLSPEC int SDLCALL SDL_strcasecmp(const char *str1, const char *str2); +#endif + +#ifdef HAVE_STRNCASECMP +#define SDL_strncasecmp strncasecmp +#elif defined(HAVE__STRNICMP) +#define SDL_strncasecmp _strnicmp +#else +extern DECLSPEC int SDLCALL SDL_strncasecmp(const char *str1, const char *str2, size_t maxlen); +#endif + +#ifdef HAVE_SSCANF +#define SDL_sscanf sscanf +#else +extern DECLSPEC int SDLCALL SDL_sscanf(const char *text, const char *fmt, ...); +#endif + +#ifdef HAVE_SNPRINTF +#define SDL_snprintf snprintf +#else +extern DECLSPEC int SDLCALL SDL_snprintf(char *text, size_t maxlen, const char *fmt, ...); +#endif + +#ifdef HAVE_VSNPRINTF +#define SDL_vsnprintf vsnprintf +#else +extern DECLSPEC int SDLCALL SDL_vsnprintf(char *text, size_t maxlen, const char *fmt, va_list ap); +#endif + +/** @name SDL_ICONV Error Codes + * The SDL implementation of iconv() returns these error codes + */ +/*@{*/ +#define SDL_ICONV_ERROR (size_t)-1 +#define SDL_ICONV_E2BIG (size_t)-2 +#define SDL_ICONV_EILSEQ (size_t)-3 +#define SDL_ICONV_EINVAL (size_t)-4 +/*@}*/ + +#if defined(HAVE_ICONV) && defined(HAVE_ICONV_H) +#define SDL_iconv_t iconv_t +#define SDL_iconv_open iconv_open +#define SDL_iconv_close iconv_close +#else +typedef struct _SDL_iconv_t *SDL_iconv_t; +extern DECLSPEC SDL_iconv_t SDLCALL SDL_iconv_open(const char *tocode, const char *fromcode); +extern DECLSPEC int SDLCALL SDL_iconv_close(SDL_iconv_t cd); +#endif +extern DECLSPEC size_t SDLCALL SDL_iconv(SDL_iconv_t cd, const char **inbuf, size_t *inbytesleft, char **outbuf, size_t *outbytesleft); +/** This function converts a string between encodings in one pass, returning a + * string that must be freed with SDL_free() or NULL on error. + */ +extern DECLSPEC char * SDLCALL SDL_iconv_string(const char *tocode, const char *fromcode, const char *inbuf, size_t inbytesleft); +#define SDL_iconv_utf8_locale(S) SDL_iconv_string("", "UTF-8", S, SDL_strlen(S)+1) +#define SDL_iconv_utf8_ucs2(S) (Uint16 *)SDL_iconv_string("UCS-2", "UTF-8", S, SDL_strlen(S)+1) +#define SDL_iconv_utf8_ucs4(S) (Uint32 *)SDL_iconv_string("UCS-4", "UTF-8", S, SDL_strlen(S)+1) + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_stdinc_h */ diff --git a/apps/plugins/sdl/include/SDL_syswm.h b/apps/plugins/sdl/include/SDL_syswm.h new file mode 100644 index 0000000..78433c6 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_syswm.h @@ -0,0 +1,226 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_syswm.h + * Include file for SDL custom system window manager hooks + */ + +#ifndef _SDL_syswm_h +#define _SDL_syswm_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" +#include "SDL_version.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @file SDL_syswm.h + * Your application has access to a special type of event 'SDL_SYSWMEVENT', + * which contains window-manager specific information and arrives whenever + * an unhandled window event occurs. This event is ignored by default, but + * you can enable it with SDL_EventState() + */ +#ifdef SDL_PROTOTYPES_ONLY +struct SDL_SysWMinfo; +typedef struct SDL_SysWMinfo SDL_SysWMinfo; +#else + +/* This is the structure for custom window manager events */ +#if defined(SDL_VIDEO_DRIVER_X11) +#if defined(__APPLE__) && defined(__MACH__) +/* conflicts with Quickdraw.h */ +#define Cursor X11Cursor +#endif + +#include +#include + +#if defined(__APPLE__) && defined(__MACH__) +/* matches the re-define above */ +#undef Cursor +#endif + +/** These are the various supported subsystems under UNIX */ +typedef enum { + SDL_SYSWM_X11 +} SDL_SYSWM_TYPE; + +/** The UNIX custom event structure */ +struct SDL_SysWMmsg { + SDL_version version; + SDL_SYSWM_TYPE subsystem; + union { + XEvent xevent; + } event; +}; + +/** The UNIX custom window manager information structure. + * When this structure is returned, it holds information about which + * low level system it is using, and will be one of SDL_SYSWM_TYPE. + */ +typedef struct SDL_SysWMinfo { + SDL_version version; + SDL_SYSWM_TYPE subsystem; + union { + struct { + Display *display; /**< The X11 display */ + Window window; /**< The X11 display window */ + /** These locking functions should be called around + * any X11 functions using the display variable, + * but not the gfxdisplay variable. + * They lock the event thread, so should not be + * called around event functions or from event filters. + */ + /*@{*/ + void (*lock_func)(void); + void (*unlock_func)(void); + /*@}*/ + + /** @name Introduced in SDL 1.0.2 */ + /*@{*/ + Window fswindow; /**< The X11 fullscreen window */ + Window wmwindow; /**< The X11 managed input window */ + /*@}*/ + + /** @name Introduced in SDL 1.2.12 */ + /*@{*/ + Display *gfxdisplay; /**< The X11 display to which rendering is done */ + /*@}*/ + } x11; + } info; +} SDL_SysWMinfo; + +#elif defined(SDL_VIDEO_DRIVER_NANOX) +#include + +/** The generic custom event structure */ +struct SDL_SysWMmsg { + SDL_version version; + int data; +}; + +/** The windows custom window manager information structure */ +typedef struct SDL_SysWMinfo { + SDL_version version ; + GR_WINDOW_ID window ; /* The display window */ +} SDL_SysWMinfo; + +#elif defined(SDL_VIDEO_DRIVER_WINDIB) || defined(SDL_VIDEO_DRIVER_DDRAW) || defined(SDL_VIDEO_DRIVER_GAPI) +#define WIN32_LEAN_AND_MEAN +#include + +/** The windows custom event structure */ +struct SDL_SysWMmsg { + SDL_version version; + HWND hwnd; /**< The window for the message */ + UINT msg; /**< The type of message */ + WPARAM wParam; /**< WORD message parameter */ + LPARAM lParam; /**< LONG message parameter */ +}; + +/** The windows custom window manager information structure */ +typedef struct SDL_SysWMinfo { + SDL_version version; + HWND window; /**< The Win32 display window */ + HGLRC hglrc; /**< The OpenGL context, if any */ +} SDL_SysWMinfo; + +#elif defined(SDL_VIDEO_DRIVER_RISCOS) + +/** RISC OS custom event structure */ +struct SDL_SysWMmsg { + SDL_version version; + int eventCode; /**< The window for the message */ + int pollBlock[64]; +}; + +/** The RISC OS custom window manager information structure */ +typedef struct SDL_SysWMinfo { + SDL_version version; + int wimpVersion; /**< Wimp version running under */ + int taskHandle; /**< The RISC OS task handle */ + int window; /**< The RISC OS display window */ +} SDL_SysWMinfo; + +#elif defined(SDL_VIDEO_DRIVER_PHOTON) +#include +#include + +/** The QNX custom event structure */ +struct SDL_SysWMmsg { + SDL_version version; + int data; +}; + +/** The QNX custom window manager information structure */ +typedef struct SDL_SysWMinfo { + SDL_version version; + int data; +} SDL_SysWMinfo; + +#else + +/** The generic custom event structure */ +struct SDL_SysWMmsg { + SDL_version version; + int data; +}; + +/** The generic custom window manager information structure */ +typedef struct SDL_SysWMinfo { + SDL_version version; + int data; +} SDL_SysWMinfo; + +#endif /* video driver type */ + +#endif /* SDL_PROTOTYPES_ONLY */ + +/* Function prototypes */ +/** + * This function gives you custom hooks into the window manager information. + * It fills the structure pointed to by 'info' with custom information and + * returns 0 if the function is not implemented, 1 if the function is + * implemented and no error occurred, and -1 if the version member of + * the 'info' structure is not filled in or not supported. + * + * You typically use this function like this: + * @code + * SDL_SysWMinfo info; + * SDL_VERSION(&info.version); + * if ( SDL_GetWMInfo(&info) ) { ... } + * @endcode + */ +extern DECLSPEC int SDLCALL SDL_GetWMInfo(SDL_SysWMinfo *info); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_syswm_h */ diff --git a/apps/plugins/sdl/include/SDL_thread.h b/apps/plugins/sdl/include/SDL_thread.h new file mode 100644 index 0000000..9ebe00e --- /dev/null +++ b/apps/plugins/sdl/include/SDL_thread.h @@ -0,0 +1,115 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_thread_h +#define _SDL_thread_h + +/** @file SDL_thread.h + * Header for the SDL thread management routines + * + * @note These are independent of the other SDL routines. + */ + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +/* Thread synchronization primitives */ +#include "SDL_mutex.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** The SDL thread structure, defined in SDL_thread.c */ +struct SDL_Thread; +typedef struct SDL_Thread SDL_Thread; + +/** Create a thread */ +#if ((defined(__WIN32__) && !defined(HAVE_LIBC)) || defined(__OS2__)) && !defined(__SYMBIAN32__) +/** + * We compile SDL into a DLL on OS/2. This means, that it's the DLL which + * creates a new thread for the calling process with the SDL_CreateThread() + * API. There is a problem with this, that only the RTL of the SDL.DLL will + * be initialized for those threads, and not the RTL of the calling application! + * To solve this, we make a little hack here. + * We'll always use the caller's _beginthread() and _endthread() APIs to + * start a new thread. This way, if it's the SDL.DLL which uses this API, + * then the RTL of SDL.DLL will be used to create the new thread, and if it's + * the application, then the RTL of the application will be used. + * So, in short: + * Always use the _beginthread() and _endthread() of the calling runtime library! + */ +#define SDL_PASSED_BEGINTHREAD_ENDTHREAD +#ifndef _WIN32_WCE +#include /* This has _beginthread() and _endthread() defined! */ +#endif + +#ifdef __OS2__ +typedef int (*pfnSDL_CurrentBeginThread)(void (*func)(void *), void *, unsigned, void *arg); +typedef void (*pfnSDL_CurrentEndThread)(void); +#else +typedef uintptr_t (__cdecl *pfnSDL_CurrentBeginThread) (void *, unsigned, + unsigned (__stdcall *func)(void *), void *arg, + unsigned, unsigned *threadID); +typedef void (__cdecl *pfnSDL_CurrentEndThread)(unsigned code); +#endif + +extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data, pfnSDL_CurrentBeginThread pfnBeginThread, pfnSDL_CurrentEndThread pfnEndThread); + +#ifdef __OS2__ +#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthread, _endthread) +#elif defined(_WIN32_WCE) +#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, NULL, NULL) +#else +#define SDL_CreateThread(fn, data) SDL_CreateThread(fn, data, _beginthreadex, _endthreadex) +#endif +#else +extern DECLSPEC SDL_Thread * SDLCALL SDL_CreateThread(int (SDLCALL *fn)(void *), void *data); +#endif + +/** Get the 32-bit thread identifier for the current thread */ +extern DECLSPEC Uint32 SDLCALL SDL_ThreadID(void); + +/** Get the 32-bit thread identifier for the specified thread, + * equivalent to SDL_ThreadID() if the specified thread is NULL. + */ +extern DECLSPEC Uint32 SDLCALL SDL_GetThreadID(SDL_Thread *thread); + +/** Wait for a thread to finish. + * The return code for the thread function is placed in the area + * pointed to by 'status', if 'status' is not NULL. + */ +extern DECLSPEC void SDLCALL SDL_WaitThread(SDL_Thread *thread, int *status); + +/** Forcefully kill a thread without worrying about its state */ +extern DECLSPEC void SDLCALL SDL_KillThread(SDL_Thread *thread); + + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_thread_h */ diff --git a/apps/plugins/sdl/include/SDL_timer.h b/apps/plugins/sdl/include/SDL_timer.h new file mode 100644 index 0000000..d764d5f --- /dev/null +++ b/apps/plugins/sdl/include/SDL_timer.h @@ -0,0 +1,125 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +#ifndef _SDL_timer_h +#define _SDL_timer_h + +/** @file SDL_timer.h + * Header for the SDL time management routines + */ + +#include "SDL_stdinc.h" +#include "SDL_error.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** This is the OS scheduler timeslice, in milliseconds */ +#define SDL_TIMESLICE 10 + +/** This is the maximum resolution of the SDL timer on all platforms */ +#define TIMER_RESOLUTION 10 /**< Experimentally determined */ + +/** + * Get the number of milliseconds since the SDL library initialization. + * Note that this value wraps if the program runs for more than ~49 days. + */ +extern DECLSPEC Uint32 SDLCALL SDL_GetTicks(void); + +/** Wait a specified number of milliseconds before returning */ +extern DECLSPEC void SDLCALL SDL_Delay(Uint32 ms); + +/** Function prototype for the timer callback function */ +typedef Uint32 (SDLCALL *SDL_TimerCallback)(Uint32 interval); + +/** + * Set a callback to run after the specified number of milliseconds has + * elapsed. The callback function is passed the current timer interval + * and returns the next timer interval. If the returned value is the + * same as the one passed in, the periodic alarm continues, otherwise a + * new alarm is scheduled. If the callback returns 0, the periodic alarm + * is cancelled. + * + * To cancel a currently running timer, call SDL_SetTimer(0, NULL); + * + * The timer callback function may run in a different thread than your + * main code, and so shouldn't call any functions from within itself. + * + * The maximum resolution of this timer is 10 ms, which means that if + * you request a 16 ms timer, your callback will run approximately 20 ms + * later on an unloaded system. If you wanted to set a flag signaling + * a frame update at 30 frames per second (every 33 ms), you might set a + * timer for 30 ms: + * @code SDL_SetTimer((33/10)*10, flag_update); @endcode + * + * If you use this function, you need to pass SDL_INIT_TIMER to SDL_Init(). + * + * Under UNIX, you should not use raise or use SIGALRM and this function + * in the same program, as it is implemented using setitimer(). You also + * should not use this function in multi-threaded applications as signals + * to multi-threaded apps have undefined behavior in some implementations. + * + * This function returns 0 if successful, or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_SetTimer(Uint32 interval, SDL_TimerCallback callback); + +/** @name New timer API + * New timer API, supports multiple timers + * Written by Stephane Peter + */ +/*@{*/ + +/** + * Function prototype for the new timer callback function. + * The callback function is passed the current timer interval and returns + * the next timer interval. If the returned value is the same as the one + * passed in, the periodic alarm continues, otherwise a new alarm is + * scheduled. If the callback returns 0, the periodic alarm is cancelled. + */ +typedef Uint32 (SDLCALL *SDL_NewTimerCallback)(Uint32 interval, void *param); + +/** Definition of the timer ID type */ +typedef struct _SDL_TimerID *SDL_TimerID; + +/** Add a new timer to the pool of timers already running. + * Returns a timer ID, or NULL when an error occurs. + */ +extern DECLSPEC SDL_TimerID SDLCALL SDL_AddTimer(Uint32 interval, SDL_NewTimerCallback callback, void *param); + +/** + * Remove one of the multiple timers knowing its ID. + * Returns a boolean value indicating success. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_RemoveTimer(SDL_TimerID t); + +/*@}*/ + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_timer_h */ diff --git a/apps/plugins/sdl/include/SDL_types.h b/apps/plugins/sdl/include/SDL_types.h new file mode 100644 index 0000000..79d8b28 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_types.h @@ -0,0 +1,28 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_types.h + * @deprecated Use SDL_stdinc.h instead. + */ + +/* DEPRECATED */ +#include "SDL_stdinc.h" diff --git a/apps/plugins/sdl/include/SDL_version.h b/apps/plugins/sdl/include/SDL_version.h new file mode 100644 index 0000000..fdc17c6 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_version.h @@ -0,0 +1,91 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_version.h + * This header defines the current SDL version + */ + +#ifndef _SDL_version_h +#define _SDL_version_h + +#include "SDL_stdinc.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @name Version Number + * Printable format: "%d.%d.%d", MAJOR, MINOR, PATCHLEVEL + */ +/*@{*/ +#define SDL_MAJOR_VERSION 1 +#define SDL_MINOR_VERSION 2 +#define SDL_PATCHLEVEL 15 +/*@}*/ + +typedef struct SDL_version { + Uint8 major; + Uint8 minor; + Uint8 patch; +} SDL_version; + +/** + * This macro can be used to fill a version structure with the compile-time + * version of the SDL library. + */ +#define SDL_VERSION(X) \ +{ \ + (X)->major = SDL_MAJOR_VERSION; \ + (X)->minor = SDL_MINOR_VERSION; \ + (X)->patch = SDL_PATCHLEVEL; \ +} + +/** This macro turns the version numbers into a numeric value: + * (1,2,3) -> (1203) + * This assumes that there will never be more than 100 patchlevels + */ +#define SDL_VERSIONNUM(X, Y, Z) \ + ((X)*1000 + (Y)*100 + (Z)) + +/** This is the version number macro for the current SDL version */ +#define SDL_COMPILEDVERSION \ + SDL_VERSIONNUM(SDL_MAJOR_VERSION, SDL_MINOR_VERSION, SDL_PATCHLEVEL) + +/** This macro will evaluate to true if compiled with SDL at least X.Y.Z */ +#define SDL_VERSION_ATLEAST(X, Y, Z) \ + (SDL_COMPILEDVERSION >= SDL_VERSIONNUM(X, Y, Z)) + +/** This function gets the version of the dynamically linked SDL library. + * it should NOT be used to fill a version structure, instead you should + * use the SDL_Version() macro. + */ +extern DECLSPEC const SDL_version * SDLCALL SDL_Linked_Version(void); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_version_h */ diff --git a/apps/plugins/sdl/include/SDL_video.h b/apps/plugins/sdl/include/SDL_video.h new file mode 100644 index 0000000..f9c4e07 --- /dev/null +++ b/apps/plugins/sdl/include/SDL_video.h @@ -0,0 +1,951 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Lesser General Public + License as published by the Free Software Foundation; either + version 2.1 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Lesser General Public License for more details. + + You should have received a copy of the GNU Lesser General Public + License along with this library; if not, write to the Free Software + Foundation, Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** @file SDL_video.h + * Header file for access to the SDL raw framebuffer window + */ + +#ifndef _SDL_video_h +#define _SDL_video_h + +#include "SDL_stdinc.h" +#include "SDL_error.h" +#include "SDL_rwops.h" + +#include "begin_code.h" +/* Set up for C function definitions, even when using C++ */ +#ifdef __cplusplus +extern "C" { +#endif + +/** @name Transparency definitions + * These define alpha as the opacity of a surface + */ +/*@{*/ +#define SDL_ALPHA_OPAQUE 255 +#define SDL_ALPHA_TRANSPARENT 0 +/*@}*/ + +/** @name Useful data types */ +/*@{*/ +typedef struct SDL_Rect { + Sint16 x, y; + Uint16 w, h; +} SDL_Rect; + +typedef struct SDL_Color { + Uint8 r; + Uint8 g; + Uint8 b; + Uint8 unused; +} SDL_Color; +#define SDL_Colour SDL_Color + +typedef struct SDL_Palette { + int ncolors; + SDL_Color *colors; +} SDL_Palette; +/*@}*/ + +/** Everything in the pixel format structure is read-only */ +typedef struct SDL_PixelFormat { + SDL_Palette *palette; + Uint8 BitsPerPixel; + Uint8 BytesPerPixel; + Uint8 Rloss; + Uint8 Gloss; + Uint8 Bloss; + Uint8 Aloss; + Uint8 Rshift; + Uint8 Gshift; + Uint8 Bshift; + Uint8 Ashift; + Uint32 Rmask; + Uint32 Gmask; + Uint32 Bmask; + Uint32 Amask; + + /** RGB color key information */ + Uint32 colorkey; + /** Alpha value information (per-surface alpha) */ + Uint8 alpha; +} SDL_PixelFormat; + +/** This structure should be treated as read-only, except for 'pixels', + * which, if not NULL, contains the raw pixel data for the surface. + */ +typedef struct SDL_Surface { + Uint32 flags; /**< Read-only */ + SDL_PixelFormat *format; /**< Read-only */ + int w, h; /**< Read-only */ + Uint16 pitch; /**< Read-only */ + void *pixels; /**< Read-write */ + int offset; /**< Private */ + + /** Hardware-specific surface info */ + struct private_hwdata *hwdata; + + /** clipping information */ + SDL_Rect clip_rect; /**< Read-only */ + Uint32 unused1; /**< for binary compatibility */ + + /** Allow recursive locks */ + Uint32 locked; /**< Private */ + + /** info for fast blit mapping to other surfaces */ + struct SDL_BlitMap *map; /**< Private */ + + /** format version, bumped at every change to invalidate blit maps */ + unsigned int format_version; /**< Private */ + + /** Reference count -- used when freeing surface */ + int refcount; /**< Read-mostly */ +} SDL_Surface; + +/** @name SDL_Surface Flags + * These are the currently supported flags for the SDL_surface + */ +/*@{*/ + +/** Available for SDL_CreateRGBSurface() or SDL_SetVideoMode() */ +/*@{*/ +#define SDL_SWSURFACE 0x00000000 /**< Surface is in system memory */ +#define SDL_HWSURFACE 0x00000001 /**< Surface is in video memory */ +#define SDL_ASYNCBLIT 0x00000004 /**< Use asynchronous blits if possible */ +/*@}*/ + +/** Available for SDL_SetVideoMode() */ +/*@{*/ +#define SDL_ANYFORMAT 0x10000000 /**< Allow any video depth/pixel-format */ +#define SDL_HWPALETTE 0x20000000 /**< Surface has exclusive palette */ +#define SDL_DOUBLEBUF 0x40000000 /**< Set up double-buffered video mode */ +#define SDL_FULLSCREEN 0x80000000 /**< Surface is a full screen display */ +#define SDL_OPENGL 0x00000002 /**< Create an OpenGL rendering context */ +#define SDL_OPENGLBLIT 0x0000000A /**< Create an OpenGL rendering context and use it for blitting */ +#define SDL_RESIZABLE 0x00000010 /**< This video mode may be resized */ +#define SDL_NOFRAME 0x00000020 /**< No window caption or edge frame */ +/*@}*/ + +/** Used internally (read-only) */ +/*@{*/ +#define SDL_HWACCEL 0x00000100 /**< Blit uses hardware acceleration */ +#define SDL_SRCCOLORKEY 0x00001000 /**< Blit uses a source color key */ +#define SDL_RLEACCELOK 0x00002000 /**< Private flag */ +#define SDL_RLEACCEL 0x00004000 /**< Surface is RLE encoded */ +#define SDL_SRCALPHA 0x00010000 /**< Blit uses source alpha blending */ +#define SDL_PREALLOC 0x01000000 /**< Surface uses preallocated memory */ +/*@}*/ + +/*@}*/ + +/** Evaluates to true if the surface needs to be locked before access */ +#define SDL_MUSTLOCK(surface) \ + (surface->offset || \ + ((surface->flags & (SDL_HWSURFACE|SDL_ASYNCBLIT|SDL_RLEACCEL)) != 0)) + +/** typedef for private surface blitting functions */ +typedef int (*SDL_blit)(struct SDL_Surface *src, SDL_Rect *srcrect, + struct SDL_Surface *dst, SDL_Rect *dstrect); + + +/** Useful for determining the video hardware capabilities */ +typedef struct SDL_VideoInfo { + Uint32 hw_available :1; /**< Flag: Can you create hardware surfaces? */ + Uint32 wm_available :1; /**< Flag: Can you talk to a window manager? */ + Uint32 UnusedBits1 :6; + Uint32 UnusedBits2 :1; + Uint32 blit_hw :1; /**< Flag: Accelerated blits HW --> HW */ + Uint32 blit_hw_CC :1; /**< Flag: Accelerated blits with Colorkey */ + Uint32 blit_hw_A :1; /**< Flag: Accelerated blits with Alpha */ + Uint32 blit_sw :1; /**< Flag: Accelerated blits SW --> HW */ + Uint32 blit_sw_CC :1; /**< Flag: Accelerated blits with Colorkey */ + Uint32 blit_sw_A :1; /**< Flag: Accelerated blits with Alpha */ + Uint32 blit_fill :1; /**< Flag: Accelerated color fill */ + Uint32 UnusedBits3 :16; + Uint32 video_mem; /**< The total amount of video memory (in K) */ + SDL_PixelFormat *vfmt; /**< Value: The format of the video surface */ + int current_w; /**< Value: The current video mode width */ + int current_h; /**< Value: The current video mode height */ +} SDL_VideoInfo; + + +/** @name Overlay Formats + * The most common video overlay formats. + * For an explanation of these pixel formats, see: + * http://www.webartz.com/fourcc/indexyuv.htm + * + * For information on the relationship between color spaces, see: + * http://www.neuro.sfc.keio.ac.jp/~aly/polygon/info/color-space-faq.html + */ +/*@{*/ +#define SDL_YV12_OVERLAY 0x32315659 /**< Planar mode: Y + V + U (3 planes) */ +#define SDL_IYUV_OVERLAY 0x56555949 /**< Planar mode: Y + U + V (3 planes) */ +#define SDL_YUY2_OVERLAY 0x32595559 /**< Packed mode: Y0+U0+Y1+V0 (1 plane) */ +#define SDL_UYVY_OVERLAY 0x59565955 /**< Packed mode: U0+Y0+V0+Y1 (1 plane) */ +#define SDL_YVYU_OVERLAY 0x55595659 /**< Packed mode: Y0+V0+Y1+U0 (1 plane) */ +/*@}*/ + +/** The YUV hardware video overlay */ +typedef struct SDL_Overlay { + Uint32 format; /**< Read-only */ + int w, h; /**< Read-only */ + int planes; /**< Read-only */ + Uint16 *pitches; /**< Read-only */ + Uint8 **pixels; /**< Read-write */ + + /** @name Hardware-specific surface info */ + /*@{*/ + struct private_yuvhwfuncs *hwfuncs; + struct private_yuvhwdata *hwdata; + /*@{*/ + + /** @name Special flags */ + /*@{*/ + Uint32 hw_overlay :1; /**< Flag: This overlay hardware accelerated? */ + Uint32 UnusedBits :31; + /*@}*/ +} SDL_Overlay; + + +/** Public enumeration for setting the OpenGL window attributes. */ +typedef enum { + SDL_GL_RED_SIZE, + SDL_GL_GREEN_SIZE, + SDL_GL_BLUE_SIZE, + SDL_GL_ALPHA_SIZE, + SDL_GL_BUFFER_SIZE, + SDL_GL_DOUBLEBUFFER, + SDL_GL_DEPTH_SIZE, + SDL_GL_STENCIL_SIZE, + SDL_GL_ACCUM_RED_SIZE, + SDL_GL_ACCUM_GREEN_SIZE, + SDL_GL_ACCUM_BLUE_SIZE, + SDL_GL_ACCUM_ALPHA_SIZE, + SDL_GL_STEREO, + SDL_GL_MULTISAMPLEBUFFERS, + SDL_GL_MULTISAMPLESAMPLES, + SDL_GL_ACCELERATED_VISUAL, + SDL_GL_SWAP_CONTROL +} SDL_GLattr; + +/** @name flags for SDL_SetPalette() */ +/*@{*/ +#define SDL_LOGPAL 0x01 +#define SDL_PHYSPAL 0x02 +/*@}*/ + +/* Function prototypes */ + +/** + * @name Video Init and Quit + * These functions are used internally, and should not be used unless you + * have a specific need to specify the video driver you want to use. + * You should normally use SDL_Init() or SDL_InitSubSystem(). + */ +/*@{*/ +/** + * Initializes the video subsystem. Sets up a connection + * to the window manager, etc, and determines the current video mode and + * pixel format, but does not initialize a window or graphics mode. + * Note that event handling is activated by this routine. + * + * If you use both sound and video in your application, you need to call + * SDL_Init() before opening the sound device, otherwise under Win32 DirectX, + * you won't be able to set full-screen display modes. + */ +extern DECLSPEC int SDLCALL SDL_VideoInit(const char *driver_name, Uint32 flags); +extern DECLSPEC void SDLCALL SDL_VideoQuit(void); +/*@}*/ + +/** + * This function fills the given character buffer with the name of the + * video driver, and returns a pointer to it if the video driver has + * been initialized. It returns NULL if no driver has been initialized. + */ +extern DECLSPEC char * SDLCALL SDL_VideoDriverName(char *namebuf, int maxlen); + +/** + * This function returns a pointer to the current display surface. + * If SDL is doing format conversion on the display surface, this + * function returns the publicly visible surface, not the real video + * surface. + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_GetVideoSurface(void); + +/** + * This function returns a read-only pointer to information about the + * video hardware. If this is called before SDL_SetVideoMode(), the 'vfmt' + * member of the returned structure will contain the pixel format of the + * "best" video mode. + */ +extern DECLSPEC const SDL_VideoInfo * SDLCALL SDL_GetVideoInfo(void); + +/** + * Check to see if a particular video mode is supported. + * It returns 0 if the requested mode is not supported under any bit depth, + * or returns the bits-per-pixel of the closest available mode with the + * given width and height. If this bits-per-pixel is different from the + * one used when setting the video mode, SDL_SetVideoMode() will succeed, + * but will emulate the requested bits-per-pixel with a shadow surface. + * + * The arguments to SDL_VideoModeOK() are the same ones you would pass to + * SDL_SetVideoMode() + */ +extern DECLSPEC int SDLCALL SDL_VideoModeOK(int width, int height, int bpp, Uint32 flags); + +/** + * Return a pointer to an array of available screen dimensions for the + * given format and video flags, sorted largest to smallest. Returns + * NULL if there are no dimensions available for a particular format, + * or (SDL_Rect **)-1 if any dimension is okay for the given format. + * + * If 'format' is NULL, the mode list will be for the format given + * by SDL_GetVideoInfo()->vfmt + */ +extern DECLSPEC SDL_Rect ** SDLCALL SDL_ListModes(SDL_PixelFormat *format, Uint32 flags); + +/** + * Set up a video mode with the specified width, height and bits-per-pixel. + * + * If 'bpp' is 0, it is treated as the current display bits per pixel. + * + * If SDL_ANYFORMAT is set in 'flags', the SDL library will try to set the + * requested bits-per-pixel, but will return whatever video pixel format is + * available. The default is to emulate the requested pixel format if it + * is not natively available. + * + * If SDL_HWSURFACE is set in 'flags', the video surface will be placed in + * video memory, if possible, and you may have to call SDL_LockSurface() + * in order to access the raw framebuffer. Otherwise, the video surface + * will be created in system memory. + * + * If SDL_ASYNCBLIT is set in 'flags', SDL will try to perform rectangle + * updates asynchronously, but you must always lock before accessing pixels. + * SDL will wait for updates to complete before returning from the lock. + * + * If SDL_HWPALETTE is set in 'flags', the SDL library will guarantee + * that the colors set by SDL_SetColors() will be the colors you get. + * Otherwise, in 8-bit mode, SDL_SetColors() may not be able to set all + * of the colors exactly the way they are requested, and you should look + * at the video surface structure to determine the actual palette. + * If SDL cannot guarantee that the colors you request can be set, + * i.e. if the colormap is shared, then the video surface may be created + * under emulation in system memory, overriding the SDL_HWSURFACE flag. + * + * If SDL_FULLSCREEN is set in 'flags', the SDL library will try to set + * a fullscreen video mode. The default is to create a windowed mode + * if the current graphics system has a window manager. + * If the SDL library is able to set a fullscreen video mode, this flag + * will be set in the surface that is returned. + * + * If SDL_DOUBLEBUF is set in 'flags', the SDL library will try to set up + * two surfaces in video memory and swap between them when you call + * SDL_Flip(). This is usually slower than the normal single-buffering + * scheme, but prevents "tearing" artifacts caused by modifying video + * memory while the monitor is refreshing. It should only be used by + * applications that redraw the entire screen on every update. + * + * If SDL_RESIZABLE is set in 'flags', the SDL library will allow the + * window manager, if any, to resize the window at runtime. When this + * occurs, SDL will send a SDL_VIDEORESIZE event to you application, + * and you must respond to the event by re-calling SDL_SetVideoMode() + * with the requested size (or another size that suits the application). + * + * If SDL_NOFRAME is set in 'flags', the SDL library will create a window + * without any title bar or frame decoration. Fullscreen video modes have + * this flag set automatically. + * + * This function returns the video framebuffer surface, or NULL if it fails. + * + * If you rely on functionality provided by certain video flags, check the + * flags of the returned surface to make sure that functionality is available. + * SDL will fall back to reduced functionality if the exact flags you wanted + * are not available. + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_SetVideoMode + (int width, int height, int bpp, Uint32 flags); + +/** @name SDL_Update Functions + * These functions should not be called while 'screen' is locked. + */ +/*@{*/ +/** + * Makes sure the given list of rectangles is updated on the given screen. + */ +extern DECLSPEC void SDLCALL SDL_UpdateRects + (SDL_Surface *screen, int numrects, SDL_Rect *rects); +/** + * If 'x', 'y', 'w' and 'h' are all 0, SDL_UpdateRect will update the entire + * screen. + */ +extern DECLSPEC void SDLCALL SDL_UpdateRect + (SDL_Surface *screen, Sint32 x, Sint32 y, Uint32 w, Uint32 h); +/*@}*/ + +/** + * On hardware that supports double-buffering, this function sets up a flip + * and returns. The hardware will wait for vertical retrace, and then swap + * video buffers before the next video surface blit or lock will return. + * On hardware that doesn not support double-buffering, this is equivalent + * to calling SDL_UpdateRect(screen, 0, 0, 0, 0); + * The SDL_DOUBLEBUF flag must have been passed to SDL_SetVideoMode() when + * setting the video mode for this function to perform hardware flipping. + * This function returns 0 if successful, or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_Flip(SDL_Surface *screen); + +/** + * Set the gamma correction for each of the color channels. + * The gamma values range (approximately) between 0.1 and 10.0 + * + * If this function isn't supported directly by the hardware, it will + * be emulated using gamma ramps, if available. If successful, this + * function returns 0, otherwise it returns -1. + */ +extern DECLSPEC int SDLCALL SDL_SetGamma(float red, float green, float blue); + +/** + * Set the gamma translation table for the red, green, and blue channels + * of the video hardware. Each table is an array of 256 16-bit quantities, + * representing a mapping between the input and output for that channel. + * The input is the index into the array, and the output is the 16-bit + * gamma value at that index, scaled to the output color precision. + * + * You may pass NULL for any of the channels to leave it unchanged. + * If the call succeeds, it will return 0. If the display driver or + * hardware does not support gamma translation, or otherwise fails, + * this function will return -1. + */ +extern DECLSPEC int SDLCALL SDL_SetGammaRamp(const Uint16 *red, const Uint16 *green, const Uint16 *blue); + +/** + * Retrieve the current values of the gamma translation tables. + * + * You must pass in valid pointers to arrays of 256 16-bit quantities. + * Any of the pointers may be NULL to ignore that channel. + * If the call succeeds, it will return 0. If the display driver or + * hardware does not support gamma translation, or otherwise fails, + * this function will return -1. + */ +extern DECLSPEC int SDLCALL SDL_GetGammaRamp(Uint16 *red, Uint16 *green, Uint16 *blue); + +/** + * Sets a portion of the colormap for the given 8-bit surface. If 'surface' + * is not a palettized surface, this function does nothing, returning 0. + * If all of the colors were set as passed to SDL_SetColors(), it will + * return 1. If not all the color entries were set exactly as given, + * it will return 0, and you should look at the surface palette to + * determine the actual color palette. + * + * When 'surface' is the surface associated with the current display, the + * display colormap will be updated with the requested colors. If + * SDL_HWPALETTE was set in SDL_SetVideoMode() flags, SDL_SetColors() + * will always return 1, and the palette is guaranteed to be set the way + * you desire, even if the window colormap has to be warped or run under + * emulation. + */ +extern DECLSPEC int SDLCALL SDL_SetColors(SDL_Surface *surface, + SDL_Color *colors, int firstcolor, int ncolors); + +/** + * Sets a portion of the colormap for a given 8-bit surface. + * 'flags' is one or both of: + * SDL_LOGPAL -- set logical palette, which controls how blits are mapped + * to/from the surface, + * SDL_PHYSPAL -- set physical palette, which controls how pixels look on + * the screen + * Only screens have physical palettes. Separate change of physical/logical + * palettes is only possible if the screen has SDL_HWPALETTE set. + * + * The return value is 1 if all colours could be set as requested, and 0 + * otherwise. + * + * SDL_SetColors() is equivalent to calling this function with + * flags = (SDL_LOGPAL|SDL_PHYSPAL). + */ +extern DECLSPEC int SDLCALL SDL_SetPalette(SDL_Surface *surface, int flags, + SDL_Color *colors, int firstcolor, + int ncolors); + +/** + * Maps an RGB triple to an opaque pixel value for a given pixel format + */ +extern DECLSPEC Uint32 SDLCALL SDL_MapRGB +(const SDL_PixelFormat * const format, + const Uint8 r, const Uint8 g, const Uint8 b); + +/** + * Maps an RGBA quadruple to a pixel value for a given pixel format + */ +extern DECLSPEC Uint32 SDLCALL SDL_MapRGBA +(const SDL_PixelFormat * const format, + const Uint8 r, const Uint8 g, const Uint8 b, const Uint8 a); + +/** + * Maps a pixel value into the RGB components for a given pixel format + */ +extern DECLSPEC void SDLCALL SDL_GetRGB(Uint32 pixel, + const SDL_PixelFormat * const fmt, + Uint8 *r, Uint8 *g, Uint8 *b); + +/** + * Maps a pixel value into the RGBA components for a given pixel format + */ +extern DECLSPEC void SDLCALL SDL_GetRGBA(Uint32 pixel, + const SDL_PixelFormat * const fmt, + Uint8 *r, Uint8 *g, Uint8 *b, Uint8 *a); + +/** @sa SDL_CreateRGBSurface */ +#define SDL_AllocSurface SDL_CreateRGBSurface +/** + * Allocate and free an RGB surface (must be called after SDL_SetVideoMode) + * If the depth is 4 or 8 bits, an empty palette is allocated for the surface. + * If the depth is greater than 8 bits, the pixel format is set using the + * flags '[RGB]mask'. + * If the function runs out of memory, it will return NULL. + * + * The 'flags' tell what kind of surface to create. + * SDL_SWSURFACE means that the surface should be created in system memory. + * SDL_HWSURFACE means that the surface should be created in video memory, + * with the same format as the display surface. This is useful for surfaces + * that will not change much, to take advantage of hardware acceleration + * when being blitted to the display surface. + * SDL_ASYNCBLIT means that SDL will try to perform asynchronous blits with + * this surface, but you must always lock it before accessing the pixels. + * SDL will wait for current blits to finish before returning from the lock. + * SDL_SRCCOLORKEY indicates that the surface will be used for colorkey blits. + * If the hardware supports acceleration of colorkey blits between + * two surfaces in video memory, SDL will try to place the surface in + * video memory. If this isn't possible or if there is no hardware + * acceleration available, the surface will be placed in system memory. + * SDL_SRCALPHA means that the surface will be used for alpha blits and + * if the hardware supports hardware acceleration of alpha blits between + * two surfaces in video memory, to place the surface in video memory + * if possible, otherwise it will be placed in system memory. + * If the surface is created in video memory, blits will be _much_ faster, + * but the surface format must be identical to the video surface format, + * and the only way to access the pixels member of the surface is to use + * the SDL_LockSurface() and SDL_UnlockSurface() calls. + * If the requested surface actually resides in video memory, SDL_HWSURFACE + * will be set in the flags member of the returned surface. If for some + * reason the surface could not be placed in video memory, it will not have + * the SDL_HWSURFACE flag set, and will be created in system memory instead. + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurface + (Uint32 flags, int width, int height, int depth, + Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask); +/** @sa SDL_CreateRGBSurface */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_CreateRGBSurfaceFrom(void *pixels, + int width, int height, int depth, int pitch, + Uint32 Rmask, Uint32 Gmask, Uint32 Bmask, Uint32 Amask); +extern DECLSPEC void SDLCALL SDL_FreeSurface(SDL_Surface *surface); + +/** + * SDL_LockSurface() sets up a surface for directly accessing the pixels. + * Between calls to SDL_LockSurface()/SDL_UnlockSurface(), you can write + * to and read from 'surface->pixels', using the pixel format stored in + * 'surface->format'. Once you are done accessing the surface, you should + * use SDL_UnlockSurface() to release it. + * + * Not all surfaces require locking. If SDL_MUSTLOCK(surface) evaluates + * to 0, then you can read and write to the surface at any time, and the + * pixel format of the surface will not change. In particular, if the + * SDL_HWSURFACE flag is not given when calling SDL_SetVideoMode(), you + * will not need to lock the display surface before accessing it. + * + * No operating system or library calls should be made between lock/unlock + * pairs, as critical system locks may be held during this time. + * + * SDL_LockSurface() returns 0, or -1 if the surface couldn't be locked. + */ +extern DECLSPEC int SDLCALL SDL_LockSurface(SDL_Surface *surface); +extern DECLSPEC void SDLCALL SDL_UnlockSurface(SDL_Surface *surface); + +/** + * Load a surface from a seekable SDL data source (memory or file.) + * If 'freesrc' is non-zero, the source will be closed after being read. + * Returns the new surface, or NULL if there was an error. + * The new surface should be freed with SDL_FreeSurface(). + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_LoadBMP_RW(SDL_RWops *src, int freesrc); + +/** Convenience macro -- load a surface from a file */ +#define SDL_LoadBMP(file) SDL_LoadBMP_RW(SDL_RWFromFile(file, "rb"), 1) + +/** + * Save a surface to a seekable SDL data source (memory or file.) + * If 'freedst' is non-zero, the source will be closed after being written. + * Returns 0 if successful or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_SaveBMP_RW + (SDL_Surface *surface, SDL_RWops *dst, int freedst); + +/** Convenience macro -- save a surface to a file */ +#define SDL_SaveBMP(surface, file) \ + SDL_SaveBMP_RW(surface, SDL_RWFromFile(file, "wb"), 1) + +/** + * Sets the color key (transparent pixel) in a blittable surface. + * If 'flag' is SDL_SRCCOLORKEY (optionally OR'd with SDL_RLEACCEL), + * 'key' will be the transparent pixel in the source image of a blit. + * SDL_RLEACCEL requests RLE acceleration for the surface if present, + * and removes RLE acceleration if absent. + * If 'flag' is 0, this function clears any current color key. + * This function returns 0, or -1 if there was an error. + */ +extern DECLSPEC int SDLCALL SDL_SetColorKey + (SDL_Surface *surface, Uint32 flag, Uint32 key); + +/** + * This function sets the alpha value for the entire surface, as opposed to + * using the alpha component of each pixel. This value measures the range + * of transparency of the surface, 0 being completely transparent to 255 + * being completely opaque. An 'alpha' value of 255 causes blits to be + * opaque, the source pixels copied to the destination (the default). Note + * that per-surface alpha can be combined with colorkey transparency. + * + * If 'flag' is 0, alpha blending is disabled for the surface. + * If 'flag' is SDL_SRCALPHA, alpha blending is enabled for the surface. + * OR:ing the flag with SDL_RLEACCEL requests RLE acceleration for the + * surface; if SDL_RLEACCEL is not specified, the RLE accel will be removed. + * + * The 'alpha' parameter is ignored for surfaces that have an alpha channel. + */ +extern DECLSPEC int SDLCALL SDL_SetAlpha(SDL_Surface *surface, Uint32 flag, Uint8 alpha); + +/** + * Sets the clipping rectangle for the destination surface in a blit. + * + * If the clip rectangle is NULL, clipping will be disabled. + * If the clip rectangle doesn't intersect the surface, the function will + * return SDL_FALSE and blits will be completely clipped. Otherwise the + * function returns SDL_TRUE and blits to the surface will be clipped to + * the intersection of the surface area and the clipping rectangle. + * + * Note that blits are automatically clipped to the edges of the source + * and destination surfaces. + */ +extern DECLSPEC SDL_bool SDLCALL SDL_SetClipRect(SDL_Surface *surface, const SDL_Rect *rect); + +/** + * Gets the clipping rectangle for the destination surface in a blit. + * 'rect' must be a pointer to a valid rectangle which will be filled + * with the correct values. + */ +extern DECLSPEC void SDLCALL SDL_GetClipRect(SDL_Surface *surface, SDL_Rect *rect); + +/** + * Creates a new surface of the specified format, and then copies and maps + * the given surface to it so the blit of the converted surface will be as + * fast as possible. If this function fails, it returns NULL. + * + * The 'flags' parameter is passed to SDL_CreateRGBSurface() and has those + * semantics. You can also pass SDL_RLEACCEL in the flags parameter and + * SDL will try to RLE accelerate colorkey and alpha blits in the resulting + * surface. + * + * This function is used internally by SDL_DisplayFormat(). + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_ConvertSurface + (SDL_Surface *src, SDL_PixelFormat *fmt, Uint32 flags); + +/** + * This performs a fast blit from the source surface to the destination + * surface. It assumes that the source and destination rectangles are + * the same size. If either 'srcrect' or 'dstrect' are NULL, the entire + * surface (src or dst) is copied. The final blit rectangles are saved + * in 'srcrect' and 'dstrect' after all clipping is performed. + * If the blit is successful, it returns 0, otherwise it returns -1. + * + * The blit function should not be called on a locked surface. + * + * The blit semantics for surfaces with and without alpha and colorkey + * are defined as follows: + * + * RGBA->RGB: + * SDL_SRCALPHA set: + * alpha-blend (using alpha-channel). + * SDL_SRCCOLORKEY ignored. + * SDL_SRCALPHA not set: + * copy RGB. + * if SDL_SRCCOLORKEY set, only copy the pixels matching the + * RGB values of the source colour key, ignoring alpha in the + * comparison. + * + * RGB->RGBA: + * SDL_SRCALPHA set: + * alpha-blend (using the source per-surface alpha value); + * set destination alpha to opaque. + * SDL_SRCALPHA not set: + * copy RGB, set destination alpha to source per-surface alpha value. + * both: + * if SDL_SRCCOLORKEY set, only copy the pixels matching the + * source colour key. + * + * RGBA->RGBA: + * SDL_SRCALPHA set: + * alpha-blend (using the source alpha channel) the RGB values; + * leave destination alpha untouched. [Note: is this correct?] + * SDL_SRCCOLORKEY ignored. + * SDL_SRCALPHA not set: + * copy all of RGBA to the destination. + * if SDL_SRCCOLORKEY set, only copy the pixels matching the + * RGB values of the source colour key, ignoring alpha in the + * comparison. + * + * RGB->RGB: + * SDL_SRCALPHA set: + * alpha-blend (using the source per-surface alpha value). + * SDL_SRCALPHA not set: + * copy RGB. + * both: + * if SDL_SRCCOLORKEY set, only copy the pixels matching the + * source colour key. + * + * If either of the surfaces were in video memory, and the blit returns -2, + * the video memory was lost, so it should be reloaded with artwork and + * re-blitted: + * @code + * while ( SDL_BlitSurface(image, imgrect, screen, dstrect) == -2 ) { + * while ( SDL_LockSurface(image) < 0 ) + * Sleep(10); + * -- Write image pixels to image->pixels -- + * SDL_UnlockSurface(image); + * } + * @endcode + * + * This happens under DirectX 5.0 when the system switches away from your + * fullscreen application. The lock will also fail until you have access + * to the video memory again. + * + * You should call SDL_BlitSurface() unless you know exactly how SDL + * blitting works internally and how to use the other blit functions. + */ +#define SDL_BlitSurface SDL_UpperBlit + +/** This is the public blit function, SDL_BlitSurface(), and it performs + * rectangle validation and clipping before passing it to SDL_LowerBlit() + */ +extern DECLSPEC int SDLCALL SDL_UpperBlit + (SDL_Surface *src, SDL_Rect *srcrect, + SDL_Surface *dst, SDL_Rect *dstrect); +/** This is a semi-private blit function and it performs low-level surface + * blitting only. + */ +extern DECLSPEC int SDLCALL SDL_LowerBlit + (SDL_Surface *src, SDL_Rect *srcrect, + SDL_Surface *dst, SDL_Rect *dstrect); + +/** + * This function performs a fast fill of the given rectangle with 'color' + * The given rectangle is clipped to the destination surface clip area + * and the final fill rectangle is saved in the passed in pointer. + * If 'dstrect' is NULL, the whole surface will be filled with 'color' + * The color should be a pixel of the format used by the surface, and + * can be generated by the SDL_MapRGB() function. + * This function returns 0 on success, or -1 on error. + */ +extern DECLSPEC int SDLCALL SDL_FillRect + (SDL_Surface *dst, SDL_Rect *dstrect, Uint32 color); + +/** + * This function takes a surface and copies it to a new surface of the + * pixel format and colors of the video framebuffer, suitable for fast + * blitting onto the display surface. It calls SDL_ConvertSurface() + * + * If you want to take advantage of hardware colorkey or alpha blit + * acceleration, you should set the colorkey and alpha value before + * calling this function. + * + * If the conversion fails or runs out of memory, it returns NULL + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormat(SDL_Surface *surface); + +/** + * This function takes a surface and copies it to a new surface of the + * pixel format and colors of the video framebuffer (if possible), + * suitable for fast alpha blitting onto the display surface. + * The new surface will always have an alpha channel. + * + * If you want to take advantage of hardware colorkey or alpha blit + * acceleration, you should set the colorkey and alpha value before + * calling this function. + * + * If the conversion fails or runs out of memory, it returns NULL + */ +extern DECLSPEC SDL_Surface * SDLCALL SDL_DisplayFormatAlpha(SDL_Surface *surface); + + +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ +/** @name YUV video surface overlay functions */ /*@{*/ +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ + +/** This function creates a video output overlay + * Calling the returned surface an overlay is something of a misnomer because + * the contents of the display surface underneath the area where the overlay + * is shown is undefined - it may be overwritten with the converted YUV data. + */ +extern DECLSPEC SDL_Overlay * SDLCALL SDL_CreateYUVOverlay(int width, int height, + Uint32 format, SDL_Surface *display); + +/** Lock an overlay for direct access, and unlock it when you are done */ +extern DECLSPEC int SDLCALL SDL_LockYUVOverlay(SDL_Overlay *overlay); +extern DECLSPEC void SDLCALL SDL_UnlockYUVOverlay(SDL_Overlay *overlay); + +/** Blit a video overlay to the display surface. + * The contents of the video surface underneath the blit destination are + * not defined. + * The width and height of the destination rectangle may be different from + * that of the overlay, but currently only 2x scaling is supported. + */ +extern DECLSPEC int SDLCALL SDL_DisplayYUVOverlay(SDL_Overlay *overlay, SDL_Rect *dstrect); + +/** Free a video overlay */ +extern DECLSPEC void SDLCALL SDL_FreeYUVOverlay(SDL_Overlay *overlay); + +/*@}*/ + +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ +/** @name OpenGL support functions. */ /*@{*/ +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ + +/** + * Dynamically load an OpenGL library, or the default one if path is NULL + * + * If you do this, you need to retrieve all of the GL functions used in + * your program from the dynamic library using SDL_GL_GetProcAddress(). + */ +extern DECLSPEC int SDLCALL SDL_GL_LoadLibrary(const char *path); + +/** + * Get the address of a GL function + */ +extern DECLSPEC void * SDLCALL SDL_GL_GetProcAddress(const char* proc); + +/** + * Set an attribute of the OpenGL subsystem before intialization. + */ +extern DECLSPEC int SDLCALL SDL_GL_SetAttribute(SDL_GLattr attr, int value); + +/** + * Get an attribute of the OpenGL subsystem from the windowing + * interface, such as glX. This is of course different from getting + * the values from SDL's internal OpenGL subsystem, which only + * stores the values you request before initialization. + * + * Developers should track the values they pass into SDL_GL_SetAttribute + * themselves if they want to retrieve these values. + */ +extern DECLSPEC int SDLCALL SDL_GL_GetAttribute(SDL_GLattr attr, int* value); + +/** + * Swap the OpenGL buffers, if double-buffering is supported. + */ +extern DECLSPEC void SDLCALL SDL_GL_SwapBuffers(void); + +/** @name OpenGL Internal Functions + * Internal functions that should not be called unless you have read + * and understood the source code for these functions. + */ +/*@{*/ +extern DECLSPEC void SDLCALL SDL_GL_UpdateRects(int numrects, SDL_Rect* rects); +extern DECLSPEC void SDLCALL SDL_GL_Lock(void); +extern DECLSPEC void SDLCALL SDL_GL_Unlock(void); +/*@}*/ + +/*@}*/ + +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ +/** @name Window Manager Functions */ +/** These functions allow interaction with the window manager, if any. */ /*@{*/ +/* * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * */ + +/** + * Sets the title and icon text of the display window (UTF-8 encoded) + */ +extern DECLSPEC void SDLCALL SDL_WM_SetCaption(const char *title, const char *icon); +/** + * Gets the title and icon text of the display window (UTF-8 encoded) + */ +extern DECLSPEC void SDLCALL SDL_WM_GetCaption(char **title, char **icon); + +/** + * Sets the icon for the display window. + * This function must be called before the first call to SDL_SetVideoMode(). + * It takes an icon surface, and a mask in MSB format. + * If 'mask' is NULL, the entire icon surface will be used as the icon. + */ +extern DECLSPEC void SDLCALL SDL_WM_SetIcon(SDL_Surface *icon, Uint8 *mask); + +/** + * This function iconifies the window, and returns 1 if it succeeded. + * If the function succeeds, it generates an SDL_APPACTIVE loss event. + * This function is a noop and returns 0 in non-windowed environments. + */ +extern DECLSPEC int SDLCALL SDL_WM_IconifyWindow(void); + +/** + * Toggle fullscreen mode without changing the contents of the screen. + * If the display surface does not require locking before accessing + * the pixel information, then the memory pointers will not change. + * + * If this function was able to toggle fullscreen mode (change from + * running in a window to fullscreen, or vice-versa), it will return 1. + * If it is not implemented, or fails, it returns 0. + * + * The next call to SDL_SetVideoMode() will set the mode fullscreen + * attribute based on the flags parameter - if SDL_FULLSCREEN is not + * set, then the display will be windowed by default where supported. + * + * This is currently only implemented in the X11 video driver. + */ +extern DECLSPEC int SDLCALL SDL_WM_ToggleFullScreen(SDL_Surface *surface); + +typedef enum { + SDL_GRAB_QUERY = -1, + SDL_GRAB_OFF = 0, + SDL_GRAB_ON = 1, + SDL_GRAB_FULLSCREEN /**< Used internally */ +} SDL_GrabMode; +/** + * This function allows you to set and query the input grab state of + * the application. It returns the new input grab state. + * + * Grabbing means that the mouse is confined to the application window, + * and nearly all keyboard input is passed directly to the application, + * and not interpreted by a window manager, if any. + */ +extern DECLSPEC SDL_GrabMode SDLCALL SDL_WM_GrabInput(SDL_GrabMode mode); + +/*@}*/ + +/** @internal Not in public API at the moment - do not use! */ +extern DECLSPEC int SDLCALL SDL_SoftStretch(SDL_Surface *src, SDL_Rect *srcrect, + SDL_Surface *dst, SDL_Rect *dstrect); + +/* Ends C function definitions when using C++ */ +#ifdef __cplusplus +} +#endif +#include "close_code.h" + +#endif /* _SDL_video_h */ diff --git a/apps/plugins/sdl/include/begin_code.h b/apps/plugins/sdl/include/begin_code.h new file mode 100644 index 0000000..27e2f7b --- /dev/null +++ b/apps/plugins/sdl/include/begin_code.h @@ -0,0 +1,196 @@ +/* + SDL - Simple DirectMedia Layer + Copyright (C) 1997-2012 Sam Lantinga + + This library is free software; you can redistribute it and/or + modify it under the terms of the GNU Library General Public + License as published by the Free Software Foundation; either + version 2 of the License, or (at your option) any later version. + + This library is distributed in the hope that it will be useful, + but WITHOUT ANY WARRANTY; without even the implied warranty of + MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU + Library General Public License for more details. + + You should have received a copy of the GNU Library General Public + License along with this library; if not, write to the Free + Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA + + Sam Lantinga + slouken@libsdl.org +*/ + +/** + * @file begin_code.h + * This file sets things up for C dynamic library function definitions, + * static inlined functions, and structures aligned at 4-byte alignment. + * If you don't like ugly C preprocessor code, don't look at this file. :) + */ + +/** + * @file begin_code.h + * This shouldn't be nested -- included it around code only. + */ +#ifdef _begin_code_h +#error Nested inclusion of begin_code.h +#endif +#define _begin_code_h + +/** + * @def DECLSPEC + * Some compilers use a special export keyword + */ +#ifndef DECLSPEC +# if defined(__BEOS__) || defined(__HAIKU__) +# if defined(__GNUC__) +# define DECLSPEC +# else +# define DECLSPEC __declspec(export) +# endif +# elif defined(__WIN32__) +# ifdef __BORLANDC__ +# ifdef BUILD_SDL +# define DECLSPEC +# else +# define DECLSPEC __declspec(dllimport) +# endif +# else +# define DECLSPEC __declspec(dllexport) +# endif +# elif defined(__OS2__) +# ifdef __WATCOMC__ +# ifdef BUILD_SDL +# define DECLSPEC __declspec(dllexport) +# else +# define DECLSPEC +# endif +# elif defined (__GNUC__) && __GNUC__ < 4 +# /* Added support for GCC-EMX = 4 +# define DECLSPEC __attribute__ ((visibility("default"))) +# else +# define DECLSPEC +# endif +# endif +#endif + +/** + * @def SDLCALL + * By default SDL uses the C calling convention + */ +#ifndef SDLCALL +# if defined(__WIN32__) && !defined(__GNUC__) +# define SDLCALL __cdecl +# elif defined(__OS2__) +# if defined (__GNUC__) && __GNUC__ < 4 +# /* Added support for GCC-EMX